ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • General Chemistry  (4,739)
  • Inorganic Chemistry  (3,699)
  • Animals
  • 1960-1964  (8,438)
Collection
Publisher
Years
Year
  • 1
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 303 (1960), S. 46-52 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The RAMAN spectra of aqueous solutions of NaHSeO3, KHSeO3, Na2Se2O5, K2Se2O5, (NH4)2Se2O5, and that of NaDSeO3 in D2O are given at different concentrations. All spectra are identical. In these solutions following equilibrium is existing: O2SeOSeO2″ + H2O ⇄ 2 HOSeO2-. Tautomerism of the HOSeO2--ion is excluded. The splitting of the OH-stretching band of HOSeO2- in the IR-spectrum of a saturated solution of KHSeO3 in H2O is correlated to strong H-bonds.
    Notes: Es werden die- RAMAN-Spektren von NaHSeO3, KHSeO3, Na2Se2O5, K2Se2O5 und (NH4)2Se2O5 in H2O und das von NaDSeO3 in D2O bei verschiedenen Konzentrationen mitgeteilt. Sämtliche Spektren sind identisch (siehe die analogen S-Verbindungen). Es wird gezeigt, daß in diesen Lösungen Pyroselenitionen und Hydrogenselenitionen nebeneinander im Gleichgewicht vorliegen: \documentclass{article}\pagestyle{empty}\begin{document}$$ {\rm O}_{\rm 2} {\rm SeOSeO}_{_2}^{''} + {\rm H}_{\rm 2} {\rm O} \mathbin{\lower.3ex\hbox{$\buildrel\textstyle\rightarrow\over {\smash{\leftarrow}\vphantom{_{\vbox to.5ex{\vss}}}}$}} 2{\rm HOSeO}_{\rm 2}^{'} $$\end{document} Eine Tautomerie der Hydrogenselenitionen wird ausgeschlossen. Die Aufspaltung der OH-Valenzbande des Hydrogenselenitions im IR-Spektrum einer gesättigten wäßrigen KHSeO3-Lösung wird auf starke H-Brücken zurückgeführt.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 303 (1960), S. 79-84 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: RAMAN and IR-spectra of (CH3O)2SeO, (C2H5O)2SeO, and CH3O · SeO · OC2H5 are given and discussed. Because of the fact that couplings between the CH-oscillations within the alkyl groups and between CH-oscillations and that of the C—O—-Se-sceletons are allowed to be neglected, it is possible to discuss the spectra.
    Notes: Es werden die RAMAN- und IR-Spektren von Dimethylselenit, Diäthylselenit und Methyläthyselenit mitgeteilt und diskutiert. Kopplungen zwischen den Alkylschwingungen der einzelnen Molekeln einerseits und zwischen den Alkylschwingungen und denen der COSe-Gerüste andererseits sind vernachlässigbar klein. Dadurch ist die Zuordnung der Gerüstfrequenzen möglich.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 303 (1960), S. 85-89 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The cristalline products of the formula Si3Cl6C3H6 which are formed from CH3SiCl3 and (CH3)2SiCl2 at 700°C, proved to be identical. This Si-hexachloro-cyclocarbosilane can be converted into Si3Cl6C3Cl6 by photochlorination in boiling CCl4. The ring remains unattacked. Si3Cl6C3Cl6 is a white crystalline sublimable compound, which is completely hydrolysed in aqueous alkali (3% NaOH) according to This complete hydrolysis of the molecule provides a proof for the structural formula of the Si3Cl6C3H6. A partial cleavage of the C—Cl bond takes place, if more concentrated alkali is used (30% NaOH).
    Notes: Die aus CH3SiCl3 und (CH3)2SiCl2 bei 700°C gewonnenen kristallinen Produkte der Formel Si3Cl6C3H6 sind identisch. Dieses Si-hexachlor-cyclocarbosilan läßt sich unter Erhaltung des Ringes in siedendem CCl4 vollständig zum Si3Cl6C3Cl6 photochlorieren. Es ist eine weiße, kristalline sublimierbare Verbindung, die bei der Hydrolyse mit 3proz. NaOH quantitativ gespalten wird nach Damit ist die Strukturformel des Si3Cl6C6H6 durch Chlorierung und Abbau der Molekel belegt. Bei höherer Alkalität (30proz. NaOH) erfolgt auch eine teilweise Aufspaltung der C—Cl-Bindung.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 4
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 303 (1960), S. 90-95 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: According to thermal analysis and x-ray investigation two compounds of the composition K3Fe(SO4)3 and KFe(SO4)3 and KFe(SO4)2 exist in the system K2SO4—Fe2(SO4)3. The compound K3Fe(SO4)3 is melting congruent at 703°C and has a reversible transformation point at about 250°C. It has a noticeable solubility for K2SO4 and Fe2(SO4)3 in the solid state. The compound KFe(SO4)2 is decomposed below the melting point. The eutectic point between K2SO4 and K3Fe(SO4)3 is 627°C and between K3Fe(SO4)3 and KFe(SO4)2 is 693°C.
    Notes: Nach der thermischen Analyse und röntgenographischen Untersuchungen treten im System K2SO4—Fe2(SO4)3 zwei Verbindungen der Zusammensetzung K3Fe(SO4)3 und KFe(SO4)2 auf. Die Verbindung K3Fe(SO4)3 schmilzt kongruent bei 703°C und besitzt bei etwa 250°C eine reversible Phasenumwandlung. Sie besitzt im festen Zustand eine merkliche Löslichkeit för K2SO4 und Fe2(SO4)3. Die Verbindung KFe(SO4)2 zersetzt sich unterhalb des Schmelzpunktes. Die eutektische Temperatur zwischen K2SO4 und K3Fe(SO4)3 beträgt 627°C, die zwischen K3Fe(SO4)3 und KFe(SO4)2 693°C.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: For the handling of air-sensitive fluids, especially for the investigation of the silanes, a new experimental technique is described. It enables to work with such compounds at the usual chemical and physical-chemical methods, even outside of a closed apparatus. As an essential auxiliary means injection syringes, cannulas and piercing rubber caps are used. The single operations are all easily and safely to carry out and the necessary variations of the apparatus in use are insignificant. The same apparatus means can be used also for the handling of volatile substances which can be condensed below room temperature.
    Notes: Zur Handhabung von luftempfindlichen Flüssigkeiten, insbesondere für die Untersuchung der Silane, Wird eine neue Arbeitstechnik beschrieben. Sie gestattet, mit derartigen Verbindungen auch außerhalb einer geschlossen Apparatur nach den gewöhnlichen chemischen und physikalisch-chemischen Methoden zu experimentieren. Als wesentliche Hilfsmittel werden Injektionsspritzen, Kanülen und Durchstichkappen verwendet. Die einzelnen Operationen sind sämtlich leicht und sicher durchführbar, und die erforderliche Veränderung an den gebräuchlichen Apparaturen ist geringfügig. Die gleichen apparativen Hilfsmittel Können auch für die Handhabung von flüchtigen, unterhalb Raumtemperatur kondensierbaren Substanzen verwendet werden.
    Additional Material: 8 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 303 (1960), S. 303-315 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The preparation of acid and neutral decavanadates of sodium, potassium, and tri-n-butylammonium from solutions of PH from 1.5 to 7 is described.By means of spectrophotometric measurements the degree of condensation of polyvanadates occuring in solutions of varying PH has been estimated. Only four stable anions are supposed to exist: mono-, di-, tetra-, and decavanadate.The unstable deep red isopolyvanadate being formed as an intermediate species on acidifying vanadate solutions is probably a dodecavanadate.
    Notes: Im PH-Bereich von 1,5-7 werden Kalium- und Natriumisopolyvanadate gewonnen, die als saure oder neutrale Dekavanadate bzw. als Gemische beider vorliegen. Daraus hergestellte Tri-n-butylammoniumsalze werden ebenfalls als Dekavanadate betrachtet.Mit Hilfe der Messung der Extinktion von Vanadatlösungen nach verschiedenem Säurezusatz wurde die Kondensation der Vanadationen verfolgt. Aus den gefundenen Diagrammen ergibt sich, daß nur vier Anionenarten existieren, die als Mono-, Di-, Tetra- und Dekavanadat formuliert werden können. Salzkryoskopische Bestimmungen des Molekulargewichts der Dekavanadate lieferten keine sicheren Ergebnisse.Dem beim Ansäuern von Vanadatlösungen entstehenden, wenig beständigen, tiefroten Isopolyvanadat wird die Formel eines Dodekavanadats erteilt.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 304 (1960), S. 181-184 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: All modifications of iron(III) hydroxide are transformed into silver-iron(III) oxide, AgFeO2, by reaction with freshly precipitated silver oxide in hot sodium hydroxide solutions. The transformations having different velocities for the indicidual iron(III) hydroxide species occur in the liquid phase.The Structure of AgFeO2 is similar to that of α-NaFeO2.
    Notes: Alle Modifikationen von Eisen(III)-hydroxid werden nach der Vorschrift von Krause, d. h. durch Erwärmen mit gefälltem Silberoxid in Natronlauge, in Silbereisenoxid AgFeO2 umgewandelt, wenn auch sehr verschieden rasch. Die Umsetzung erfolgt über die Lösung. AgFeO2 besitzt eine ähnliche Struktur wie α-NaFeO2.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 304 (1960), S. 191-195 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Die Trennung der leichten seltenen Erden durch Elution mit Natriumtriphosphat ist im ph-Bereich von 5-8 untersucht worden. Bei der Trennung von Sm—Nd- und Pr-La-Konzentraten konnten zufriedenstellende Ergebnisse mit einem 0, 2proz. Elutionsmittel bei ph 6 erhalten werden, jedoch ist der Trenneffekt bei Nd—Pr gering. Im allgemeinen sind die Trenneffekte bei diesen höheren ph-Werten weniger scharf als beim ph 3,6, jedoch hat diese Arbeitsweise den Vorteil, daß beträchtlich weniger Elutionsmittel verbraucht wird.
    Notes: Separation of light rare earths by elution with sodium triphosphate in the Ph range 5-8 has been studied. Satisfactory resolutions of Sm—Nd and Pr—La concentrates are obtained with a 0.2% eluant at Ph 6. Fractionation of the Nd—Pr pair is poor. In general separations at this higher Ph are not as clear-cut as at ph 3.6, but have the advantage of a considerable saving in the consumption of triphosphate.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 304 (1960), S. 196-206 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The interaction between guanidinium 12-molybdatophosphate and guanidinium carbonate, between sodium 12-wolframato- and 12-molybdatophosphate, respectively, and NaOH, and between potassium 12-wolframatosilicate and KOH has been investigated.The addition of even small amounts of alkali to the solutions of the dodeca-salts results in the formation of “unsaturated” heteropoly compounds. At these conditions, the existence of the so-called salts of high substitution has not been confirmed. The basicity of a saturated heteropoly acid is that of the nonmetal acid present in the mid-point of the structure.
    Notes: Es wurden die Reaktionen von Guanidinphosphor-12-molybdat mit Guanidinecarbonat, von Natriumphosphor-12-wolframat und Natriumphosphor-12-molybdat mit NaOH, von Kaliumsilico-12-wolframat mit KOH untersucht.Dabei wurde gefunden, daß selbst kleine Mengen von hinzugefügtem Alkali zu einer Erhöhung der ph-Werte der untersuchten Lösungen und zur Bildung der Heteropolyverbindungen ungesättigter Reihen führen.Die Existenz der sogenannten Heteropolysalze hoher Substitution unter den beschriebenen Bedingungen ist widerlegt worden.Die Basizität der Heteropolysäuren entspricht der Basizität der Nichtmetall-Säure, welche in der Struktur der Heteropolysäuren enthalten ist.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 304 (1960), S. 207-217 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The ion exchange behaviour of kaolinite and illite has been studied with solutions of Ag+, Sr2+ and Y3+ ions labeled with 110Ag, 90Sr and 90Y respectively. The observed ion exchange capacities are in good agreement with values obtained by conventional methods. An extremely high selectivity of kaolinite for Y3+ ions was observed when Sr2+ and Y3+ ions were offered simultaneously. The proportion of Y3+:Sr2+ ions taken up from solutions of equal normality for both ions is 103 or higher.
    Notes: Unter Verwendung von 110Ag, 90Sr und 90Y wurde der Eintausch von Ag+-, Sr2+- und Y3+-Ionen aus 1 n-Lösungen an Kaolinit und Illit gemessen. Die für das Kationenaustauschvermögen gefundenen Werte stimmen gut mit den nach anderen Methoden bestimmten Werten überein. Bei gleichzeitigem Angebot von Y3+ und Sr2+-Ionen wurde eine außerordentlich hohe Selektivität des Kaolinits für Yttrium-Ionen beobachtet (das Verhältnis der vom Kaolinit aus äquivalenten Lösungen eingetauschten Ionen Y3+: Sr2+ war von der Größenordnung 103 oder größer). Die Vorteile der radiochemischen Bestimmung des Ionenaustauschvermögens werden diskutiert.
    Additional Material: 5 Tab.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 304 (1960), S. 238-240 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The preparation and the properties of several alkoxydes of tungsten of the formula WO(OR)4 are described.
    Notes: Darstellung und Eigenschaften einiger Alkoxyverbindungen des Wolframs von der Formel WO(OR)4 werden beschrieben. (R = Methyl, äthyl, Propyl, Butyl und Benzyl.)
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 304 (1960), S. 230-237 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Dimethyl boric acid reacts with KOH and ammonia giving the addition compounds K[(CH3)2B(OH)2] and (CH3)2BOH. NH3. The reaction with potassium metal in liquid ammonia does not result in the salt K[(CH3)2BO], because this product immediately dismutates into B(CH3)3 and K2[CH3BO2], Which is stabilised by the addition of two molecules of (CH3)2B(OH). The resulting salt K2[B3(CH3)5O2(OH)2] has been investigated. The reasons for the instability of the salts of the methylboric acids are discussed.
    Notes: Mit Kaliumhydroxyd und Ammoniak bildet Dimethylborsäure die Anlagerungsprodukte K[(CH3)2B(OH)2] und (CH3)2BOH · NH3. Die Umsetzung mit Kalium in flüssigem Ammoniak ergibt nicht das Kaliumsalz [(CH3)2BO]K. Dieses dismutiert vielmehr unter den Reaktionsbedingungen in Trimethylbor und das Kaliumsalz der Methylborsäure K2[CH3BO2], das sich durch Anlagerung von zwei weiteren Molekeln Dimethylborsäure zum K2[B3(CH3)5O2(OH)2], Dikalium-Dihydrogenpentamethyltriborat stabilisiert. Diese Verbindung wird näher untersucht. Die Gründe für die Instabilität der Ionen der monomeren Methylborsäuren werden diskutiert.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 13
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 207-215 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Bestimmung der Beständigkeitskonstanten einiger Kupfer-Biguanidin-Komplexe; Diskussion der Abhängigkeit der Beständigkeit der Chelate von der Basenstärke der Liganden.
    Notes: The sucessive instability constants of some copper biguanide complexes have been determined by potentiometric measurements. The dependence of chelate stability upon the basic strength of the ligands has been discussed.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 14
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 190-197 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The crystals of S6(NH)2 as well as of S7NH were found to be of orthorhombic symmetry like the crystals of S4(NH)4. The space group is D2h16-Pbnm, with 4 formula units per unit cell. The lattice constants are: S6(NH)2 a = 7,386 Å, b = 7,864 Å, c = 12,828 Å; S7NH a = 7,61 Å, b = 8,04 Å, c = 13,03 Å. The structures have been determined from three-dimensional X-ray data. Both compounds are puckered eight-membered rings, like S8 and S4(NH)4 The NH-groups of S6(NH)2 are located in 1-5 position.
    Notes: Die Verbindungen S6(NH)2 und S7NH kristallisieren beide, genau wie S4(NH)4, rhombisch, in der Raumgruppe D2h16-Pbnm, mit 4 Molekeln in der Elementarzelle. Die Gitterkonstanten sind: S6(NH)2 a = 7,386 Å, b = 7,864 Å, c = 12,828 Å, S7NH a = 7,61 Å, b = 8,04 Å, c = 13,03 Å. Die Strukturen wurden mittels dreidimensionaler Fourier-Synthesen bestimmt. Beide Verbindungen bilden, wie S8 und S4(NH)4, einen gewellten 8-Ring. Die beiden NH-Gruppen im S6(NH)2 stehen in 1,5-Stellung.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 178-189 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The enthalpy of formation of tantalum tetrachloride has been estimated by determination of the heat of solution; δDLH(TaCl4, 298) = -168.8 ± 0.5 kcal/mole.The enthalpie of formation of TaCl5(s), TaCl5(g), TaCl4(s), TaCl4(g), and TaCl3(s) as also estimated values of their standard entropies and Cp-functions are given. All the data permit a clear interpretation of the hitherto known experimental results on the lower tantalum chlorides.
    Notes: Die Bildungsenthalpie des Tantaltetrachlorids wurde im Lösungscalorimeter gemessen δDLH(TaCl4, 298) = -168,8 ± 0,5 kcal/Mol.Für die Stoffe TaCl5 f, TaCl5 g, TaCl4 f, TaCl4 g und TaCl3 f sind jetzt die Bildung enthalpien verfügbar. Diese, sowie geschätzte Werte für die Normalentropien und Cp-Funktionen werden mitgeteilt. Das damit vorhandene Zahlenmaterial gestattet widerspruchsfreie Deutung aller mit niederen Tantalchloriden vorliegenden experimentellen Befunde.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 25-39 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Conditions are given for the preparation of seven metals, Cr, Cu, Fe, Si, Ti, Ta and Nb by the thermal decomposition of their volatile iodides in a simplified DE BOER bulb. Some of the properties of these metallic elements are described. Yttrium could not be prepared by the thermal decomposition of its iodide at 1200 °C.
    Notes: Es werden die Bedingungen für die Darstellung der sieben Metalle Cr, Cu, Fe, Si, Ti, Ta und Nb durch die Zersetzung ihrer flüchtigen Jodide in einer vereinfachten DE BOER-Apparatur beschrieben. Die Eigenschaften dieser Metalle werden angegeben. Es gelang nicht, Yttrium durch die thermische Zersetzung seines Jodids bei 1200 °C darzustellen.
    Additional Material: 19 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 15-24 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By reaction of anhydrous CoBr2 and (C6H5)2PH in absolute methanol three different complex compounds of the compositions [{(C6H5)2PH}3CoBr2], [{(C6H5)2PH}3CoBr]Br, and [{(C6H5)2PH}4CoBr]2Br2 are successively formed. Their structural configuration is discussed on the basis of molecular weight determinations, magnetic measurements and such of the conductivity, respectively.The reactions between (C6H5)2PH and NiBr2, PdCl2, or CuBr result in the formation of complexes of different constitutions.
    Notes: Aus wasserfreiem CoBr2 und (C6H5)2PH entstehen in absolutem Methanol nacheinander drei verschiedene Komplexverbindungen. Das sich zuerst bildende [{(C6H5)2PH}3CoBr2] liegt in Benzol monomer vor und besitzt Nichtelektrolytcharakter. Das magnetische Moment von 2,01 BM spricht deutlich für einen trigonal-bipyramidalen Bau des Komplexes. Des weiteren kann ein isomerer Komplex der Zusammensetzung [{(C6H5)2PH}3CoBr]Br isoliert werden, der eine Leitfähigkeit im Ausmaß eines binären Elektrolyten aufweist. Das magnetische Verhalten von 3,37 BM läßt auf einen tetraedrisch konfigurierten Komplex schließen. Und schließlich entsteht ein Zweikernkomplex der Formel [{(C6H5)2PH}4CoBr]2Br2, dessen diamagnetisches Verhalten eine Kobalt-Kobalt-Wechselwirkung vermuten läßt.NiBr2 reagiert mit (C6H5)2PH unter HBr-Abspaltung und Bildung des [{(C6H5)2PH}2Ni{P(C6H5)2}2], das auf Grund des diamagnetischen Verhaltens planquadratische Struktur besitzt.Unter Verwendung von PdCl2 entsteht mit (C6H5)2PH unter teilweiser HCl-Abspaltung ein Zweikernkomplex, [(C6H5)2PHPdP(C6H5)2Cl]2, der in Nitrobenzol keine Leitfähigkeit zeigt und darin dimer vorliegt.Wie aus den magnetischen Messungen und Molekulargewichtsbestimmungen hervorgeht, entsteht aus CuBr und (C6H5)2PH ein tetramerer, farbloser Komplex, [(C6H5)2PHCuBr]4, mit tetraedrischer Konstitution.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 18
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 40-54 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The system Fe-Ti-O has been investigated at a temperature of 1000 °C by means of CO2-CO-equilibria.By isothermal decomposition of numerous Fe2O3-TiO2-mixtures, the isothermal phase diagram of the system Fe-Ti-O at 1000 °C has been set up. Below the line FeO-TiO2, the compounds Fe2TiO4 and FeTiO3 occur; above that line, complete miscibilities for Fe3O4-Fe2TiO4 and Fe2O3-FeTiO3, respectively, as well as incomplete miscibility for Fe3O4-FeTiO3 are observed.The reduction of ilmenite and orthotitanate yields invariant equilibria the dependence of which upon temperature variations is used for the evaluation of respective thermodynamic data.There is an ideal miscibility between Fe3O4 and Fe2TiO4.
    Notes: Die Phasenverhältnisse im System Fe-Ti-O sind zur Zeit noch nicht vollständig bekannt. Drei Methoden der Gleichgewichtsmessung können herangezogen werden. Nachdem bereits früher mit der Methode der direkten Sauerstoffdruckmessung bei 1365 °C das Teildreieck: Fe2O3-TiO2-FeTiO3 untersucht worden war, wird im vorliegenden mit CO2-CO-Gleichgewichten der anschließende Bereich bis zur Linie Fe-TiO2 bei 1000 °C behandelt.Durch isothermen Abbau zahlreicher Mischungen von Fe2O3 und TiO2 bei 1000 °C wird das isotherme Phasendreieck Fe-Ti-O aufgestellt. Unterhalb der Linie FeO-TiO2 werden die Verhältnisse bestimmt durch die Verbindungen Fe2TiO4 und FeTiO3. Beide können etwas FeO lösen. Oberhalb der Linie FeO-TiO2 werden die vollständigen Mischbarkeiten Fe3O4-Fe2TiO4 und Fe2O3-FeTiO3 sowie die unvollständige Mischbarkeit Fe3O4-FeTiO3 angetroffen. Die bei 1365 °C angetroffene Mischreihe Fe2TiO5 und FeTi2O5 kann mit CO2-CO-Gleichgewichten nicht mehr erfaßt werden. Weil im Teildreieck FeTiO3-TiO2-Fe die Verbindung FeTi2O5 nicht vorkommt, müßte sie an der Grenzlinie FeTiO3-TiO2 in diese Stoffe disproportionieren, falls die zugehörige Mischreihe oberhalb der Grenzlinie bei 1000° existiert.Die Ilmenit- und Orthotitanatreduktion liefern univariante Gleichgewichte, deren Temperaturabhängigkeit beschrieben wird. Hieraus werden die zugehörigen thermodynamischen Größen hergeleitet. Die Idealität der Mischreihe Fe3O4-Fe2TiO4 wird festgestellt.
    Additional Material: 11 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 19
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 78-87 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The RAMAN-spectra of CH3SeO2Na, CH3SeO2K, C2H5SeO2Na, and C2H5SeO2K in solid state and in aqueous solution and the IR-spectra of these salts pressed in KBr are discussed. The ion C2H5SeO2 shows in solution rotational isomerism.
    Notes: Es werden die RAMAN-Spektren von CH3SeO2Na, CH3SeO2K, C2H5SeO2Na und C2H5SeO2K im festen Zustand und in wäßriger Lösung sowie die IR-Spektren dieser Salze gepreßt in KBr mitgeteilt und diskutiert. Die gefundenen Spektren stimmen gut mit den Erwartungsspektren überein. Das Äthanselenination liegt im gelösten Zustand in zwei rotationsisomeren Strukturen vor.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 20
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 64-77 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The heterogeneous electron transfer reaction between TlBr and the bromide complexes of TlIII has been investigated with 204Tl as a tracer isotope. The reaction was found to be catalyzed by UV - light. Experiments on the homogeneous exchange system TlI/TlIII in the presence of bromide as well as paperchromatographic experiments allowed to establish the following mechanisms for the overall reaction:alight decomposition of [TlBrn]3-n (n 〉 1) in to TlI and bromine,bheterogeneous TlI-exchange between TlBr and solution,cTlI -oxidation by bromine .It is possible to give a partial explanation for the zero time exchange which is observed when TlI is precipitated as TlBr from TlI/TlIII mixtures.
    Notes: Mit Hilfe des radioaktiven Isotops 204Tl wurden heterogene Elektronenaustauschversuche zwischen TlBr und TlIII-Bromidokomplexen durchgeführt. Dabei wurde festgestellt, daß die Reaktion durch UV-Licht beschleunigt wird. Homogene Versuche mit dem System TlI/TlIII in Gegenwart von Bromid sowie papierchromatographische Versuche erbrachten den Beweis, daß die [TlBrn]3-n-Komplexe mit n 〉 1 unter Einwirkung von UV-Strahlung in TlI und Brom zerfallen. Die heterogene Elektronenaustauschreaktion kann somit in folgende Teilreaktionen zerlegt werden:aden Zerfall der [TlBrn]3-n-Komplexe in TlI und Brom,bden heterogenen TlI-Austausch zwischen Lösung und Niederschlag,cdie Oxydation von TlI durch Brom.Es war möglich, den bei TlBr-Fällung aus TlI/TlIII-Mischungen auftretenden Nullzeitaustausch (zero time exchange) teilweise zu erklären.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 21
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 88-97 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The RAMAN-spectra of CH3SeO2H and C2H5SeO2H in different states (solid, in H2O, in CH3OH) and the IR-spectra in KBr are given and discussed. Strong H-bonds, which are strongest in CH3SeO2H, cause association in solid and in solved state. The molecule C2H5SeO2H forms in solution (in H2O, in CH3OH, in KBr) two rotational isomeric configurations. In contrast to the compounds H2SeO3 and RO · SeO · OH, methanol does no esterify CH3SeO2H and C2H5SeO2H. Some chemical, physical, and physiologic properties are given.
    Notes: Es werden die RAMAN-Spektren der Methan- und Äthanseleninsäure in verschiedenen Zuständen (fest, in H2O, in CH3OH) sowie die IR-Spektren in KBr mitgeteilt und diskutiert. Starke H-Brückenbindungskräfte, die in der Methanverbindung etwas stärker sind, bewirken sowohl im festen Zustand als auch in Lösung Assoziation. Die Äthanseleninsäure existiert in Lösung (in H2O, in CH3OH, in KBr) in zwei rotationsisomeren Strukturen. Keine der Säuren wird durch Methanol im Gegensatz zur selenigen Säure und den alkylselenigen Säuren verestert. Einige chemische, physikalische und physiologische Eigenschaften werden angegeben.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 98-107 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The RAMAN-spectra of the compounds CH3SeOOH · HCl and C2H5SeOOH · HCl in solid state and in aqueous solutions as well as the IR-spectra of these compounds suspended in nujol or pressed in KCl are given and discussed. It results a structure with the general formula [R-Se(OH)2] Cl with two SeO-single bonds. The ions are connected in the lattice by H-bonds. Low dissociation of the cation occurs in aqueous solution. The ion [C2H5Se(OH)2]⊕ exists in aqueous solution in two rotational isomeric configurations.
    Notes: Es werden die RAMAN-Spektren der Verbindungen CH3SeOOH · HCl und C2H5SeOOH · HCl im festen Zustand und in wäßriger Lösung sowie die IR-Spektren dieser Verbindungen suspendiert in Nujol und gepreßt in KCl mitgeteilt und diskutiert. Es ergibt sich eine Struktur der allgemeinen Formel [R-Se(OH)2]Cl mit 2 SeO-Einfachbindungen. Die Ionen sind im Gitter über H-Brücken miteinander verbunden. In wäßriger Lösung findet geringe Dissoziation des Kations zur freien Säure statt. Das [C2H5Se(OH)2]⊕-Ion liegt in wäßriger Lösung in zwei rotationsisomeren Konfigurationen vor.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 116-120 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By means of electron diffractions, the steep gradients of the magnetic fields at the surface of an iron catalyst used for the ammonia synthesis and at the edge of a razor blade have been measured to be 6 · 105 and 9 · 105 Gauss/cm, respectively. The method allows to detect the catalytically active center of a ferromagnetic substance exhibiting the magnetocatalytic Hedvall-effect.
    Notes: An der Oberfläche des Eisenkatalysators für die Ammoniaksynthese und am Rande einer Rasierklinge werden die steilen Gefälle des Magnetfeldes, 6 · 105 und 9 · 105 Gauß/cm, mittels Elektronenstrahlen gemessen. Auf Grund dieses Befundes wird der aktive Ort der ferromagnetischen Substanz begreiflich, die den magnetokatalytischen Hedvall-Effekt aufweist.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 24
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 55-63 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The change of the absorption of light and of the pH with the time in 0,1 m. Na2WO4- solutions acidified under well defined circumstances, has been determined. It is concluded that the intermediate compound at the time-reaction paratungstate → ψ metatungstate, caused by acidification of the solutions, is really not the so-called „metatungstate A“, {H2[HW6O21 · x aq]}3-, but the metatungstate (dodecatungstate), [H2W12O40 · aq]6-, itself. The ψ-metatungstate is formed by hydrolysis of the dodecatungstate. This hydrolytic reaction is practically completely suppressed below pH = 3.
    Notes: Es wurde an verschiedenen unter wohldefinierten Umständen angesäuerten 0,1 m Na2 WO4-Lösungen die zeitabhängige Verschiebung der Lichtabsorption und der pH-Werte aufgenommen.Die Versuchsergebnisse weisen dahin, daß das bei der Zeitreaktion: Parawolframat → ψ-Metawolframat von Jander und Krüerke angenommene „saure Parawolframat“: [H2(HW6O21 · aq)]3-, das sogenannte „Metawolframat A“, nicht existiert, sondern daß das durch Ansäuern mit 1,2-1,5 Mol HClO4 pro Mol Na2WO4 aus Parawolframat [HW6O21·aq]5- zuerst sich bildende Zwischenprodukt selbst das Metawolframat [H2W12O40 · aq]6- (Dodekawolframat) ist: \documentclass{article}\pagestyle{empty}\begin{document}$$ 2[\rm{HW}_6 \rm{O}_{21} \cdot \rm{aq}]^{5 -} + 4\rm{H}^ + \rightleftharpoons [\rm{H}_2 \rm{W}_{12} \rm{O}_{40} \cdot \rm{aq}]^{6 -} + 2\rm{H}_2 \rm {O,} $$\end{document} aus welchem dann langsam durch Hydrolyse das ψ-Metawolframat entsteht:\documentclass{article}\pagestyle{empty}\begin{document}$$ [{\rm H}_2 {\rm W}_{12} {\rm O}_{40} \cdot {\rm aq}]^{6 -} + 2\,{\rm H}_2 {\rm O} \rightleftharpoons 2\,[{\rm H}_3 {\rm W}_6 {\rm O}_{21} \cdot {\rm aq}]^{3 -} $$\end{document}.Diese Hydrolyse kann aber durch einen ziemlich kleinen Säureüberschuß, z. B. 1,56 Mol HClO4 pro Mol Na2WO4, ungefähr bei pH ∼ 3 schon zurückgedrängt werden.Weitere Untersuchungen an verdünnteren Lüsungen sind im Gange.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The process of wet oxidation of varoius iron(III) sulfides, prepared from iron(III) oxide hydrates and hydrogen sulfide, by means of atmospheric oxygen or hydrogen peroxide has been investigated.The influence of oxidation velocity and temperature on the quality of the iron(III) hydroxide lattices being formed is discussed.
    Notes: Die feuchte Oxydation von Eisensulfid, das aus α-FeOOH mit H2S nach vollständiger Umsetzung erhalten wird, führt stets zum γ-FeOOH. Bei unvollständiger Beschwefelung des α-FeOOH resultieren nach der Oxydation des Sulfids α-FeOOH oder α-γ-FeOOH-Mischprodukte, je nach der Menge des zugegebenen H2S. Das nicht umgesetzte α-FeOOH lenkt als Keimbildner die Oxydation des Sulfids in diese Richtung. Diese Keimhypothese läßt sich dadurch bestätigen, daß Eisensulfid nach Zusatz von α-FeOOH-Keimen nicht wie normal zum γ-, sondern zum α-FeOOH oxydiert wird. Aus frisch gefälltem amorphen Eisen(III)-hydroxyd oder γ-FeOOH hergestelltes Eisensulfid oxydiert sich unter feuchten Bedingungen immer zum γ-FeOOH. Ebenso liefert ein bis 34 Tage unter Wasser gealtertes Eisensulfid nach der Oxydation in wäßriger Aufschlämmung γ-FeOOH. Schlecht kristallisierte γ-FeOOH-Präparate, die kaum Debyeogramme liefern, entstehen durch momentane Oxydation des Eisensulfids mit 3proz. H2O2. Wird Eisensulfid vor der Oxydation gründlich mit absolutem Alkohol filtertrocken gewaschen, so bildet sich unter dem Einfluß des Luftsauerstoffs ein praktisch amorphes FeOOH. Die Qualität der entstehenden Eisen(III)-hydroxydgitter läßt sich durch die Oxydationsgeschwindigkeit und Oxydationstemperatur beeinflussen. Geringe Oxydationsgeschwindigkeit und erhöhte Temperatur führen zu guter Kristallisation.
    Additional Material: 9 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 133-137 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The solubilities of silver halides and the formation of complexes in the systems AgX—AgF—H2O (X = Cl, Br, J) are similar to those in the systems AgX—AgNO3—H2O; the same argentohalogen cations are formed. The complexes [Ag2J]F and [Ag2Br]F have been isolated. [Ag2J]F crystallizes in a monoclinic lattice (a = 4,72 Å, b = 7,66 Å, c = 6,36 Å, β = 86,5°) containing two molecules per unit cell.
    Notes: Die Löslichkeiten der Silberhalogenide und die Komplexbildung in den Systemen AgX—AgF—H2O (X = Cl, Br, J) sind ähnlich wie in den Systemen AgX—AgNO3—H2O; es bilden sich die gleichen Argentohalogenkationen. Die Komplexverbindungen [Ag2J]F und [Ag2Br]F konnten isoliert und analysiert werden. Das [Ag2J]F besitzt ein monoklines Kristallgitter (a = 4,72 Å, b = 7,66 Å, c = 6,36 Å, β = 86,5°) mit zwei Formeleinheiten in der Elementarzelle.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 121-132 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The magnetic susceptibilities of the higher vanadium oxides in the temperature range from -196 to 900 °C have been measured in order to investigate the phase relationsships in the system VO1,5-VO2,5.The existence of discrete compounds, VO1,67, VO1,75, VO1,80, VO1,84, VO1,86, VO1,87, and VO2,17, indicated by X-ray studies by Andersson resp. Aebi, is reflected in the magnetic properties in different measure. Vanadium dioxide apparently possesses a very narrow homogeneity range (VO1,995-VO2,000) in which the temperature of the susceptibility jump characteristic for VO2 increases from 65 to 67,5 °C.The observed values of the constants of the Curie-Weiss-law are discussed.
    Notes: Zur Untersuchung der Phasen-Verhältnisse im System VO1,5-VO2,5 wurden Messungen der magnetischen Suszeptibilität der höheren Vanadinoxyde bei Temperaturen von -196 bis 900°C durchgeführt.Die Existenz der von Andersson bzw. Aebi röntgenographisch nachgewiesenen diskreten Verbindungen VO1,67, VO1,75, VO1,80, VO1,84, VO1,86, VO1,87 und VO2,17 spiegelt sich in verschiedenem Maße in den magnetischen Eigenschaften wider. Vanadindioxyd besitzt offensichtlich einen sehr schmalen Homogenitätsbereich (VO1,995-VO2,000), innerhalb dessen die Temperatur des für VO2 charakteristischen Suszeptibilitätssprunges von 65 auf 67,5°C anwächst.Die für die Vanadinoxyde gefundenen Konstanten des Curie-Weiss-Gesetzes werden diskutiert.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 138-142 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The catalyst CaCO3/Co++ and its high activity on the peroxidic decoloration of dyes such as indigo carmine and betanine (in beetroot juice) at room temperature are described.
    Notes: Es wird der Katalysator CaCo3/Co++ näher beschrieben, der selbst bei Raumtemperatur die peroxydatische Oxydation (Entfärbung) von Farbstoffen, wie Indigocarmin oder Betanin (Roterübensaft) ganz außerordentlich beschleunigt.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 30
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 143-147 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Five preparations of different composition (but all within the range of the homogeneous phase TiO) were made by sintering TiO2 and Ti° mixtures at 1400°C, then homogenizing them at 1000° and quenching from that temperature.For the TiO of stoichiometric composition a lattice constant of a25° = 4,1766±0,0001 Å was obtained; the linear expansion coefficient is independent of the composition of the samples showing an average of (7.6 ± 2) · 10-6; the macroscopic density of TiO is d25 = 4.917 ± 0.001 g/cm3; the actual number of molecules per unit cell is n′ = 3.38 indicating that there are 15.5% vacant sites in the lattice.With increasing Ti content an increase of the lattice constant, macroscopic density, and of the total number of vacant sites is observed. There is a possibility to regard the Ti-O alloys as solid solutions of Ti2O3 in Ti.
    Notes: Fünf Präparate verschiedener Zusammensetzung innerhalb der homogenen Phase TiO wurden durch Sintern von TiO2- und Ti-Mischungen bei 1400° hergestellt, bei 1000° homogenisiert und dann von dieser Temperatur abgeschreckt.Gitterkonstantenmessungen ergaben für das TiO stöchiometrischer Zusammensetzung den Wert a25 = 4,1766 ± 0,0001 Å; der lineare Ausdehnungskoeffizient war unabhängig von der Zusammensetzung: α = (7,6 ± 2) 10-6; die makroskopische Dichte ergab sich zu d25 = 4,917 ± 0,001 g/cm3; die tatsächliche Anzahl der TiO-Formeleinheiten per Elementarzelle - zu n′ = 3,38, was auf 15,5% Leerstellen im Gitter hindeutet.Beim Einbau von metallischem Ti ins TiO-Gitter vergrößert sich die Gitterkonstante, die makroskopische Dichte und die Anzahl der Leerstellen. Es besteht die Möglichkeit, die Ti-O-Legierungen als feste Lösungen von Ti2O3 in Ti aufzufassen.
    Additional Material: 6 Tab.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 31
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 158-168 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The solubilities of solid chlorides in titanium tetrachloride dependent on temperature have been investigated. Compounds with a typical molecular structure are relatively soluble. For the quantitative determinations, a new apparature has been developed which allows to work exactly and simply with substances sensitive to moisture.
    Notes: Es wurden die Löslichkeiten fester Chloride in Titantetrachlorid in Abhängigkeit von der Temperatur untersucht. Als relativ stark löslich erwiesen sich Verbindungen mit typischen Molekelgittern. Für die quantitativen Bestimmungen wurde von uns eine Apparatur entwickelt, die ein genaues und einfaches Arbeiten mit den feuchtigkeitsempfindlichen Substanzen erlaubt.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 305 (1960), S. 148-157 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The RAMAN and IR-spectra of the liquid and gaseous, respectively, phosphorus nitridefluorides (NPF2)3 and (NPF2)4 are given. The trimeric compound is supposed to be a planar symmetrical six-membered PN-ring (symmetry D3h); the tetramer has probably the symmetry C2h being a non-planar eight-membered ring. The PN-force-constants of the phosphorus nitridefluorides are greater than the force constants of the POP-bonds in the corresponding metaphosphate rings.
    Notes: Die RAMAN-Spektren der verflüssigten und die IR-Spektren der gasförmigen Phosphornitrilfluoride (NPF2)3 und (NPF2)4 werden mitgeteilt. Die Zuordnung der gefundenen Banden steht beim Trimeren mit einer Molekülsymmetrie D3h entsprechend einem ebenen, symmetrischen PN-Sechsring in Einklang. Beim Tetrameren wird auf einen nicht ebenen Achtring geschlossen; die Molekel hat wahrscheinlich die Symmetrie C2h. Ein Vergleich zeigt, daß die PN-Kraftkonstante in den Phosphornitrilfluoriden größer ist als die PO. Kraftkonstante in den Ringen der entsprechenden Metaphosphate.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 233-233 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 306 (1960), S. 260-265 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: A survey on the modifications of boron known today is given. Experiments are described for preparing boron crystals containing Be by decomposing BBr3 and BeBr2 on a hot tantal wire. Together with inhomogenous depositions on the surface of the wire, single-crystals of boron containing 0,1-0,5% Be have been isolated. The crystals have the tetragonal unit cell of β-boron
    Notes: Nach einem Überblick über die bisher bekannten Bor-Modifikationen werden Versuche beschrieben, durch gemeinsames Zersetzen von BBr3 BeBr2 am glühenden Tantaldraht Borkristalle mit eingelagertem Beryllium darzustellen. Neben inhomogenen Abscheidungen an der Drahtoberfläche, die Tantaldiborid enthielten, wurden Einkristalle isoliert, die nach spektralanalytischer Untersuchung 0,1-0,5% Be enthielten und auf Grund von Drehkristall- und Weißenbergaufnahmen die Kristallstruktur des tetragonalen Bor mit den Zelldimensionen a = 8,80 Å und c = 5,08 Å besitzen.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 306 (1960), S. 273-276 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Trisulfimide, (SO2NH)3, has been separated from sulfate by paper chromatography using a solvent on the basis isopanol-ethanol-water-ammonia.The acid hydrolysis of trisulfimide yields first sulfuric acid and imidodisulfamide, NH(SO2NH2)2; the latter one is further hydrolyzed to NH2SO3H ans SO2(NH2)2.
    Notes: Bei Anwendung eines Fließmittels auf Basis Isopropanol-Åthanol-Wasser-Ammoniak wird Trisulfimid papierchromatographisch von Sulfat getrennt. Die saure Hydrolyse verläuft über Imidodisulfamid und H2SO4. Ersteres wird weiter in NH2SO3H und SO2(NH2)2 gespalten. Die Angaben von Hantzsch und Stuer werden damit bestätigt.
    Additional Material: 2 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 1-2 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 13-22 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The conditions for preparing AlB2 from Al and B have been investigated. In all experiments at 800°C, a boron phase, containing small amounts of Al, was formed as a by-product of AlB2. The formation of AlB2 depends mainly from the degree of dispersion of the reaction components. Above 980°, AlB2 decomposes into Al and β-AlB2. The conditions for crystallising AlB2-sheets from molten Al, containing E, have been examined.
    Notes: Die Darstellungsbedingungen für AlB2 aus Al und B werden eingehend untersucht. Bei ∼800 °C bildet ein kleiner Teil des Bors stets eine aluminiumarme Phase, die neben dem AlB2 anfällt. Der Umsetzungsgrad zu AlB2 hängt vor allem von dem Verteilungsgrad der Reaktionskomponenten ab. Oberhalb 980° zerfällt AlB2 in Al und β-AlB12. Weiterhin wurden die Bedingungen für die Bildung blättchenförmiger AlB2-Kristalle aus borhaltigen Aluminiumschmelzen nachgeprüft.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 303 (1960), S. 247-262 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Ag—SiO2-carrier catalysts exhibiting high activities on the decomposition of formic acid vapour have been prepared by reduction of the crystalline silver silicates Ag4SiO4, Ag2SiO3, and Ag2Si2O5 The activities of the most effective catalysts being prepared from the phyllosilicate Ag2Si2O5 increase with higher reduction and annealing temperatures, respectively. This effects is supposed to be due to the formation of well-crystallized silver surfaces.Similarly active Ni—SiO2- and Cu—SiO2-catalysts are formed by reduction of the products resulting from interaction between the phyllosilicic acid H2Si2O5 and solution of nickel and copper ammoniates, respectively.From the valuable properties of these catalysts, it is concluded that metal silicates possessing layer anions yield an especially suitable SiO2-carrier on reduction.
    Notes: Durch Reduktion der kristallisierten Silbersilicate Ag4SiO4, Ag2SiO3 und Ag2Si2O5 entstehen Trägerkatalysatoren von Ag auf SiO2, die gegenüber dem Zerfall des HCOOH Dampfes sehr wirksam sind. Die wirksamsten Katalysatoren ergibt das Schichtsilicat Ag2Si2O5; ihre Aktivität nimmt mit steigender Reduktions- bzw. Temperatur noch zu, dies wird auf die Ausbildung guter Kristallflächen des Ag zurückgeführt.Durch Behandeln einer „Phyllokieselsäure, H2Si2O5“, mit Lösungen der entsprechenden Metallammoniakate sind Ni- und Cu-haltige Produkte hergestellt worden, die nach Reduktion ebenfalls sehr wirksame Ni- bzw. Cu—SiO2-Trägerkatalysatoren ergeben.Die hohe katalytische Aktivität und gute Temperaturbeständigkeit derjenigen Kontakte, die aus Schichtsilicaten hergestellt worden sind, lassen den Schluß zu, daß Silicate mit Schichtanione bei der Reduktion einen besonders geeigneten SiO2-Träger ergeben.
    Additional Material: 12 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 39
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 303 (1960), S. 263-282 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The alkali metal oxides vaporize either in the form of Me2O-molecules or as following 2 Me2O(s) = 4 Me(g) + O2. According to BERKOWITZ et al. in the case of Li2O both processes take place. For the remaining alkali metal oxides the calculation of molecular energy could not decide the question. The calculations show that for the oxides of light alkali metals an angular model can only be considered. The investigations carried out in a MgO-boat, show that in vacuum (10-5 mm Hg) up to 980° C Li2O either does not vaporize at all or only to a very small extent. In case of vaporization starts at about 670°C. The sublimate consists of Na2O.Na2O. In case of K2O the vaporization begins at 450°C first with a sublimate of K2O; with increasing temperature the reaction 2 K2Os = K2O2,s + 2 Kg becomes more prominent. The second process is more pronounced in case of Rb2O; here Rb2O sublimes undecomposed only between 450° C and 500°C. Above 500°C Rubidiummetal sublimes and pure Rb2O2 remains in solid phase, which does not vaporize up to 630°C. In case of Cs2O the sublimate above 350°C consists of Cs2O, above 450°C of Cs-metal and above 500°C of Cs2O2, which vaporizes at this temperature without leaving any residue.These results are neither in good agreement with the vapor pressure values calculated on the basis of (a) vaporization as Me2O-molecules nor (b) for dissociation in metal and oxygen. The question of vaporization of different alkali metal oxides can only be decided by means of mass spectroscopic analysis. It is guessed that (a) becomes more predominant with increasing atomic weight of alkali metal.
    Notes: Alkalimetalloxide können im Prinzip sowohl als Me2O-Molekeln als auch gemäß 2 Me2O(f) = 4 Me(g) + O2 verdampfen; beim Li2O gehen nach BERKOWITZ und Mitarbeitern beide Vorgänge nebeneinander vor sich. Für die übrigen Alkalimetalloxide können Berechnungen der Molekelenergie (Teil I) diese Frage nicht entscheiden; sie zeigen, daß für die Oxidmolekeln der leichteren Alkalimetalle nur ein gewinkeltes Modell in Frage kommt.Versuche mit Verwendung eines MgO-Schiffchens zeigen, daß im Vakuum (≤ 10-5 Torr) bis 980° C Li2O nicht oder nur in ganz geringem Maße verdampft. Bei Na2O beginnt die Verdampfung bei etwa 670°C. Das Sublimat besteht aus Na2O. Bei K2O verdampft ab 450° C zunächst K2O; mit steigender Temperatur geht in immer stärkerem Maße die Reaktion 2 K2Of = K2O2f + 2 Kg vor sich. Dieser zweite Vorgang ist bei Rb2O noch viel ausgeprägter; hier findet sich ein nichtmetallisches Sublimat nur zwischen 450° C und 500°C; oberhalb 500° verdampft Metall und es verbleibt als Bodenkörper reines Rb2O2, das sich bis 630° im Vakuum nicht verflüchtigt. Beim Cs2O besteht das Sublimat ab 350° C aus Cs2O, oberhalb 450° C aus Cs-Metall und oberhalb 500° C aus Cs2O2, das bei dieser Temperatur im Vakuum ohne Rückstand verdampft.Diese Ergebnisse sind weder mit den Dampfdruckwerten, die man (a) für die Verdampfung als Me2O-Molekeln noch (b) für die Dissoziation in Metall + Sauerstoff berechnet, in guter Übereinstimmung. Die Frage kann nur durch andere, insbesondere massenspektroskopische Bestimmungen entschieden werden. Vermutlich tritt (a) um so mehr in den Vordergrund, je schwerer das Alkalimetall ist.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 304 (1960) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 41
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 304 (1960), S. 1-11 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The RAMAN and infrared spectra of the alkali salts of peroxodiphosphoric acid in solid state and in aqueous solutions are recorded. Applying the theory of molecular spectra on the ion P2O84-, all stretched structures can be excluded. The ion P2O84- has an angular structure and occures in trans-configuration with symmetry C2h or C1.
    Notes: Die RAMAN- und Ultrarotspektren von Alkalisalzen der Peroxodiphosphorsäure werden im festen Zustand und in wäßriger Lösung aufgenommen. An Hand der Theorie der Molekülspektren, die auf das P2O8-Ion angewendet wird, lassen sich sämtliche gestreckten Strukturen ausschließen. Das P2O8-Ion ist gewinkelt gebaut und liegt in transForm mit Symmetrie C2h oder C1 vor.
    Additional Material: 6 Tab.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 113-119 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Various mixtures of phosphorus trichloride and triethyl phosphite on one side and triphenyl phosphite and tris-diethylamino phosphine on the other side were prepared to study the equilibria resulting from reorganization in both systems. The equilibrium constants are compared with values calculated on the basis of completely random reorganization. It is shown that the mixed compounds of both systems are more stable than would be expected from statistical calculations.
    Notes: Es wurden Mischungen von Phosphortrichlorid und Triäthylphosphit einerseits und Triphenylphosphit und tris-Diäthylaminophosphin andererseits hergestellt und die sich in diesen beiden Systemen durch Ligandenaustausch einstellenden Gleichgewichte untersucht. Die Gleichgewichtskonstanten der Systeme werden mit denen verglichen, die sich bei rein statistisch-zufälliger Verteilung der Liganden ergeben würden. Es wurde gezeigt, daß die Verbindungen mit verschiedenen Liganden in beiden untersuchten Systemen eine größere Stabilität aufweisen, als man nach der Statistik erwarten würde.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 44
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 123-136 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By diffusion annealing of the solid metals Mg and Zr at 614°C and by interaction between liquid Mg and compact Zr, following phases have been obtained: α-mixed-crystal, intermetallic phase δ with a homogeneity range from about 60 to 70% Zr, and α-Zr-mixedcrystal (solid solution of Mg in α-Zr) with a content of Mg up to 15% Mg at 800°C.Several alloys with contents of Zr from about 54 to 85% have been prepared by powder metallurgy. There is a maximum of Brinell hardness at 50-70% Zr.Preliminary annealing experiments have been made in the system Mg—Zn—Zr.
    Notes: Bei Diffusionsglühungen der festen Metalle bei 614°C und von flüssigem Mg mit kompaktem Zr bei 800°C entstehen im Diffusionsgefüge folgende Phasen: α-Mischkristall, intermetallische Phase δ mit Homogenitätsbereich von zunächst ungefähr 60 bis 70% Zr und α-Zr-Mischkristall (feste Lösung von Mg in α-Zr) mit möglicherweise bis zu 15% Mg bei 800°C.Nach der pulvermetallurgischen Methode wurden eine Reihe von Legierungen mit 54-85% Zr hergestellt. Auf der Mg-Seite wurden diese durch Legierungen aus Mg-Schmelzen mit Zr-Zusatz ergänzt. Brinellhärtemessungen lieferten eine Härte-Konzentrationskurve, die zwischen ungefähr 50 und 70% ein ausgeprägtes Maximum aufwies. Dies sowie Debye-Scherrer-Aufnahmen und die mikroskopische Untersuchung der Legierungen bestätigten das Vorhandensein Zr-reicher Phasen zwischen ∽50 und 70% und etwa 85 bis 100% Zr.Im System Mg—Zn—Zr wurden orientierende Diffusionsglühungen angestellt.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 137-144 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: CsCl and CoCl2 form a fourfold eutectical system with the compounds Cs3CoCl5, Cs2CoCl4 and CsCoCl3. Two other compounds - Cs5Co2Cl9 and Cs3Co2Cl7 - decompose in the solid state.In the system RbCl/CoCl2 there are: Three eutectics, the compounds Rb2CoCl4 and RbCoCl3, further on the compound Rb3CoCl5, the melting point of which is also a peritectic. Rb2CoCl4 has a transition point.The system KCl/CoCl2 shows the congruently melting compound K2CoCl4, the incongruently melting KCoCl3 (with a transition point in the solid state), two eutectics and a peritectic.For NaCl and CoCl2 the same diagram was found as already described in literature.LiCl and CoCl2 form mixed crystals with a minimum on the LiCl-side; on the CoCl2-side there is an peritectical system. At lower temperature, a miscibility gap exists. In the space of this miscibility gap the compounds Li4CoCl6, Li2CoCl4 and LiCoCl3 are formed.The melting point of CoCl2 has been newly determined. The effects of moisture and some solvents on these compounds are described.References to the possible structures are given.
    Notes: CsCl und CoCl2 bilden ein vierfach eutektisches System mit den Verbindungen Cs3CoCl5, Cs2CoCl4 und CsCoCl3. Zwei weitere Verbindungen  -  Cs5Co2Cl9 und Cs3Co2Cl7  -  zersetzen sich im festen Zustand.Im System RbCl/CoCl2 liegen vor: Drei Eutektika, die Verbindungen Rb2CoCl4 und RbCoCl3, sowie die Verbindung Rb3CoCl5, mit deren Schmelzpunkt ein Peritektikum zusammenfällt. Rb2CoCl4 besitzt einen Umwandlungspunkt.Aus KCl und CoCl2 bilden sich das kongruent schmelzende K2CoCl4 und das inkongruent schmelzende KCoCl3, das noch einen Umwandlungspunkt besitzt. Dazu gehören zwei Eutektika und das Peritektikum.Das schon beschriebene Diagramm des Systems NaCl/CoCl2 konnte bestätigt werden.Zwischen LiCl und CoCl2 herrscht auf der LiCl-reichen Seite Mischkristallbildung mit Minimum, die dann auf der CoCl2-reichen Seite in ein Peritektikum übergeht. In der Mischungslücke bilden sich bei tieferen Temperaturen die Verbindungen Li4CoCl6, Li2CoCl4 und LiCoCl3.Der Schmelzpunkt des CoCl2 wurde neu bestimmt.Das Verhalten der Verbindungen gegen Feuchtigkeit und einige Lösungsmittel wird beschrieben. Hinweise über die möglichen Strukturen werden gegeben.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 46
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 163-173 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Nb3O7Cl is formed by thermal interaction (600°C) between Nb2O5 and NbOCl3 as colourless single crystals (in the presence of O2 or Cl2) or as blue crystals (in the absence of any oxidizing agents). It is thermally transportable according to the heterogeneous equilibrium \documentclass{article}\pagestyle{empty}\begin{document}$$ {\rm NbOCl}_{{\rm (s)}} + 4{\rm NbCl}_{{\rm 5(g)}} \mathbin{\lower.3ex\hbox{$\buildrel\textstyle\rightarrow\over{\smash{\leftarrow}\vphantom{_{\vbox to.5ex{\vss}}}}$}} 7{\rm NbCl}_{{\rm 3(g)}}. $$\end{document}NbOCl2 results from the reduction of NbOCl3 by H2 or from the interaction between Nb, NbCl5 and Nb2O5 in a sealed tube at 370/350°C; there is a transport reaction according to \documentclass{article}\pagestyle{empty}\begin{document}$$ {\rm NbOCl}_{{\rm 2(s)}} + {\rm NbCl}_{{\rm 5(g)}} \mathbin{\lower.3ex\hbox{$\buildrel\textstyle\rightarrow\over{\smash{\leftarrow}\vphantom{_{\vbox to.5ex{\vss}}}}$}} {\rm NbOCl}_{{\rm 3(g)}} + {\rm NbCl}_{{\rm 4(g)}}. $$\end{document}At analogous conditions, the diamagnetic compound TaOCl2 has been prepared by the transport reactions between SiO2, Ta and TaCl5 or Ta2O5, Ta and TaCl5.
    Notes: Nb3O7Cl wurde durch Erhitzen (600°C) von Nb2O5 mit einem NbOCl3-Überschuß hergestellt. In Gegenwart von O2 oder Cl2 erhält man farblose Einkristalle. Wird ohne Zugabe von Oxydationsmitteln gearbeitet, so entstehen blaue Kristalle der gleichen Verbindung. Sie besitzt somit ein Homogenitätsgebiet. Nb3O7Cl ist mit Hilfe des heterogenen Gleichgewichts Nb3O7Cl + 4 NbCl5g = 7 NbOCl3g im Temperaturgefälle transportierbar.NbOCl2 entsteht bei der Reduktion von NbOCl3 mit 2. Zu seiner Darstellung setzt man am besten Nb, NbCl5 und Nb2O5 und Nb2O5 bei 370/350°C im Einschlußrohr um. Man kann die Synthese mit dem Transport im Temperaturgefälle verbinden, der nach der Gleichung NbOCl2 + NbCl5g = NbOCl3g + NbCl4g vor sich geht.TaOCl2 konnte durch Umsetzung von SiO2, Ta und TaCl5 oder von Ta2O5, Ta und TaCl5 im Einschlußrohr gewonnen werden. Die Verbindung erwies sich als dem NbOCl2 in vieler Hinsicht ähnlich und konnte auch auf die analoge Weise im Temperaturgefälle transportiert werden. TaOCl2 ist diamagnetisch.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 47
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 202-204 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Beim Erhitzen von Zr und Te bzw. aus ZrO2 und Te entsteht unter Luftzutritt bei 750°C die Verbindung ZrO2 · 2 TeO, die röntgenographisch untersucht wurde.
    Notes: By heating Zr and Te or ZrO2 and Te in air at 750°C the compound ZrO2 · 2 TeO results. The crystal parameters have been determined.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 187-201 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The conversion of normal kaolinite into H-kaolinite by means of dilute acids, organic cation exchangers, and electrodialysis has been studied.By interaction between kaolinite and an acid exchange resin, a H-kaolinite has been prepared; 90% of its exchange sites were occupied by H- and Al-ions. The nature of the Al-exchange has been investigated.Similarly, the preparation of a H-montmorillonite and its inner-crystalline swelling were studied.
    Notes: Die verschiedenen Verfahren zur Belegung von Tonmineralen mit austauschfähigen Wasserstoffionen wurden miteinander verglichen. An den durch Behandeln eines Kaolinits mit sehr verdünnten Säuren. mit einem organischen Kationenaustauscher und durch Elektrodialyse hergestellten H-Kaoliniten wurde das Verhalten der neben den austauschfähigen H-Ionen stets vorhandenen austauschfähigen Al-Ionen studiert.Als wirksamstes und schonendstes Verfahren erwies sich die Behandlung mit einem stark sauren organischen Kationenaustauscher. Nach diesem Verfahren wurde eine größere Menge H-Kaolinit hergestellt, die bei nur unbedeutendem Angriff auf das Kaolinitgitter zu 90% (H + Al)-Ionen enthielt und sich für die Untersuchung der charakteristischen Eigenschaften des H-Kaolinits geeignet erwies.Es gelang, nach dem gleichen Verfahren einen Montmorillonit mit Wasserstoffionen zu belegen. Die innerkristalline Quellung dieses H-Montmorillonits wurde röntgenographisch untersucht.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 208-218 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Several alkali periodato- and tellurato-cuprates(III) have been prepared at definite values of pH. Their chemical and physicochemical properties (solubilities, thermal stabilities, magnetic behaviours) are communicated.
    Notes: Durch Regulation der Wasserstoffionenkonzentration ist es möglich, die bisher nicht dargestellten Komplexe des dreiwertigen Kupfers zu isolieren. Die isolierten kristallinischen Komplexe wurden durch chemische Analyse und Röntgen-Pulverdiagramme charakterisiert; außerdem wurde ihre Löslichkeit, thermische Stabilität und magnetische Suszeptibilität bestimmt.
    Additional Material: 8 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 226-228 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Mitteilung der Raumgruppe und Dimensionen der Elementarzelle von Mangan(II)-sulfat-monohydrat.
    Notes: Manganese(II) sulphate monohydrate is monoclinic prismatic with space group A 2/a—C2h6 and the cell-dimensions are a = 7.758 ± 0.008 Å, b = 7.612 ± 0.008 Å, c = 7.126 ± 0.008 Å, β = 115° 421/2′ ± 2′. The unit cell contains (MnSO4 · H2O)4 and the calculated density at 25°C is 2.960 g./cm3.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 52
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 234-234 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 53
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 265-275 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The dissociation properties of mono- and dicacodylatochromium(III) complexes in aqueous solutions have been investigated by physico-chemical methods.Coupled with an acid dissociation, there is a secondary complex dissociation yielding free cacodylic acid and basic chromium(III) complexes.
    Notes: Mit Hilfe physikalisch-chemischer Verfahren werden ein Mono- sowie ein Dikakodylatokomplex des dreiwertigen Chroms nachgewiesen und deren Verhalten in wäßriger Lösung untersucht. Hierbei wird vor allem eine mit einer Säuredissoziation gekoppelte sekundäre Komplexdissoziation festgestellt, die einerseits zur Abspaltung freier Kakodylsäure, andererseits zur Bildung basischer Chrom(III)-komplexe führt.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 290-303 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Arsenic acid esters react with HF or AsF3 forming esters of monomeric fluoroarsenic acids. These are only stable as addition compounds with one mole of alcohol, e. g. FAsOH-(OR)3, exhibiting the coordination number 5. In polar solvents, a rearrangement to heteropolar compounds with both the coördination numbers 4 and 6, e. g. [AsOH(OR)3]- [AsOH(OR)3F2]-, produced by transference of fluorine, occurs.
    Notes: Monomere Fluoroarsensäureester entstehen aus Arsensäureestern durch Reaktion mit HF oder mit AsF3. Sie sind nicht in der Form FAsO(OR)2 bzw. F2AsO(OR) mit Koordinationszahl 4 am Arsen beständig, sondern erst nach Anlagerung eines Mols Alkohol, wobei die Koordinationszahl 5 ausgebildet wird, z. B. FAsOH(OR)3. In dieser Form lösen sich die Ester in unpolaren Lösungsmitteln, wobei schon bei verhältnismäßig niedriger Konzentration eine Aggregation eintritt. In polaren Lösungsmitteln lösen sie sich als heteropolare Verbindungen, wobei Kationen mit Koordinationszahl 4, Anionen mit Koordinationszahl 6 ausgebildet werden, z. B. [AsOH(OR)3][AsOH(OR)3F2]; bei der Umlagerung in die heteropolare Form erfolgt stets die Übertragung des Fluors und nicht die der anderen Gruppen.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 55
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1961), S. 328-344 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: From the IR-spectra of gaseous NSF3 and SNF, an assignment of the fundamental vibrations and an estimation of the valence force constants are given.The constitutions of SNF, NSF3, S3N3F3, and S4N4F4 are investigated by NMR-spectra.
    Notes: Es wird versucht, aus den Infrarotspektren der Gase NSF3 und SNF die Struktur der Molekeln abzuleiten. Eine Zuordnung der Grundschwingungen wird vorgenommen und die Berechnung der Valenzkraftkonstanten durchgeführt. [NSF3: fSN = 12,4 msyn/Å (SN-Bindungsgrad = 2,7), fSF = 5,(6) msyn/Å (SF-Bindungsgrad = 1,(2)); SNF: fSN = 10,4 msyn/Å (SN-Bindungsgrad = 2,3) fNF = 1,(5) msyn/Å]. Mittels der KMR-Spektren von SNF, NSF3, S3N3F3 und S4N4F4 werden ebenfalls Aussagen über die Konstitutionen dieser Verbindungen erhalten.
    Additional Material: 10 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 56
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 3-12 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The dipole moments of the compounds N(CH3)2Cl, N(C2H5)2Cl, N(CH3)Cl2, and N(C2H5)Cl2 were determined and the order of magnitude of the NCl3-moment was ascertained. The variations of the N—Cl-binding- and N—CH3-group moments within the series N(CH3)3/N(CH3)2Cl/N(CH3)Cl2/NCl3 resulting from inner molecular induction were estimated for the (+)N—Cl(-) and (-)N—Cl(+) cases. A comparison with the order of magnitude in the corresponding variations of the C—Cl-binding- and C—CH3,-group moments in the alkyl halogenides led to the result that the direction of the N—Cl-binding moment in the compounds investigated is as shown: (+)N—Cl(-).
    Notes: Die Dipolmomente der Verbindungen N(CH3)2Cl, N(C2H5)2Cl, N(CH3)Cl2 und N(C2H5)Cl2 wurden bestimmt und das des Chlorstickstoffs der Größenordnung nach ermittelt. Die Änderungen der N—Cl-Bindungs- und N—CH3-Gruppenmomente innerhalb der Reihe N(CH3)3/N(CH3)2Cl/N(CH3)Cl2/NCl3 infolge innermolekularer Induktion wurden für die Fälle (+)N—Cl(-) und (-) und (-)N—Cl(+) abgeschätzt. Ein Vergleich mit der Größenordnung entsprechender Änderungen der C—Cl-Bindungs- und C—CH3-Gruppenmomente bei Alkylhalogeniden führt zu dem Ergebnis, daß der Richtungssinn des N—Cl-Bindungsmoments in den untersuchten Verbindungen (+)N—Cl(-) ist.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The reactions of the LEWIS acid SO3, with tertiary phenyl and cyclohexyl derivatives of N, P, As, Sb, and Bi have been studied. According to the sequence: phosphine, bismuthine, arsine, and stibine, especially stable SO3-adducts are formed by the compounds of P and surprisingly of Bi. In the case of As- and Sb-compounds redox reactions occur.Tertiary phosphine and arsine oxides and sulfides, respectively, yield SO3 -adducts, too.
    Notes: Die Reaktionen der LEWIS-Säure. SO3 mit den tertiären Phenyl- und Cyclohexylderivaten von N, P, As, Sb und Bi wurden studiert. Besonders stabile SO3-Addukte bildeten die Verbindungen des Phosphors und überraschenderweise des Wismuts. Die Donatoreigenschaften der Triphenylverbindungen nehmen in folgender Reihe ab: Phosphin, Bismutin, Arsin und Stibin. Den schwächeren LEWIS-Basen gegenüber wirkte SO3 oxydierend, wobei im Falle des Arsins auch dieser Reaktion eine Adduktbildung voran ging. Den SO3-Addukten entsprechen zum Teil stabile BH3-Addukte. Auch die tertiären Phosphin- und Arsin-Oxyde bzw. Sulfide reagierten mit SO3 unter Bildung von Addukten. Die bisher wenig bekannten Donatoreigenschaften dieser Verbindungsklasse wurden damit deutlich gemacht.
    Additional Material: 15 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 58
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 306 (1960) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 59
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 306 (1960), S. 241-245 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Divalent titanium can be determined with an accuracy of +0,2% by measuring the hydrogen volume developed by means of diluted acids. The method is especially suited for the investigation of salt melts containing large amounts of alkali halogenides.
    Notes: Es wird eine Methode zur Bestimmung des zweiwertigen Titans durch Messung des mit verdünnter Salzsäure entwickelten Wasserstoffvolumens beschrieben, die besonders zur Untersuchung von Salzschmelzen geeignet ist. Eine Genauigkeit von ±0,2% Ti2+ kann erreicht werden.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 98-104 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Melting sodium oxide even reacts with gold. Crucibles of magnesium oxide only are useful to some extent, but not for thermal analysis of the system NaCl-Na2O. Therefore, the melting phenomena were studied by observing the motion of a heavy piston into the melting material while heating. By this means a eutectic point was found at ∼700 °C and ∼25 mol% Na2O; there is no evidence for the formation of any compound.
    Notes: Schmelzendes Natriumoxid reagiert sogar mit Gold. Als Gefäßmaterial ist nur Magnesiumoxid beschränkt brauchbar, aber die käuflichen Geräte sind nicht zur thermischen Analyse des Systems NaCl-Na2O geeignet. Die Schmelzerscheinungen wurden deshalb dadurch studiert, daß das Eindringen eines belasteten Stempels in das schmelzende Material beim Erhitzen verfolgt wurde. So wurde ein Eutektikum bei ∼700 °C und ∼25 Mol-% Na2O gefunden; Anzeichen für die Existenz einer Verbindung aus den Komponenten ergaben sich nicht.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 61
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 308 (1961), S. 133-142 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Non-electrolytic binuclear complexes of the composition [MeX1{OC3H6N(C2H5)2}1]2 are formed by interaction between 3-N,N-diethyl aminopropanol and Cu- and Zn-halo- genides, respectively. Using 2-N,N-diethyl aminoethanthiol, Zn- and Ni-compounds of the same kind have been prepared. N,N,N′-triethyl ethylene diamine yields ordinary mono- nuclear complexes, [enCuX2], and binuclear compounds. Only mononuclear complexes of copper are formed by N,N-diethyl ethylene diamine.
    Notes: 3-N,N-diäthylaminopropanol bildet ebenso wie das entsprechende Äthanolamin mit Kupfer- bzw. Zinkhalogeniden Zweikernkomplexe [CuX1{OC3H6N(C2H5)2}1]2 von Nichtelektrolytcharakter. Vom 2-N,N-diäthylaminoäthanthiol konnten gleichartige Verbindungen nur mit Zinkhalogeniden und erstmalig auch mit Nickelsalzen erhalten werden. Das N,N,N′-Triäthyläthylendiamin führte entweder zu Einkernkomplexen [en CuX2] der üblichen Art oder bei Überschuß zu Zweikernkomplexen von anderer Zusammensetzung und Konstitution. Das N,N-Diäthyläthylendiamin verhielt sich als Ligand praktisch ebenso wie das unsubstituierte Äthylendiamin und lieferte mit Kupferhalogeniden lediglich Einkernkomplexe.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 62
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 309 (1961), S. 233-244 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: A culminative effect of some factors, which are responsible for the formation of aluminum hydroxide crystals has been observed in experiments treating alkali aluminates by CO2 and aqueous solutions of aluminum salts by alkali.The concentration of the OH-ions, the temperature of the reaction, and the kind of bond of water decide the nature of the precipitation products.The precipitated materials have been identified by X-ray diagrams, phase contrast microscopy, electron microscopy, and IR-spectroscopy.
    Notes: Fällungsversuche mit Aluminatlaugen und wäßrigen Lösungen von Aluminiumsalzen haben das Zusammenwirken einiger Faktoren, die für die Bildung kristalliner Aluminium-trihydroxide verantwortlich sind, erkennen lassen. Die OH--Ionenkonzentration, die Reaktionstemperatur und die Art der Bindung des Wassers bestimmen den Charakter des Fällungsproduktes. Die Identifizierung der ausgefällten Materialien geschah unter Verwendung des Röntgendiffraktometers, der Phasenkontrastmikroskopie, der Elektronenmikroskopie und der Infrarotspektroskopie.
    Additional Material: 5 Tab.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 306 (1960), S. 312-316 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Diskussion und Untersuchung der polarographischen Reversibilität im System Ti3+/Ti4+. Reversible Wellen treten bei Oxydation bzw. Reduktion hydratisierter Sulfatokomplexe auf, z. B. nach .Irreversibilität ist auf die Bildung hydrolysierter Sulfatokomplexe zurückzuführen.
    Notes: The polarographic reversibility of the Ti3+/Ti4+ couple has been discussed the conditions of reversibility have been established and confirmed by several polarographic techniques. The reversible waves, anodic or cathodic are due respectively to the oxidation and reduction of hydrated sulphate complexes, viz. .Irreversibility is due to the formation of some hydrolysed sulphate complexes.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 309 (1961), S. 171-180 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The IR-spectra of the gaseous thionylimides OSNH and OSND and an assignment of the fundamental vibrations are communicated. The compounds have the structure 0—S—N—X with ∢OSN ≈ 120° and ∢SNX = 110° → 130°, X being probably in the OSN-plane. From the SO- and SN-valence force constants (8.7 and 8.3 mdyn/Å, respectively), SO-and SN-bond orders of 1.8 and 1.9 result.
    Notes: Die Infrarotspektren der gasförmigen Thionylimide OSNH und OSND werden mitgeteilt und eine Zuordnung der Grundschwingungen vorgenommen. Die Moleküle besitzen die Struktur O—S—N—X; ∢OSN ≈ 120°; ∢SNX = 110° → 130°; X befindet sich vermutlich in der OSN-Ebene. Ob eine cis- oder trans-Form vorliegt, kann nicht entschieden werden. Die SO- und SN-Valenzkraftkonstanten betragen 8,7 und 8,3 mdyn/Å, daraus ergeben sich die SO- und SN-Bindungsgrade zu 1,8 und 1,9.
    Additional Material: 5 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 65
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 311 (1961), S. 212-223 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The RAMAN and IR-spectra of trisulfuryl chloride are observed and discussed. The symmetries belonging to the point groups C2 h and D2 h are excluded by structure considerations. The structures C1, C2, Cs and C2 v are remaining. The stretching frequencies are assigned. It has been found that the stretching frequencies of the (sulfuroxygen)-double bond and the single bond are doubled in consequence of the central SO3 group. The known RAMAN-spectrum of disulfuryl chloride is completed by the infrared spectrum.
    Notes: Die RAMAN- und Ultrarotspektren des Trisulfurylchlorides wurden aufgenommen und diskutiert. Durch Strukturbetrachtungen werden die Symmetrien der Punktgruppen C2 h und D2 h ausgeschlossen. Offen bleiben die Strukturen C1, C2Cs und C2 v. Die Valenzfrequenzen werden zugeordnet. Es zeigt sich, daß sowohl die Zahl der Valenzfrequenzen der Schwefel - Sauerstoff-Doppelbindung als auch die der Einfachbindung infolge der mittelständigen SO3-Gruppe verdoppelt werden. - Das bekannte RAMAN-Spektrum des Disulfurylchlorides wird durch das Ultrarotspektrum ergänzt.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 307 (1960), S. 12-14 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The Zeiselmethod for quantitative determination of alkoxygroups may be also applied to the determination of Si—OR groups. In presence of phenol and red phosphorus boiling HI cleaves the Si—OR group quantitatively forming Si—OH and RI. The alkyliodide is converted with Br2 to BrI and alkylbromide; BrI is oxydized with excess Br2 to iodate which can be determined by titration (KI and n/lo Na2S2O3).
    Notes: Die Zeiselsche Methode zur quantitativen Bestimmung von Alkoxylgruppen läßt sich auf die Bestimmung der SiOR-Gruppe ausdehnen. Siedende Jodwasserstoffsäure spaltet in Anwesenheit von Phenol und rotem Phosphor die SiOR-Gruppe quantitativ in SiOH und RJ. Das Alkyljodid wird mit Br2 in JBr und Alkylbromid Überführt, JBr durch Überschüssiges Br2 zum Jodat oxydiert und dieses durch Titration (KJ; 0,1 n Na2S2O3) bestimmt.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Experimental examinations of the theorie of d-electron vacancies of metal catalysts have shown that the influence of additive iron in Ni-catalysts is counterbalanced by small amounts of copper. Copper additions of 5% cause an alteration of the catalytic activity of about one order of magnitude.
    Notes: Versuche zur experimentellen Überprüfung der d-Lücken-Theorie der Metallkatalysatoren zeigen, daß der Einfluß von Eisenzusätzen zu Nickel-Katalysatoren durch geringe Kupfersätze aufgehoben werden kann. Kupferzusätze von 5% bewirken eine Änderung der katalytischen Aktivität um etwa eine Größenordnung.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 143-169 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Compounds of the alkali metals with copper do not exist; only lithium is somewhat soluble in metallic copper. According to literature data silver forms with lithium several intermetallic phases; the phase NaAg2, up to now unknown, was found in the system Na/Ag. Gold forms compounds with all alkali metals. The existance of the following phases could be established by means of thermal analysis: Li15Au4, Li3Au, δ1 and δ2 (∼35 At.-% Au), β′, β′1, and β′2 (between 44.5 and 51%), Li4Au5, α(60-100%), α1 (63-83%), α2 (60%); Na2Au, NaAu, NaAu2; K2Au, KAu, KAu2, KAu4; RbAu, RbAu2, RbAu4; CsAu. The structures of NaAg2, Li15Au4, β′, β′1, β′2, α and α1, furthermore of RbAu and CsAu could be elucidated.The investigated systems show clear correlations; the tendency in forming compounds increases from copper to gold and from caesium to lithium. Broader regions of homogeneity occur only in lithium-containing systems.The volume chemistry of alloys is discussed. In all solid solutions and alloys the alkali metals are strongly contacted; provided that the amount of noble metal is not too small, the “Volume increments in intermetallic compounds” according to W. Biltz can be applied to the alkali metals.
    Notes: Verbindungen der Alkalimetalle mit Kupfer existieren nicht; nur Li löst sich etwas im Cu-Metall. Silber bildet nach Literaturangaben mit Li mehrere intermetallische Phasen; im System Na/Ag wurde die bisher übersehene Phase NaAg2 gefunden. Gold bildet mit allen Alkalimetallen Verbindungen. Durch thermische Analyse wurden folgende Phasen nachgewiesen: Li15Au4, Li3Au, δ1 und δ2 (∼35 At.-% Au), β′, β′1, und β′2 (zwischen 44,5 und 51%), Li4Au5, α (60-100%), α1 (63-83%), α2 (60%). — Na2Au, NaAu, NaAu2 — K2Au, KAu, KAu2, KAu4 — RbAu, RbAu2, RbAu4, — CsAu. Die Strukturen von NaAg2, im System Li/Au von Li15Au4, β′, β′1, β′2, α und α1, ferner von RbAu und CsAu konnten aufgeklärt werden.Die untersuchten Systeme zeigen übersichtliche Verhältnisse; die Tendenz zur Verbindungsbildung steigt vom Kupfer zum Gold und vom Caesium zum Lithium. Breitere Homogenitätsgebiete treten nur bei den Li-haltigen Systemen auf.Die Raumchemie der Legierungen wird besprochen. Bei allen festen Lösungen und Legierungen sind die Alkalimetalle stark kontrahiert; bei nicht zu kleinem Gehalt an Edelmetall finden sich für die Alkalimetalle die „Volumeninkremente in intermetallischen Verbindungen“ nach W. Biltz.
    Additional Material: 20 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 12-25 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The neutralization-like reactions occuring in the ionizing solvent benzoyl fluoride between acid- and base-like compounds have been investigated by conductometric, potentiometric, and preparative methods. Similarly, replacement reactions between salt-like and strongly basic compounds were studied.From the potentiometric measurements, the maximum value of the ionic product of benzoyl fluoride at 20°C is supposed to be [C6H5CO+][F-] 〈 10-19.
    Notes: Die in dem ionisierenden Solvens Benzoylfluorid aufgefundenen Säuren- und Basenanalogen wurden in neutralisationsanalogen Umsetzungen zu den entsprechenden salzanalogen Verbindungen unter gleichzeitiger Bildung von Solvensmolekülen umgesetzt. Weiterhin wurden zwischen salzanalogen Verbindungen, die sich von einem schwachen Basenanalogen ableiten, und starken Basenanalogen Verdrängungstitrationen durchgeführt. Die Reaktionen wurden konduktometrisch und potentiometrisch verfolgt, teilweise wurden die gebildeten Salzanalogen präparativ dargestellt. Aus dem Verlauf der potentiometrischen Titrationen wurde die obere Grenze des Ionenproduktes des Benzoylfluorides bei 20° zu [C6H5CO+][F-] 〈 10-19 abgeschätzt.
    Additional Material: 18 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 26-31 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Solutions of GeCl4 in strong HCl (〉6 n) exhibit strong absorption in the UV-region at 2100-2150 Å, proportional to both HCl- and GeCl4-concentration and - at constant acid concentration - according to the Lambert-Beer law.The [GeCl6]2--ion is supposed to be the absorbing species. The molar extinction coefficient and the equilibrium constant of the reaction 2Cl- + GeCl4 ⇄ [GeCl6]2- have been estimated.Alkali chlorides enlarge the absorption efficieny of these solutions. The effect decreases from LiCl to CsCl.
    Notes: Salzsaure Lösungen von Germanium(IV)-chlorid zeigen oberhalb einer Salzsäurekonzentration von 6 n im UV-Gebiet von 2100-2150 Å eine starke Absorption, die sowohl der Salzsäure- als auch Germaniumkonzentration proportional ist. Im untersuchten Germaniumkonzentrationsbereich gilt bei konstanter Säurekonzentration das Lambert-Beersche Gesetz. Da weder eine wäßrige Lösung von GeO2 noch GeCl4 in Methanol unter vergleichbaren Konzentrationsbedingungen eine nennenswerte Absorption aufweisen, wird als absorbierender Körper in salzsaurer Lösung das GeCl62--Ion angenommen. Aus den Meßergebnissen konnte die Gleichgewichtskonstante der Reaktion 2 Cl- + GeCl4 ⇌ GeCl62- sowie der molare Extinktionskoeffizient berechnet werden. Alkalichloride erhöhen das Absorptionsvermögen salzsaurer Lösungen von GeCl4. Der Effekt nimmt innerhalb der Gruppe vom LiCl zum CsCl hin ab.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 121-122 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 123-142 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: By reaction of (N2H5)2SO4 with NaBH4, hydrazine borine (m. p. 61°C) is obtained in good yields. Solubilities, dipole moment, crystal structure and IR-absorption were studied. In the pyrolysis of this compound, one mole of hydrogen and a part of the hydrazine are released. Under controlled conditions, H2B—NHNH—BH2 can be isolated from the products of pyrolysis in good yields as a crystalline polymeric compound, stable in water and acids. Powder diagrams and IR-spectra were taken. Further pyrolysis leads to instable or even explosive compounds with compositions near (HBN)n which contain still N—N-bonds.
    Notes: Durch Umsetzung von Hydrazinsulfat mit Natriumboranat wird das Monoborinhydrazin in guten Ausbeuten erhalten, Fp. 61°. Löslichkeiten, Dipolmoment, Kristallstruktur und IR-Spektren wurden untersucht. Bei der Pyrolyse wird rasch ein Mol Wasserstoff und ein Teil des Hydrazins abgeben. Aus den Reaktionsprodukten läßt sich unter bestimmten Versuchsbedingungen mit guten Ausbeuten H2B—NH—NH—BH2 isolieren, das als Polymeres vorliegt und gegenüber Wasser und auch Säuren unempfindlich ist. Auch diese Verbindung ist kristallin und wurde durch ihr Debyeogramm und ihr IR-Spektrum charakterisiert. Die weitere Pyrolyse führt zu wenig beständigen, teilweise explosiven Verbindungen der ungefähren Zusammensetzung (HBN)n, in der auch noch die N—N-Bindung des Hydrazins zum größten Teil erhalten ist.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 1-11 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The physical and solvent properties of benzoyl fluoride, acting as an ionizing solvent for many inorganic and organic compounds, have been investigated. Numerous compounds increase the poor specific self-conductivity of the pure solvent (χ20° = 1 · 10-8 mho cm-1). From the assumed small self-dissoziation of pure benzoyl fluoride according to C6H5COF ⇌ C6H5CO+ + F-, a classification of the soluble compounds is given on the basis of their acid-base-reactions.
    Notes: Im Rahmen von Untersuchungen an ionisierenden Lösungsmitteln wird Benzoylfluorid unter diesem Gesichtspunkt als Lösungsmittel untersucht. Die physikalischen Daten des Benzoylfluorides werden soweit bekannt zusammengestellt und teilweise erstmalig bzw. erneut bestimmt. Es wird ein Überblick über das Lösevermögen des Benzoylfluorides für anorganische und organische Stoffe gegeben. Zahlreiche Substanzen erhöhen beim Lösen in Benzoylfluorid die sehr geringe spezifische Eigenleitfähigkeit des reinen Lösungsmittels von χ20° = 1 · 10-8 ω-1 cm-1 bedeutend. Die spezifischen und molaren Leitfähigkeiten einiger dieser Verbindungen werden bestimmt. Als Ursache der geringen Eigenleitfähigkeit des reinen Benzoylfluorides muß eine sehr geringe Eigendissoziation des Benzoylfluorides nach C6H5COF ⇌ C6H5CO+ + F- angenommen werden. Entsprechend diesem Dissoziationsschema werden die in Benzoylfluorid löslichen Verbindungen in säuren-, basen- und salzanaloge Stoffe sowie in Substanzen, die in das Solvosystem des Benzoylfluorides nicht eingreifen, eingeteilt.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 74
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 32-42 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Symmetric bis-(silyl) hydrazines and monisilyl hydrazines with blocked functions at the neighbouring N-atom react with chlorosilanes only after metallation of a NH-group by LiC6H5, yielding tris- and asymm. bis-(trialkylsilyl) hydrazines, respectively (equations in „Inhaltsübersicht“).
    Notes: Symmetrisch zweifach silylsubstituierte Hydrazine reagieren nicht direkt mit Chlorsilanen, sondern erst nach vorangehender Metallierung einer NH-Gruppe durch Lithium-phenyl: R3SiNHNHSiR3 + LiC6H5 + R′3SiCl → ( R′3Si)(R3Si)NNHSiR3 + LiCl + C6H6.Das gleiche gilt für Monosilylhydrazine mit blockierten Funktionen am benachbarten N-Atom: R′R″NNHSiR3+ LiC6H5 + R3SiCl → R′R″NN(SiR3)2 + LiCl + C6H6.Es konnten so dreifach und asymmetrisch zweifach trialkylsilylsubstituierte Hydrazine bequem dargestellt werden.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 50-52 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Trimethyl chlorosilane reacts with sodium forming hexamethyl disilane the preparation of which is successful with aluminium chloride as a catalyst and special apparative methods. While t-butyl chloride forms under analogous conditions small amounts of hexamethyl ethane resp., together with trimethylchlorosilane, t-butyltrimethylsilane, experiments for the preparation of octamethyl trisilane have failed.
    Notes: Trimethylchlorsilan reagiert mit Natrium zum Hexamethyldisilan. Die präparative Darstellung gelingt mit Aluminiumchlorid als Katalysator und speziellen apparativen Maßnahmen. Während sich unter gleichen Bedingungen aus t-Butylchlorid geringste Mengen Hexamethyläthan bzw. mit Trimethylchlorsilan t-Butyltrimethylsilan bilden, schlagen Versuche zur Darstellung vom Octamethyltrisilan fehl.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 43-49 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Complex compounds of the general composition [{(C6H5)2P—P(C6H5)2}2MeX2] the nonelectrolytic character of which has been proved by measuring the conductivities are formed from (C6H5)2P—P(C6H5)2 and anhydrous salts MeX2—NiBr2, PdCl2, CoBr2, CoJ2 — in benzene resp. alcohol. The structural configuration of these complexes is discussed on the basis of molecular weight determinations, magnetic measurements and such of the dipole moments, respectively. CuCl reacts with (C6H5)2P—P(C6H5)2 in the molecular ration 1:1.
    Notes: Tetraphenyldiphosphin reagiert als einzähliger Komplexligand mit wasserfreiem NiBr2, PdCl2, CoBr2, CoJ2 in Toluol, Benzol bzw. Alkohol unter Bildung von Komplexen der allgemeinen Zusammensetzung [{(C6H5)2P—P (C6H5)2}2MeX2]. An Hand magnetischer Untersuchungen, Dipolmoment- und Leitfähigkeitsmessungen ist für [{(C6H5)2P—P (C6H5)2}2NiBr2], [{(C6H5)2P—P (C6H5)2}2PdCl2] u. [{(C6H5)2P—P (C6H5)2}2CoBr2] ein planquadratischer Bau anzunehmen. Das [{(C6H5)2P—P (C6H5)2}2CoJ2] ist auf Grund des magnetischen Verhaltens tetraedrisch konfiguriert. Kupfer(I)-salze setzen sich mit (C6H5)2P—P(C6H5)2 im Mol.-Verh. von 1:1 um. Das (C6H5)2P—P(C6H5)2 · CuCl gleicht hinsichtlich des strukturellen Aufbaues den analogen Kupfer(I)-Komplexen prim., sek. und tert. Phosphine.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 69-77 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The exchange reactions occurring rapidly and completely between Si—Cl- and Si—N-bonds in dilute benzene solutions have been investigated by dielectric measurements. The direction of exchange depends on the nature of other Si-ligands.
    Notes: Mit Hilfe einer dielektrischen Meßmethode wird gezeigt, daß in verdünnten benzolischen Lösungen bei Zimmertemperatur Austauschreaktionen zwischen SiCl- und SiN-Verbindungen vonstatten gehen, die rasch und völlig nach einer Seite verlaufen. Diese Reaktionen gestatten Aussagen über die nicht unmittelbar am Austausch beteiligten Gruppen.
    Additional Material: 10 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 53-68 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Several alkali-alkaline-earth-phosphates, -arsenates and -vanadates of the general formula MeIMeIIXVO4 have been prepared by sintering or fusing the respective components. Using the isotypism of these compounds with K2SO4, the lattice constants of the low-temperature (NT-) and high-temperature (HT-) modifications have been determined. The space groups are D2h16 for the NT-forms and D3d3 for the HT-forms.The HT-forms of NaBaPO4, NaSrPO4, NaBaAsO4, and of the vanadates of Sr and Ba are unstable, yielding the tertiary salts Me3IXO4 and Me3II(XO4)2 at higher temperatures.Investigating the behaviour of KSrPO4 and KSrVO4, it has been shown that this type of compounds is hydrolyzed to hydroxyapatites.
    Notes: Durch Sintern oder Schmelzen entsprechender Mischungen der Komponenten werden folgende Alkali-Erdalkaliphosphate, -arsenate und -vanadate hergestellt: Na(K)Ca(Sr, Ba) P(As, V)O4. Ausgehend von der Isotypie des Kaliumsulfates mit derartigen A2XO4-Verbindungen werden deren Gitterkonstanten für die rhombischen Niedertemperatur(NT)-bzw. für die hexagonalen Hochtemperatur(HT)-Formen berechnet. Alle Verbindungen kristallisieren in den Raumgruppen D2h16 bzw. D3d3. Die HT-Formen von NaBaPO4, NaSrAsO4, NaBaAsO4 und der Vanadate des Sr und Ba sind unbeständig. In diesen Fällen tritt beim Erhitzen Zersetzung zu tertiären Salzen Me3IXO4 und Me3II(XO4)2 ein. Der Grund für die Zersetzung kann aus der Feldstärkentheorie von Dietzel hergeleitet werden. - An den Beispielen des KSrPO4 und des KSrVO4 wird gezeigt, daß die Verbindungen durch Wasser zu den entsprechenden Hydroxylapatiten hydrolysiert werden.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 86-89 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: It is shown that the reaction between molybdenum pentachloride and methanol proceeds in two ways. The resulting compounds are described.
    Notes: Es wird gezeigt, daß die Reaktion zwischen Molybdänpentachlorid und Methylalkohol in zwei Richtungen verlaufen kann. Die Reaktionsprodukte werden beschrieben.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 80
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 78-85 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The dipole moments of some dimethyl aminosilanes are reported. There are considerable deviations from the additivity of constant bond moments, indicating a partial double bond character of the Si—N-bond.
    Notes: Die Dipolmomente einiger Dimethylaminosilanderivate wurden bestimmt. Der Vergleich der Dimethylaminochlorsilane mit den entsprechenden Methylchlorsilanen und Dimethylaminomethylsilanen zeigt bedeutende Abweichungen von der Additivität konstanter Bindungsmomente. Diese Abweichungen werden unter dem Gesichtspunkt der Herausbildung partieller Si—N-Doppelbindungen diskutiert.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 90-93 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The action of ammonia or amines on disulfuryl fluoride in a molar ratio of 2:1 does not lead to a substitution of fluorine at lower temperatures. The primary step in the reaction is the aminolytic fission of the (S—O—S)-bond. The reaction is suitable for the preparation of the amidosulphuric acid fluoride and its N-alkyl derivatives.
    Notes: Die Einwirkung von Ammoniak oder Aminen auf Disulfurylfluorid im Mol-Verhältnis 2:1 führt bei niederen Temperaturen nicht zu einer Fluor-Substitution. Der primäre Reaktionsschritt ist die ammonolytische Spaltung der S—O—S-Bindung. Die Umsetzung ist zur präparativen Gewinnung des Amidoschwefelsäurefluorids und seiner N-Alkylderivate geeignet.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 94-99 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The preparation of a number of esters of amidosulphonic acid from amidosulphonic acid chloride and alcoholates is described. The properties and reactions of the esters are communicated.
    Notes: Es wird die Darstellung einiger Ester der Amidoschwefelsäure aus Amidoschwefel-säurechlorid und Alkoholaten beschrieben. Eigenschaften und Reaktionen der Ester werden mitgeteilt.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 113-113 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 100-109 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Synthesis and properties of the compounds X(CH3)2SiNHSi(CH3)2X (X = H, C6H5, Cl, and Br) are described. The products of hydrolysis and the relative rate of hydrolysis  -  including that of (CH3)3SiNHSi(CH3)3  -  are studied. The results are discussed regarding bond properties and steric effects.
    Notes: Darstellung und Eigenschaften der Tetramethyldisilazane X(CH3)2SiNHSi(CH3)2X mit X = H, C6H5, Cl und Br werden beschrieben. Insbesondere wurden die Hydrolyseprodukte dieser Stoffe und die relative Hydrolysegeschwindigkeit einschließlich der des (CH3)3SiNHSi(CH3)3 näher studiert. Die Ergebnisse werden in bindungstheoretischer Hinsicht diskutiert.
    Additional Material: 1 Tab.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 110-113 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The infrared spectra of NaHC2 and Na2C2, prepared by known procedures, were obtained. All the three expected frequencies for NaHC2 could be observed. The force constants were calculated. They show the expected decrease with the increase of lone electron pairs. For Na2C2 no C—C stretching frequency was observed. The compound is easily oxidized to carbonate.
    Notes: Nach bekannten Verfahren wurde Mono- und Di-Natriumacetylid dargestellt und deren Infrarot-Spektren aufgenommen. Bei der Monoverbindung wurden die drei zu erwartenden Frequenzen erhalten und die Kraftkonstanten berechnet. Auch bei diesem Ion bringt die Zunahme freier Elektronenpaare eine Verminderung der Kraftkonstante. In der Dinatriumverbindung konnte die C≡C-Valenzschwingung nicht ermittelt werden. Dagegen wurde leichte Oxydierbarkeit zu Carbonat festgestellt.
    Additional Material: 2 Tab.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 114-120 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Paper chromatography of PO(NH2)3 in liquid NH3 is described, and the RAMAN spectrum of the solid as well as the infrared spectrum of the aquous solution is given together with corrections of former assignments. By comparison of force constants and frequencies it is shown, that phosphorus in PO(NH2)3 and PS(NH2)3 as in a less electro-negative environment uses d-electrons for bonding only to a small degree.
    Notes: Die Papierchromatographie von PO(NH2)3 in flüssigen NH3 wird beschrieben und das RAMAN-Spektrum der festen Substanz sowie das Infrarotspektrum der wäßrigen Lösung mitgeteilt, zusammen mit Berichtigungen einer früheren Zuordnung. Durch Vergleiche von Kraftkonstanten und Frequenzen wird gezeigt, daß d-Elektronen des Phosphors in PO(NH2)3 und in PS(NH2)3 als in einer wenig elektronegativen Umgebung nur in einem geringen Maße an den Bindungen beteiligt sind.
    Additional Material: 2 Tab.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 185-194 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: From solutions of SrCl2 containing KH2PO4 in excess, well crystallized SrHPO4 is precipitated by KOH at pH = 6-8. At higher pH-values, strontium hydroxy-apatite is obtained. If SrCl2 is in excess, at all pH-values hydroxy-apatite is formed. Alkali chlorides favourise the formation of apatite; in the presence of them, apatite is formed at all pH-values if their concentration is at least 1,5 n.Barium ions form at pH = 6-8 the secondary phosphate, too. At higher pH-values, however, tertiary phosphate is obtained instead of apatite. In the presence of alkali chlorides, barium hydroxy-apatite is precipitated from aqueous solutions only at pH = 10.
    Notes: Aus Strontiumchloridlösungen, die überschüssiges KH2PO4 enthalten, fällt mit KOH be pH 6-8 gut kristallisiertes sekundäres Strontiumphosphat, bei höheren pH-Werten dagegen Strontiumhydroxylapatit. Liegt überschüssiges SrCl2 vor, so entsteht bei allen pH-Werten nur Hydroxylapatit. Alkalichloride begünstigen die Apatitbildung; in ihrer Gegenwart fällt, sofern ihre Konzentration mindestens 1,5 n beträgt, ebenfalls bei allen pH-Werten Apatit aus. - Bariumionen liefern bei pH 6-8 ebenfalls das sekundäre Phosphat, bei höheren pH-Werten jedoch nicht Apatit, sondern das tertiäre Phosphat. Barium-hydroxylapatit wird aus wäßrigen Lösung in Gegenwart von Alkalichloriden erst bei pH 10 ausgefällt.
    Additional Material: 4 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 195-203 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Paper chromatography and paper electrophoresis have shown that fluorozirconium and hydroxofluoro zirconium komplexes are easily altered.The easily hydrolyzable pentafluorozirconates have been identified by means of a weakly acid chromatography solvent. Because of the complete dissoziation \documentclass{article}\pagestyle{empty}\begin{document}$$ \left[{{\rm ZrF}_{\rm 7} } \right]^{3 - } \mathbin{\lower.3ex\hbox{$\buildrel\textstyle\rightarrow\over{\smash{\leftarrow}\vphantom{_{\vbox to.5ex{\vss}}}}$}} \left[{{\rm ZrF}_{\rm 6} } \right]^{2 - } + {\rm F}^{\rm - } $$\end{document} occuring during the chromatographic ion separation experiment, only [ZrF6]2-ions are detectable on the chromatogram. Kationic zirconium complexes are formed in strongly acid chromatography solvents.
    Notes: Mit Hilfe von papierchromatographischen und -elektrophoretischen Untersuchungen wird gezeigt, daß Fluorozirkon- und Hydroxofluorozirkon-Komplexe je nach den angewandten Bedingungen sehr leicht Veränderungen unterliegen können. Der Nachweis der leicht hydrolysierenden Pentafluorozirkonate gelingt mit einem schwach sauren Laufmittel. Heptafluorozirkonate dissoziieren wegen der Ionentrennung vollständig nach \documentclass{article}\pagestyle{empty}\begin{document}$$ \left[{{\rm ZrF}_{\rm 7} } \right]^{3 - } \mathbin{\lower.3ex\hbox{$\buildrel\textstyle\rightarrow\over{\smash{\leftarrow}\vphantom{_{\vbox to.5ex{\vss}}}}$}} \left[{{\rm ZrF}_{\rm 6} } \right]^{2 - } + {\rm F}^{\rm - } $$\end{document} so daß nur [ZrF6]2--Ionen auf dem Chromatogramm sichtbar gemacht werden können. Bei Verwendung stark saurer Laufmittel bilden sich kationische Zirkon-Komplexe.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 204-216 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Acid hydrolysis of K- and [NH4][ZrF5(H2O)] yields K1.5H0.5Zr2F8O and [NH4]1.3H0.7Zr2F8O, respectively. By alkaline hydrolysis of K- and NH4-fluorozirconates, the compounds K- and [NH4][ZrF3(OH)2(H2O)] are formed. These are easily dehydrated to K- and [NH4]ZrF3(OH)2, respectively. It is assumed that in the two latter compounds as well as in KZrF5 and [NH4]ZrF5 zirconium has a higher co-ordination number than 5, resulting from fluorine bridging.The thermal decomposition reactions \documentclass{article}\pagestyle{empty}\begin{document}$ \left[{{\rm NH}_{\rm 4} } \right]{\rm ZrF}_{\rm 3} \left({{\rm OH}} \right)_2 \buildrel \Delta \over \longrightarrow \left[{{\rm NH}_{\rm 4} } \right]_2 {\rm Zr}_{\rm 4} {\rm F}_{{\rm 12}} {\rm O}_{\rm 3} \buildrel { 〉 240^ \circ } \over \longrightarrow {\rm Zr}_{\rm 4} {\rm F}_{{\rm 10}} {\rm O}_{\rm 3} $\end{document} and \documentclass{article}\pagestyle{empty}\begin{document}$$ {\rm KZrF}_{\rm 3} \left({{\rm OH}} \right)_2 \buildrel \Delta \over \longrightarrow {\rm KZrF}_{\rm 3} {\rm O} $$\end{document} yielding still higher molecular compounds are discussed.
    Notes: Durch saure Hydrolyse von Kalium- und Ammoniumpentafluorozirkonatmonohydrat, die mit [ZrF5(H2O)]--Ionen zur formulieren sind, entstehen die Verbindungen K1,5H0,5Zr2F8O bzw. [NH4]1,3H0,7Zr2F8O. Die alkalische Hydrolyse von Kalium- und Ammoniumfluorozirkonaten führt zu den Verbindungen K[ZrF3(OH)2(H2O)] und [NH4][ZrF3(OH)2(H2O)], die sich leicht zu KZrF3(OH)2 bzw. [NH4]ZrF3(OH)2 entwässern lassen. Es ist anzunehmen, daß in den wasserfreien Verbindungen sowie in KZrF5 bzw. [NH4]ZrF5 nicht die Koordinationszahl 5 am Zirkon vorliegt, sondern durch Fluorbrücken eine höhere Koordination erreicht wird. Die thermische Zersetzung von [NH4]ZrF3(OH)2 führt zur [NH4]2 Zr4F12O3, das oberhalb 240° unter [NH4]F-Abspaltung in das definierte Oxyfluorid Zr4F10O3 übergeht. KZrF3(OH)2 liefert bei der thermischen Zersetzung die außerordentlich schwer lösliche Verbindung KZrF3O. Alle nicht in Komplexklammern eingefaßten Anionen-Gruppierungen sind nur als Baueinheiten zu verstehen, die über Fluorbrücken zu höher molekularen Gebilden zusammengefaßt sind.
    Additional Material: 7 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 169-179 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Ditertiary phosphines of the type (C6H11)2P—(CH2)n—P(C6H11)2 - with n = 3; 4; 5 - react with anhydrous nickel, cobalt and iron salts forming chelate complexes of the general composition [(C6H11)2P—(CH2)n—P(C6H11)2MeX2] - (Me = Ni, Co, Fe; X = Cl, Br, J, NO3). Whereas the cobalt complexes have a tetrahedral configuration, those of nickel are diamagnetic and have a planar arrangement of ligands. The preparations of [(C6H11)2P—;(CH2)3—P(C6H11)2CuBr] (coordination number of copper = 3) and [(C6H11)2P—(CH2)5—P(C6H11)2Cu2Br2] are described.
    Notes: Die ditertiären Phosphine vom Typ des Trimethylen-1,3-, des Tetramethylen-1,4- und des Pentamethylen-1,5-dicyclohexylphosphins bilden mit wasserfreien Nickel-, Kobalt- und Eisen(II)-Salzen Komplexe der allgemeinen Formel [(C6H11)2P—(CH2)n—P(C6H11)2MeX2], wobei die Liganden mit dem Zentralatom komplexcyclische 6-, 7- und 8-Ringe bilden. Während die Chelatkomplexe des Nickels allgemein planquadratisch konfiguriert sind, weisen diejenigen des Kobalts einen Tetraederbau auf. Die Eisen(II)-Komplexe sind relativ instabil, was eine lockere Koordination der ditertiären Phosphine andeutet, so daß Strukturaussagen auf Grund von Dipolmoment- sowie magnetischen Messungen und Molekulargewichtsbestimmungen nicht möglich sind. Die Kettenlänge zwischen den beiden Phosphoratomen ist nur bei der Bildung der Nickel- und der Kupfer(I)-Komplexe von Einfluß. So vermag (C6H11)2P—(CH2)5—P(C6H11)2 mit NiCl2 das vermutlich trans-konfigurierte [(C6H11)2P—(CH2)5—P(C6H11)2NiCl2] zu bilden. In den analogen Verbindungen des (C6H11)2P—(CH2)3—P(C6H11)2 und des (C6H11)2P—(CH2)4—P(C6H11)2 erfolgt die Fixierung der Liganden in cis-Stellung. Gegenüber Kupfer(I)-bromid verhält sich (C6H11)2P—(CH2)3—P(C6H11)2 als zweizähliger Ligand, wobei eine Substanz der Formel [(C6H11)2P—(CH2)3—P(C6H11)2CuBr] mit koordinativ dreizähligem Kupfer resultiert. Bei entsprechender Reaktion des (C6H11)2P—(CH2)5—P(C6H11)2 entsteht hingegen das [(C6H11)2P—(CH2)5—P(C6H11)2Cu2Br2], und bei Verwendung des (C6H11)2P—(CH2)4—P(C6H11)2 können beide Komplextypen auftreten.
    Additional Material: 2 Tab.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 195-200 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The interaction between S4N4 and diphenyl diazomethane or fluorenyl diazomethane yields bis-diphenyl-methylene trisulfur tetranitride, [(C6H5)2C]2S3N4, and difluorenyliden trisulfur tetranitride, (C13N8)2S3N4, respectively. The preparation methods and the properties of these compounds are described. A reaction mechanism is proposed.
    Notes: Es wurde die Reaktion von S4N4 mit Diazomethanverbindungen untersucht. Die Umsetzung von S4N4 mit Diphenyldiazomethan und Fluorenyldiazomethan führt zu Bisdiphenylmethylen-trischwefel-tetranitrid, [(C6H5)2C]2S3N4, und Difluorenyliden-trischwefeltetranitrid, (C13H8)2S3N4. Herstellung und Eigenschaften dieser Verbindungen sind beschrieben. Für ihre Bildung wird ein Reaktionsmechanismus vorgeschlagen.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 221-224 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: VICKERY asserts scandium hydroxide to be precipitated very incompletely by an aqueous solution of ammonia. This statement is criticized and in contrast it is shown that using the normal conditions of analytical chemistry the precipitation is quantitative. It has to be supposed that the differing observations of VICKERY are caused by methodic errors which probably explain further improbable results published by the author.
    Notes: Die Behauptung VICKERYS, daß Scandiumhydroxid durch Ammoniaklösung nur sehr unvollständig ausgefällt werde, wird kritisiert. Es wird gezeigt, daß die Fällung bei den üblichen analytisch-chemischen Bedingungen quantitativ erfolgt. Die abweichenden Befunde VICKERYS lassen einen methodischen Fehler vermuten, der wahrscheinlich auch weitere Ergebnisse seiner Arbeit entstellt hat.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 230-232 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: In den Systemen Hg(CNS)2—KCN—H2O und Hg(CN)2—KCNS—H2O wurden die Verbindungen KHg(CNS)2CN(I), KHg(CN)2CNS(II) und K2Hg(CN)4(III) erhalten. Während I und III nur aus Lösungen bestimmter Zusammensetzung (KCN · Hg(CNS)2) bzw. 4KCN · 4 Hg (CNS)2 erhalten wurden, kristallisiert II aus Reaktionsmischungen mit starker Variation der Komponenten.
    Notes: The compounds KHg(CNS)2CN(I), KHg(CN)2CNS(II) and K2Hg(CN)4(III) have been isolated from the systems: Hg(CNS)2-KCN—H2O and Hg(CN)2—KCNS—H2O. Whereas I and III are obtained from reaction mixtures of the compositions KCN · Hg(CNS)2 and 4 KCN · Hg(CNS)2, II crystallises out from reaction mixtures constituted with large variations of the components.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The preparation of bis-benzene-chromium(0) in almost theoretical yield is described (one easy catalytic normal-pressure and two room-temperature procedures).The rôle of the aluminium halogenide catalyst forming an intermediate compound of the composition „3[Cr(C6H6)2]AlHal4 · 4 AlHal3“ (with Hal = Cl, Br) has been elucidated.The isolation of this primary complex, its behaviour against ligand exchange, as well as the stability of bis-benzene-chromium(0) and the disproportionation of the [Cr(C6H6)2]+-cation in alkaline solution are communicated.
    Notes: Es werden optimale Bedingungen für die Di-benzol-chrom-Synthese mit fast quantitativer Ausbeute ermittelt, ein bequemes, katalytisches Normaldruckverfahren wird beschrieben und zwei Raumtemperaturverfahren werden angegeben. Es gelingt, die Reaktion in Teilschritte aufzulösen und die Wirkungsweise des Aluminiumhalogenids zu klären. Das Primärprodukt ist „3 [Cr(C6H6)2]AlHal4 · 4 AlHal3“. Es entsteht auch aus Di-benzol-chrom(0) und AlHal3(Hal = Cl, Br) unter Abscheidung von pyrophorem Aluminium.Am Primärkomplex wird ein rascher Ligandenaustausch festgestellt, während Dibenzol-chrom(0) kinetisch bis zu seiner Zersetzungstemperatur völlig stabil ist.Die partielle alkalische Disproportionierung des [Cr(C6H6)2]+-Kations wird beschrieben.
    Additional Material: 6 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 312 (1961), S. 277-281 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: Cs3TbF7, the first fluoro complex of TbIV, has been prepared. The compound is colourless, relatively stable on exposure to air, and paramagnetic (μ = 7.4 μB). According to the powder diagram, Cs3TbF7 is cubic (a = 9,80 Å; Z = 4 formula units per unit cell; dX-ray = 4.88, dpyk = 4.63 g · cm-3) and probably isotype with (NH4)3ZrF7.
    Notes: Als erster Fluorokomplex des vierwertigen Terbiums wurde Cs3TbF7 erhalten, eine farblose, auch an feuchter Luft recht beständige, paramagnetische (μ = 7,4 μB) Verbindung. Nach Pulveraufnahmen kristallisiert sie kubisch (Z = 4, a = 9,80 Å; drö = 4,88, dpyk = 4,63 g · cm-3), vermutlich im (NH4)3ZrF7-Typ.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The mixed-crystal systems SnTe—GeTe, SnTe—SnSe, PbSe—SnSe, and GeTe—SnSe are described. Only in the system SnTe—GeTe, complete miscibility occurs; the other systems exhibit miscibility gaps extending to about 40 mole-%. Vegards law is more or less valid.
    Notes: Es werden die Mischkristallsysteme beschrieben: SnTe—GeTe, SnTe—SnSe, PbSe—SnSe, GeTe—SnSe. Im allgemeinen treten Mischungslücken auf über einen Bereich von etwa 40 Mol-%. Nur das heterotype Mischkristallsystem SnTe—GeTe ist lückenlos. Die VEGARDsche Regel ist mehr oder weniger gut erfüllt.
    Additional Material: 8 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 313 (1961) 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 313 (1961), S. 37-47 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: According to the method of Rice, Freamo, and Grelecki solid chloroamine has been decomposed at -190 °C by ultraviolet irradiation. The blue product formed is stable below -150 °C; it is already known from the analogous decomposition of hydrogen azide, and its formation can be understood only by the primary formation of nitrogen monohydride.  -  This result is supported by the identification of hydrogen cyanate during the thermal decomposition of gaseous chloroamine in the presence of carbon mon oxide (5 to 10 Torr, 500 °C). Under the same conditions, hydrazine too produces hydrogen cyanate.  -  Considering the result of Wannagat and Kohnen, who showed nitrogen monohydride and ammonia to form hydrazine, it follows that it is possible to synthesize hydrazine from chloroamine and ammonia via nitrogen monohydride as an intermediate.
    Notes: In Anlehnung an die Methodik von Rice, Freamo und Grelecki wurde festes Chloramin bei -190 °C durch ultraviolette Strahlung zersetzt. Das entstehende blaue Produkt, beständig unterhalb -150 °C, ist bereits durch die entsprechende Zersetzung des Hydrogenazids bekannt; seine Bildung ist nur durch primäres Auftreten von Stickstoffmonohydrid zu erklären.  -  Dieses Ergebnis wird durch den Nachweis von Hydrogencyanat im Anschluß an die thermische Zersetzung gasförmigen Chloramins in Gegenwart von Kohlenmonoxid (5 bis 10 Torr, 500 °C) bekräftigt. Auch Hydrazin liefert unter diesen Bedingungen Hydrogencyanat.  -  Unter Berücksichtigung des Befundes von Wannagat und Kohnen, daß Stickstoffmonohydrid mit Ammoniak zu Hydrazin reagieren kann, folgt, daß es ein experimentell gangbarer Weg ist, Hydrazin aus Chloramin und Ammoniak über Stickstoffmonohydrid als Zwischenprodukt zu synthetisieren.
    Additional Material: 3 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Electronic Resource
    Electronic Resource
    Weinheim : Wiley-Blackwell
    Zeitschrift für anorganische Chemie 310 (1961), S. 236-241 
    ISSN: 0044-2313
    Keywords: Chemistry ; Inorganic Chemistry
    Source: Wiley InterScience Backfile Collection 1832-2000
    Topics: Chemistry and Pharmacology
    Description / Table of Contents: The compound [SbCl4][SbF6], being the isomeric ionic form of the fluorination-catalyst SbCl2F3, has been prepared from SbF3 and Cl2.
    Notes: Es wird die aus SbF3 und Cl2 zu gewinnende Verbindung [SbCl4][SbF6] beschrieben, eine heteropolare isomere Form zu der als Fluorierungskatalysator patentierten Substanz SbCl2F3.
    Additional Material: 1 Ill.
    Type of Medium: Electronic Resource
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...