ALBERT

Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.

Note: Cover; Title Page; Copyright Page; Dedication Page; Table of Contents; Acknowledgments; Part One: Prehistory; 1. Introduction; 2. Sex and Salesmanship; 3. Seduction and the Emotions; 4. Social Primates; Part Two: Today; 5. Testing for Talent; 6. What Do Women Want?; 7. Coalitions of the Willing; 8. The Scarcity of Charm; 9. The Tender War; Notes; References; Index.

Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; PART I. THE COMPLEXITY FRAME FOR POLICY; Chapter 1. Twin Peaks; Chapter 2. Government With, Not Versus, the Market; Chapter 3. I Pencil Revisited: Beyond Market Fundamentalism; Chapter 4. The Complexity Policy Frame; PART II. EXPLORING THE FOUNDATIONS; Chapter 5. How Economics Lost the Complexity Vision; Chapter 6. How Macroeconomics Lost the Complexity Vision; Chapter 7. Complexity: A New Kind of Science?; Chapter 8: A New Kind of Complexity Economics?; Chapter 9. Nudging toward a Complexity Policy Frame. , PART III. LAISSEZ-FAIRE ACTIVISM IN PRACTICEChapter 10. The Economics of Influence; Chapter 11. Implementing Influence Policy; Chapter 12. Laissez-Faire Activism; Chapter 13. Getting the Ecostructure of Government Right; PART IV. THE LOST AGENDA; Chapter 14. Getting the Ecostructure of Social Science Education Right; Chapter 15. The Lost Agenda; Notes; Bibliography; Index.

Note: Classical theory of comparative advantageComparative advantage with two factors of production -- Comparative advantage and factor endowments : the Heckscher-Ohlin theorem -- Imperfect competition and economies of scale in trade -- The partial equilibrium analysis of international trade -- Trade restrictions : tariffs -- Non-tariff trade barriers -- Domestic support policies and trade -- Multilateral trade negotiations and U.S. trade policy -- Economic integration -- Foreign exchange markets and the exchange rate -- Agricultural trade and the exchange rate -- International capital movements and multinational corporations -- Agricultural trade and economic development -- Trade and the environment..

Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.

Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System

Note: CONTENTS; List of Figures; List of Tables; List of Contributors; Introduction; PART I: ECONOMISTS ON TRIAL; 1. Who predicted the crisis and what can we learn from them? ; 2 A brief note on economic recessions, banking reform and the future of capitalism; 3 Understanding crisis: on the meaning of uncertainty and probability; 4 Financial crisis and risk measurement: the historical perspective and a new methodology; 5 Did economic analysis fail in the current financial crisis?; PART II: WHAT DOES HISTORY TELL US? ; 6 Does the current global crisis remind us of the Great Depression?. , 7 Innovation, growth, cycles and finance: three (or four or more) stories from the 1930s and their lessons8 Epic Recession and economic theory; 9 Did asset prices cause the current crisis?; 10 The role of the history of economic thought in the development of economic theory and policy; PART III: COUNTRY CASES IN A GLOBAL CRISIS; 11. Testimony to the Financial Crisis Inquiry Commission by Alan Greenspan; 12 Long-term depression and new markets: economists and the 2008 recession; 13 Manifestations of the global crisis in a small open economy. , 14 The aftermath of a long decade of real nil interest rates (Spain 1996-2008)Index.

Note: Preface; Contributors; Content; Introduction; Cosmology - The Largest Possible Model?; The Standard Model of Cosmology as a Tool for Interpretation and Discovery; Patterns in Physical and Biological Systems; Symmetry and the Explanation of Organismal Form; Pluralistic Modeling of Complex Systems; The Methodological Challenges of Complex Systems; Contested Modeling: The Case of Economics; A Unifying Approach to High- and Low-Level Cognition; High-vs Low-Level Cognition and the Neuro- Emulative Theory of Mental Representation. , Evaluating a Computational Model of Eye-Movement Control in ReadingConsidering Criteria for Model Modification and Theory Change in Psychology; Identification of Kinetic Models by Incremental Refinement; Kinetics, Models, and Mechanism; Modeling Complexity: The Case of Climate Science; Chaos, Plurality, and Model Metrics in Climate Science; Subject Index; Author Index.

Note: The democratic promiseThe deliberative turn in democratic theory -- The elusive concept of empathy -- Empathy in deliberative theory -- Empathy's importance : the empirical evidence -- Deliberative democracy and its critics -- Empathy and democracy..

Note: Book Cover; Title; Copyright; Contents; Figures; Tables; Contributors; Preface; Acknowledgements; 1 Introduction; Part I The Arctic: Context, framework and methodology; 2 Framing oil and gas in the Arctic from a sustainable development perspective; 3 Climate change and consequences for the Arctic; 4 Corporate social responsibility: The economic and institutional responsibility of business in society; 5 Framework and methodology: Regulation and discourse analysis as a research strategy; Part II Legal and institutional framework: Case studies. , 6 Legal and institutional framework: A comparative analysis7 Expanding oil and gas activities on the North Slope of Alaska; 8 Oil and gas activities at the Mackenzie Delta, in Canada's Northwest Territories; 9 Going North: The new petroleum province of Norway; 10 The Russian model: Merging profit and sustainability; Part III Comparisons and managerial implications; 11 Human rights and indigenous peoples in the Arctic: What are the implications for the oil and gas industry?; 12 Perceptions of Arctic challenges: Alaska, Canada, Norway and Russia compared; 13 Managerial implications; Index.

Note: Introduction; Space weather forecasting historically viewed through the lens of meteorology; The Sun as the prime source of space weather; The coupling of the solar wind to the Earth's magnetosphere; Major radiation environments in the heliosphere and their implications for interplanetary travel; Radiation belts and ring current; Ionospheric response; Solar effects in the middle and lower stratosphere and probable associations with the troposphere; Space weather effects on communications; Space weather effects on power grids; Space weather impacts on space radiation protection. , Effects on spacecraft hardware and operationsEffects on satellite navigation; Forecasting space weather.

Note: N.F. entfällt ab 57.2000. - Volltext auch als Teil einer Datenbank verfügbar , Ersch. ab 2000 in engl. Sprache mit dt. Hauptsacht.

Note: Table of Contents Introduction N. J. Price and K. R. McClay https://doi.org/10.1144/GSL.SP.1981.009.01.01 What is a Thrust? What is a Nappe? J. G. Dennis, R. A. Price, J. K. Sales, R. Hatcher, A. W. Bally, W. J. Perry, H. P. Laubscher, R. E. Williams, D. Elliott, D. K. Norris, D. W. Hutton, T. Emmett, and K. R. McClay https://doi.org/10.1144/GSL.SP.1981.009.01.02 I. Mechanics of Thrusts and Nappes Thoughts on the tectonics of folded belts A. W. Bally https://doi.org/10.1144/GSL.SP.1981.009.01.03 Pore pressure, discontinuities, isostasy and overthrusts P. E. Gretener https://doi.org/10.1144/GSL.SP.1981.009.01.04 Gravitational gliding in deltas G. Mandl and W. Crans https://doi.org/10.1144/GSL.SP.1981.009.01.05 Thrust sheet deformation at a ramp: summary and extensions of an earlier model D. V. Wiltschko https://doi.org/10.1144/GSL.SP.1981.009.01.06 Deformation and secondary faulting near the leading edge of a thrust fault D. A. Rodgers and W. D. Rizer https://doi.org/10.1144/GSL.SP.1981.009.01.07 Mechanical model of thrust sheet gliding and imbrication G. Mandl and G. K. Shippam https://doi.org/10.1144/GSL.SP.1981.009.01.08 The rock mechanics of thrust and nappe formation S. A. F. Murrell https://doi.org/10.1144/GSL.SP.1981.009.01.09 Subduction and coeval thrust belts, with particular reference to North America A. G. Smith https://doi.org/10.1144/GSL.SP.1981.009.01.10 The role of gravity in orogenic belts H. Ramberg https://doi.org/10.1144/GSL.SP.1981.009.01.11 II. Rock Products of Thrusting Dynamic analysis of a small imbricate thrust and related structures, Front Ranges, Southern Canadian Rocky Mountains J. H. Spang and S. P. Brown https://doi.org/10.1144/GSL.SP.1981.009.01.12 The microfabric of calcite tectonites from the Helvetic Nappes (Swiss Alps) S. M. Schmid, M. Casey, and J. Starkey https://doi.org/10.1144/GSL.SP.1981.009.01.13 Very low grade metamorphism with a reverse gradient induced by an overthrust in Haute-Savoie (France) J. Aprahamian and J.-L. Pairis https://doi.org/10.1144/GSL.SP.1981.009.01.14 Saline horizons acting as thrust planes along the southern margin of the Damara Orogen (Namibia/SW-Africa) H. J. Behr, H. Ahrendt, A. Schmidt, and K. Weber https://doi.org/10.1144/GSL.SP.1981.009.01.15 Sliding and other deformation mechanisms in a glacier of salt, S Iran C. J. Talbot https://doi.org/10.1144/GSL.SP.1981.009.01.16 The Caledonides of northern Norway: relation between preferred orientation of quartz lattice, strain and translation of the nappes A.-M. Boullier and J.-M. Quenardel https://doi.org/10.1144/GSL.SP.1981.009.01.17 Structure and distribution of fault rocks in the Alpine Fault Zone, New Zealand R. H. Sibson, S. H. White, and B. K. Atkinson https://doi.org/10.1144/GSL.SP.1981.009.01.18 Uplift rates and thermal structure in the Alpine Fault Zone and Alpine Schists, Southern Alps, New Zealand C. J. Adams https://doi.org/10.1144/GSL.SP.1981.009.01.19 III. Thrust and Nappe Regimes. A. ‘The Old World’ Caledonides The internal geometry of nappes: criteria for models of emplacement M. A. Cooper https://doi.org/10.1144/GSL.SP.1981.009.01.20 The strain profile above a major thrust fault, Finnmark, N Norway N. J. Milton and G. D. Williams https://doi.org/10.1144/GSL.SP.1981.009.01.21 The Moine Thrust Zone: an overview K. R. McClay and M. P. Coward https://doi.org/10.1144/GSL.SP.1981.009.01.22 Tectonic slides in the Caledonides D. H. W. Hutton https://doi.org/10.1144/GSL.SP.1981.009.01.23 Estimation of the rate and amount of absolute lateral shortening in an orogen using diachronism and strike slipped segments W. E. A. Phillips https://doi.org/10.1144/GSL.SP.1981.009.01.24 Strain within thrust sheets M. P. Coward and J. H. Kim https://doi.org/10.1144/GSL.SP.1981.009.01.25 III. Thrust and Nappe Regimes. A. ‘The Old World’ Alpine Tectonics of the Helvetic Nappes J. G. Ramsay https://doi.org/10.1144/GSL.SP.1981.009.01.26 The 3D propagation of décollement in the Jura H. P. Laubscher https://doi.org/10.1144/GSL.SP.1981.009.01.27 Fold-and-thrust tectonics in the Helvetic Nappes (E Switzerland) O. A. Pfiffner https://doi.org/10.1144/GSL.SP.1981.009.01.28 Some observations on the development of thrust faults in the Ultradauphinois Zone, French Alps A. Beach https://doi.org/10.1144/GSL.SP.1981.009.01.29 Gravity sliding in the Maritime Alps R. H. Graham https://doi.org/10.1144/GSL.SP.1981.009.01.30 III. Thrust and Nappe Regimes. A. ‘The Old World’ Eurasia Sutures, thrusts and nappes in the Variscan Arc of western Europe: plate tectonic implications Ph. Matte and J. P. Burg https://doi.org/10.1144/GSL.SP.1981.009.01.31 Wrench related thrusting along a Mesozoic-Cenozoic continental margin: Antalya Complex, SW Turkey N. H. Woodcock and A. H. F. Robertson https://doi.org/10.1144/GSL.SP.1981.009.01.32 Thrust and strike slip fault interaction along the Chaman transform zone, Pakistan R. D. Lawrence and R. S. Yeats S. H. Khan, A. Farah, and K. A. DeJong https://doi.org/10.1144/GSL.SP.1981.009.01.33 Active thrusting and the evolution of the Zagros fold belt J. A. Jackson and T. J. Fitch D. P. McKenzie https://doi.org/10.1144/GSL.SP.1981.009.01.34 An overview of thrusts and nappes of western Himalaya V. C. Thakur https://doi.org/10.1144/GSL.SP.1981.009.01.35 Ambiguity in interpretation of seismic data from modern convergent margins: an example from the IPOD Japan Trench transect R. von Huene, M. Arthur, and B. Carson https://doi.org/10.1144/GSL.SP.1981.009.01.36 Geometrical problems and implications of large scale over-thrusting in the Banda Arc -Australian margin collision zone M. G. Audley-Charles https://doi.org/10.1144/GSL.SP.1981.009.01.37 Neogene thrust emplacement from a frontal arc in New Guinea J. Milsom https://doi.org/10.1144/GSL.SP.1981.009.01.38 IV. Thrust and Nappe Regimes. B. ‘The New World’ The Americas The Cordilleran foreland thrust and fold belt in the southern Canadian Rocky Mountains R. A. Price https://doi.org/10.1144/GSL.SP.1981.009.01.39 The nature and significance of large ‘blind’ thrusts within the northern Rocky Mountains of Canada R. I. Thompson https://doi.org/10.1144/GSL.SP.1981.009.01.40 Metamorphic complex of SE Canadian Cordillera and relationship to foreland thrusting R. L. Brown https://doi.org/10.1144/GSL.SP.1981.009.01.41 Thrust nappes in the Rocky Mountain Foothills near Mountain Park, Alberta H. A. K. Charlesworth and W. E. Kilby https://doi.org/10.1144/GSL.SP.1981.009.01.42 Deformational styles in two Mesozoic fault zones, western Washington, USA D. S. Cowan and R. B. Miller https://doi.org/10.1144/GSL.SP.1981.009.01.43 Thrusts and nappes in the North American Appalachian Orogen R. D. Hatcher, Jr. https://doi.org/10.1144/GSL.SP.1981.009.01.44 COCORP seismic reflection profiling across thrust faults J. A. Brewer, F. A. Cook, L. D. Brown, J. E. Oliver, S. Kaufman, and D. S. Albaugh https://doi.org/10.1144/GSL.SP.1981.009.01.45 Mechanisms for basement shortening in the Andean foreland fold belt of southern South America Margaret A. Winslow https://doi.org/10.1144/GSL.SP.1981.009.01.46

Note: Articles Introduction J. Brooks https://doi.org/10.1144/GSL.SP.1983.012.01.01 Geological and Geochemical Studies of Northwest European Continental Shelf The role of the Department of Energy in petroleum exploration of the United Kingdom P. J. Walmsley https://doi.org/10.1144/GSL.SP.1983.012.01.02 Gas Exploration and Reserves in Europe A. Makourine https://doi.org/10.1144/GSL.SP.1983.012.01.03 A Review of Geochemical Data Related to the Northwest European Gas Province P. C. Barnard and B. S. Cooper https://doi.org/10.1144/GSL.SP.1983.012.01.04 Surface Geochemical Exploration in the North Sea J. L. Gevirtz, B. D. Carey, and S. R. Blanco https://doi.org/10.1144/GSL.SP.1983.012.01.05 Analytic Procedure and Results of an Isotope Geochemical Surface Survey in an Area of the British North Sea E. Faber and W. Stahl https://doi.org/10.1144/GSL.SP.1983.012.01.06 Petroleum Offshore Sniffer Exploration J. Sigalove https://doi.org/10.1144/GSL.SP.1983.012.01.07 Petroleum Exploration Onshore U.K. G. J. Candy https://doi.org/10.1144/GSL.SP.1983.012.01.08 North Sea petroleum exploration T. P. Brennand https://doi.org/10.1144/GSL.SP.1983.012.01.09 Exploration of the Norwegian Shelf Hans Rønnevik, Svein Eggen, and Jan Vollset https://doi.org/10.1144/GSL.SP.1983.012.01.10 Stratigraphy and Sedimentation of the Palaeocene Sands in the Northern North Sea D. C. Mudge and G. M. Bliss https://doi.org/10.1144/GSL.SP.1983.012.01.11 Geochemistry of Porosity Enhancement and Reduction in Clastic Sediments C. D. Curtis https://doi.org/10.1144/GSL.SP.1983.012.01.12 Applications of Geochemistry to Sandstone Reservoir Studies Hilary Irwin and Andrew Hurst https://doi.org/10.1144/GSL.SP.1983.012.01.13 Organofacies and Early Maturation Effects in Upper Jurassic Sediments From the Inner Moray Firth Basin, North Sea M. J. Pearson and D. Watkins https://doi.org/10.1144/GSL.SP.1983.012.01.14 Aspects of Burial Diagenesis, Organic Maturation and Palaeothermal History of an Area in the South Viking Graben, North Sea M. J. Pearson, D. Watkins, and J-L Pittion D. Caston and J. S. Small https://doi.org/10.1144/GSL.SP.1983.012.01.15 Some Geological Controls on Oil Composition in the U.K. North Sea C. Cornford, J. A. Morrow, A. Turrington, J. A. Miles, and J. Brooks https://doi.org/10.1144/GSL.SP.1983.012.01.16 Kerogen Types, Organic Maturation and Hydrocarbon Occurrences in the Moray Firth and South Viking Graben, North Sea Basin M. J. Fisher and Jennifer A. Miles https://doi.org/10.1144/GSL.SP.1983.012.01.17 Geochemistry of North and South Brae Areas, North Sea R. H. Reitsema https://doi.org/10.1144/GSL.SP.1983.012.01.18 The Search for Petroleum in Northern Ireland A. E. Griffith https://doi.org/10.1144/GSL.SP.1983.012.01.19 Frontier exploration in Western and Northwest Europe D. G. Roberts https://doi.org/10.1144/GSL.SP.1983.012.01.20 Petroleum Exploration of Europe Origins of Natural Gas in the Po Valley, N. Italy L. Mattavelli, T. Ricchiuto, and D. Grighani M. Schoell https://doi.org/10.1144/GSL.SP.1983.012.01.21 Isotope Geochemistry of Natural Gases in Central Europe M. Schoell and M. J. Whiticar https://doi.org/10.1144/GSL.SP.1983.012.01.22 Geochemical Observations and Oil Genesis in the German Alps and their foreland K. Kuckelkorn, H. Wehner, and H. Hufnagel https://doi.org/10.1144/GSL.SP.1983.012.01.23 Basin Evolution and Hydrocarbon Generation D. P. McKenzie https://doi.org/10.1144/GSL.SP.1983.012.01.25 Oil Potential of Coals: A Geochemical Approach B. Durand and M. Paratte https://doi.org/10.1144/GSL.SP.1983.012.01.26 Pyrolysis-Mass Spectrometry in Coal Chemistry: a study of the coalification of vitrites and the typification of Australian Brown Coals P. A. Schenck, J. W. de Leeuw, and T. C. Viets J. Haverkamp https://doi.org/10.1144/GSL.SP.1983.012.01.27 Identification of Amorphous Sedimentary Organic Matter by Transmitted Light Microscopy D. J. Batten https://doi.org/10.1144/GSL.SP.1983.012.01.28 Spectral Correlation of Spore Coloration Standards P. M. R. Smith https://doi.org/10.1144/GSL.SP.1983.012.01.29 Selection Criteria for the Use of Vitrinite Reflectance as a Maturity Tool J. M. A. Buiskool Toxopeus https://doi.org/10.1144/GSL.SP.1983.012.01.30 Use of Porphyrins as a Maturity Parameter for Oils and Sediments A. J. G. Barwise https://doi.org/10.1144/GSL.SP.1983.012.01.31 Petroleum Geochemical Principles and Techniques Organic Geochemistry and Basin Modelling — Important Tools in Petroleum Exploration D. H. Welte, M. A. Yükler, M. Radke, D. Leythaeuser, U. Mann, and U. Ritter https://doi.org/10.1144/GSL.SP.1983.012.01.24 Geological Information on Hydrocarbon Exploration on the U.K. Continental Shelf Introduction G. G. Baxter https://doi.org/10.1144/GSL.SP.1983.012.01.32 The Compilation of an Earth Science Bibliography for the North Sea and Adjacent Areas D. J. McKay https://doi.org/10.1144/GSL.SP.1983.012.01.33 Commercially Available Geological Databanks—U.K.C.S. P. Wigley https://doi.org/10.1144/GSL.SP.1983.012.01.34 Geological Information from Hydrocarbon Exploration on the United Kingdom Continental Shelf J. R. V. Brooks https://doi.org/10.1144/GSL.SP.1983.012.01.35 EXPHST—A Program to Analyse the History of Exploration Success within a Basin or Country K. J. Chew and H. Stephenson https://doi.org/10.1144/GSL.SP.1983.012.01.36 The Use of Computerized Information in Britoil, Exploration Division G. G. Baxter https://doi.org/10.1144/GSL.SP.1983.012.01.37

Note: Table of Contents Japan The Shimanto Belt of Japan: Cretaceous-lower Miocene active-margin sedimentation A. Taira, H. Okada,J. H. Whitaker, and A. J. Smith https://doi.org/10.1144/GSL.SP.1982.010.01.01 Sedimentation across the Japan Trench off northern Honshu Island Roland von Huene and Michael A. Arthur https://doi.org/10.1144/GSL.SP.1982.010.01.02 Tectonics of some forearc fold belts in and around the arc-arc crossing area in central Japan Yujiro Ogawa https://doi.org/10.1144/GSL.SP.1982.010.01.03 Forearc geological structure of the Japanese Islands Tsunemasa Shiki and Yoshibumi Misawa https://doi.org/10.1144/GSL.SP.1982.010.01.04 Central America Facies belts of the Middle America Trench and forearc region, southern Mexico: results from Leg 66 DSDP J. Casey Moore, Joel S. Watkins, Kenneth J. McMillen, Stephen B. Bachman, Jeremy K. Leggett, Neil Lundberg, Thomas H. Shipley, Jean-Francois Stephan, Floyd W. Beghtel, Arif Butt, Borys M. Didyk, Nobuaki Niitsuma, Les E. Shephard, and Herbert Stradner https://doi.org/10.1144/GSL.SP.1982.010.01.05 Tectonic processes along the Middle America Trench inner slope Thomas H. Shipley, John W. Ladd, Richard T. Buffler, and Joel S. Watkins https://doi.org/10.1144/GSL.SP.1982.010.01.06 Sedimentation in different tectonic environments of the Middle America Trench, southern Mexico and Guatemala Kenneth J. McMillen, Robert H. Enkeboll, J. Casey Moore, Thomas H. Shipley, and John W. Ladd https://doi.org/10.1144/GSL.SP.1982.010.01.07 A summary of Deep Sea Drilling Project Leg 67 shipboard results from the Mid-America Trench transect off Guatemala Roland von Huene, Jean Aubouin, Jacques Azema, Grant Blackinton, Jerry A. Carter, William T. Coulbourn, Darrel S. Cowan, Joseph A. Curiale, Carlos A. Dengo, Richard W. Faas, William Harrison, Reinhard Hesse, Donald M. Hussong, John W. Ladd, … View all authors https://doi.org/10.1144/GSL.SP.1982.010.01.08 Evolution of the slope landward of the Middle America Trench, Nicoya Peninsula, Costa Rica Neil Lundberg https://doi.org/10.1144/GSL.SP.1982.010.01.9 South America Cenozoic structure, stratigraphy and tectonics of the central Peru forearc L. D. Kulm, T. M. Thornburg, and H.-J. Schrader J. M. Resig https://doi.org/10.1144/GSL.SP.1982.010.01.10 Forearc and other basins, continental margin of northern and southern Peru and adjacent Ecuador and Chile R. Moberly, G. L. Shepherd, and W. T. Coulbourn https://doi.org/10.1144/GSL.SP.1982.010.01.11 The geology of the western part of the Borbón Basin, North-west Ecuador C. D. R. Evans and J. E. Whittaker https://doi.org/10.1144/GSL.SP.1982.010.01.12 Aleutians Ancient plate boundaries in the Bering Sea region M. S. Marlow, A. K. Cooper, D. W. Scholl, and H. McLean https://doi.org/10.1144/GSL.SP.1982.010.01.13 The Chugach Terrane, a Cretaceous trench-fill deposit, southern Alaska Tor H. Nilsen and Gian G. Zuffa https://doi.org/10.1144/GSL.SP.1982.010.01.14 Structural evolution of coherent terranes in the Ghost Rocks Formation, Kodiak Island, Alaska Tim Byrne https://doi.org/10.1144/GSL.SP.1982.010.01.15 Asia and Australasia Sedimentation in the Sunda Trench and forearc region Gregory F. Moore, Joseph R. Curray, and Frans J. Emmel https://doi.org/10.1144/GSL.SP.1982.010.01.16 Development of the North Island Subduction System, New Zealand Gerrit J. van der Lingen https://doi.org/10.1144/GSL.SP.1982.010.01.17 Atlantic The Barbados Ridge Complex: tectonics of a mature forearc system G. K. Westbrook https://doi.org/10.1144/GSL.SP.1982.010.01.18 Sedimentology and structure of the Scotland Group, Barbados C. J. Pudsey and H. G. Reading https://doi.org/10.1144/GSL.SP.1982.010.01.19 Subduction and tectonics on the continental margin off northern Spain: observations with the submersible Cyana Jacques-André Malod, Gilbert Boillot, Claude Lepvier, Georges Mascle, and Josette Taugourdeau-Lantz Raymond Capdevila, Pierre-Alain Dupeuble, and Carla Müller https://doi.org/10.1144/GSL.SP.1982.010.01.20 Mediterranean Subduction in the Hellenic Trench: probable role of a thick evaporitic layer based on Seabeam and submersible studies X. Le Pichon, P. Huchon, J. Angelier, N. Lybéris, J. Boulin, and D. Bureau J.P. Cadet, J. Dercourt, G. Glaçon, H. Got, D. Karig, J. Mascle, L.E. Ricou, and F. Thiebault https://doi.org/10.1144/GSL.SP.1982.010.01.21 Detailed tectonic trends on the central part of the Hellenic Outer Ridge and in the Hellenic Trench System N. H. Kenyon, R. H. Belderson, and A. H. Stride https://doi.org/10.1144/GSL.SP.1982.010.01.22 The structure of the Calabro-Sicilian Arc: result of a post-orogenic intra-plate deformation Forese Carlo Wezel https://doi.org/10.1144/GSL.SP.1982.010.01.23 Makran of Iran and Pakistan Deformation of the Makran accretionary sediment prism in the Gulf of Oman (north-west Indian Ocean) Robert S. White https://doi.org/10.1144/GSL.SP.1982.010.01.24 The Late Cretaceous-Cenozoic history of western Baluchistan Pakistan—the northern margin of the Makran subduction complex Russell S. Arthurton, Abul Farah, and Wahiduddin Ahmed https://doi.org/10.1144/GSL.SP.1982.010.01.25 The Makran, Southeastern Iran: the anatomy of a convergent plate margin active from Cretaceous to Present G. J. H. McCall and R. G. W. Kidd https://doi.org/10.1144/GSL.SP.1982.010.01.26 California The Coastal Belt of the Franciscan: youngest phase of northern California subduction Steven B. Bachman https://doi.org/10.1144/GSL.SP.1982.010.01.27 The Franciscan Complex of northernmost California: sedimentation and tectonics K. R. Aalto https://doi.org/10.1144/GSL.SP.1982.010.01.28 Sedimentation, metamorphism and tectonic accretion of the Franciscan assemblage of northern California M. C. Blake, Jr, A. S. Jayko, and D. G. Howell https://doi.org/10.1144/GSL.SP.1982.010.01.29 Deformation of partly dewatered and consolidated Franciscan sediments near Piedras Blancas Point, California Darrel S. Cowan https://doi.org/10.1144/GSL.SP.1982.010.01.30 Initiation and evolution of the Great Valley forearc basin of northern and central California, U.S.A. Raymond V. Ingersoll https://doi.org/10.1144/GSL.SP.1982.010.01.31 Forearc Terranes in Orogenic Belts Cretaceous-Palaeogene Flysch Zone of the East Alps and Carpathians: identification and plate-tectonic significance of ‘dormant’ and ‘active’ deep-sea trenches in the Alpine-Carpathian Arc Reinhard Hesse https://doi.org/10.1144/GSL.SP.1982.010.01.32 The anatomy of a Lower Palaeozoic accretionary forearc: the Southern Uplands of Scotland J. K. Leggett W. S. McKerrow and D. M. Casey https://doi.org/10.1144/GSL.SP.1982.010.01.33 Sedimentology, volcanism, structure and metamorphism of the northern margin of a Lower Palaeozoic accretionary complex; Bail Hill-Abington area of the Southern Uplands of Scotland Barry C. Hepworth, Grahame J. H. Oliver, and Michael J. McMurtry https://doi.org/10.1144/GSL.SP.1982.010.01.34 Facies, Petrology and Models Sedimentary facies associations within subduction complexes Michael B. Underwood and Steven B. Bachman https://doi.org/10.1144/GSL.SP.1982.010.01.35 Composition of modern deep-sea sands from arc-related basins J. Barry Maynard, Renzo Valloni, and Ho-Shing Yu https://doi.org/10.1144/GSL.SP.1982.010.01.36 Initiation of subduction zones: implications for arc evolution and ophiolite development D. E. Karig https://doi.org/10.1144/GSL.SP.1982.010.01.37

Note: Contents Preface Editor Contributors Chapter 1 Sampling and Sample Treatments / Oliver Wurl Chapter 2 Analysis of Dissolved and Particulate Organic Carbon with the HTCO Technique / Oliver Wurl and Tsai Min Sin Chapter 3 Spectrophotometric and Chromatographic Analysis of Carbohydrates in Marine Samples / Christos Panagiotopoulos and Oliver Wurl Chapter 4 The Analysis of Amino Acids in Seawater / Thorsten Dittmar, Jennifer Cherrier, and Kai-Uwe Ludwichowski Chapter 5 Optical Analysis of Chromophoric Dissolved Organic Matter / Norman B. Nelson and Paula G. Coble Chapter 6 Isotope Composition of Organic Matter in Seawater / Laodong Guo and Ming-Yi Sun Chapter 7 Determination of Marine Gel Particles / Anja Engel Chapter 8 Nutrients in Seawater Using Segmented Flow Analysis / Alain Aminot, Roger Kérouel, and Stephen C. Coverly Chapter 9 Dissolved Organic and Particulate Nitrogen and Phosphorous / Gerhard Kattner Chapter 10 Pigment Applications in Aquatic Systems / Karen Helen Wiltshire Chapter 11 Determination of DMS, DMSP, and DMSO in Seawater / Jacqueline Stefels Chapter 12 Determination of Iron in Seawater / Andrew R. Bowie and Maeve C. Lohan Chapter 13 Radionuclide Analysis in Seawater / Mark Baskaran, Gi-Hoon Hong, and Peter H. Santschi Chapter 14 Sampling and Measurements of Trace Metals in Seawater / Sylvia G. Sander, Keith Hunter, and Russell Frew Chapter 15 Trace Analysis of Selected Persistent Organic Pollutants in Seawater / Oliver Wurl Chapter 16 Pharmaceutical Compounds in Estuarine and Coastal Waters / John L. Zhou and Zulin Zhang Appendix A: First Aid for Common Problems with Typical Analytical Instruments Appendix B: Chemical Compatibilities and Physical Properties of Various Materials Appendix C: Water Purification Technologies

Note: section A. Language, ideology and powersection B. Discourse and sociocultural change -- section C. Dialectics of discourse: theoretical developments -- section D. Methodology in CDA research -- section E. Political discourse -- F. Globalisation and 'transition' -- section G. Language and education..

Note: Machine generated contents note: Introduction Jan Aart Scholte; 1. Global governance, accountability and civil society Jan Aart Scholte; 2. Civil society and accountability of the United Nations Kerstin Martens; 3. The World Bank and democratic accountability: the role of civil society Alnoor Ebrahim and Steven Herz; 4. Civil society and IMF accountability Jan Aart Scholte; 5. Civil society and the WTO: contesting accountability Marc Williams; 6. Civil society and accountability in the Commonwealth Timothy M. Shaw and Pamela K. Mbabazi; 7. The organisation of the Islamic conference, accountability and civil society Saied Reza Ameli; 8. Civil society and patterns of accountability in the OECD Morten Ougaard; 9. Civil society and G8 accountability Peter I. Hajnal; 10. Structuring accountability: the Asia-Europe meeting Julie Gilson; 11. Civil society and accountability in global governance of climate change Peter Newell; 12. Civil society and accountability promotion in the global fund Carolyn Long and Nata Duvvury; 13. Accountability in private global governance: ICANN and civil society Mawaki Chango; 14. Civil society and the World Fair Trade Organisation: developing responsive accountability Heidi Ullrich; Conclusion Jan Aart Scholte..

Note: Cover; Copyright; Praise; Introduction; Contents; Section 1: THINK IT; The First Thing to Do When You Find Yourself in a Hole: Stop Digging; Stay Positive; Never Lose Faith; Seven Career Lessons I Learned from Selling Ginsu Knives; A Turning Point; Stop. Breathe. Think. Then Act.; Overcoming Inertia; Overcoming Fear; Keep Swimming; Section 2: DO IT; What Is a Resume?; What Are Managers Looking For?; Dirty Little Resume Secrets; The T-Bomb; Current Experience; What You Do Is More Important than What You're Called; The Top Ten Mistakes Professionals Make When Looking for Work. , Resumes: A SummaryCover Your Letter; Following Up; Getting Interviews; Be Proactive; Be Visible; Social Networking; Four Critical Steps to Getting a Job Offer; Send Out Ships; Gold Calling; Section 3: HAVE IT; Creating the Path; Recession-Proof Your Career; Creating a PR Campaign; Taking the Initiative; Increase Your Ability to Find Work; Advancing Your Career through Personal Branding; Advancing Your Career through Progressive Information Disclosure; Honing Your Workplace Negotiation Skills; The Sky's the Limit; What Are You Waiting For?; About Making Money; Creating the Life You Want. , Recommended ReadingAbout the Author.

Note: Cover; Half title; Title; Copyright; Contents; Contributors; Preface; 1 Introduction; 2 Intraplate earthquakes in Australia; 2.1 Introduction; 2.2 Two centuries of earthquake observations in Australia; 2.2.1 Mechanism, geographic distribution, and strain rate; 2.2.2 Seismogenic depth; 2.2.3 Attenuation and scaling relations; 2.3 A long-term landscape record of large (morphogenic) earthquakes; 2.3.1 Variation in fault scarp length and vertical displacement; 2.3.2 The influence of crustal type and character on seismic activity rates; 2.4 Patterns in earthquake occurrence. , 2.5 Maximum magnitude earthquake2.5.1 Scarp length as a proxy for paleo-earthquake magnitude; 2.6 Implications for SCR analogue studies: factors important in earthquake localisation; 2.6.1 Mechanical and thermal influences; 2.6.2 Structural architectural influences; 2.7 Conclusions; Acknowledgements; 3 Intraplate seismicity in Brazil; 3.1 Introduction; 3.2 Earthquake catalogue; 3.3 Seismicity map; 3.4 Seismotectonic correlations; 3.4.1 Lower seismicity in Precambrian cratonic provinces; 3.4.2 Intraplate seismicity and cratonic roots; 3.4.3 Passive margin seismicity. , 3.4.4 Influence of neotectonic faults3.4.5 Flexural stresses; 3.5 Discussion and conclusions; Acknowledgments; 4 Earthquakes and geological structures of the St. Lawrence Rift System; 4.1 Introduction; 4.2 Historical earthquakes and their impact; 4.3 Seismic zones of the SLRS; 4.3.1 Charlevoix; 4.3.2 Lower St. Lawrence; 4.3.3 Western Quebec; 4.3.4 Background seismicity; 4.4 The St. Lawrence Rift System; 4.5 The rift hypothesis and the SLRS: discussion and conclusions; Acknowledgments; 5 Intraplate earthquakes in North China; 5.1 Introduction; 5.2 Tectonic background; 5.2.1 Geological history. , 5.2.2 Lithospheric structure5.2.3 Major seismogenic faults; 5.3 Active tectonics and crustal kinematics; 5.4 Strain rates and seismicity; 5.5 Seismicity; 5.5.1 Paleoseismicity; 5.5.2 Large historic events; 1303 Hongdong earthquake (M 8.0); 1556 Huaxian earthquake (M 8.3); 1668 Tancheng earthquake (M 8.5); 1679 Sanhe earthquake (M 8.0); 1695 Linfen earthquake (M 7.5-8.0); 5.5.3 Large instrumentally recorded earthquake; The 1966 Xingtai earthquake (Ms 7.2); The 1975 Haicheng earthquake (Ms 7.3); The 1976 Tangshan earthquake (Ms 7.8); 5.6 Spatiotemporal patterns of large earthquakes. , 5.6.1 Long-distance roaming of large earthquakes5.6.2 Fault coupling and interaction; 5.6.3 A conceptual model for mid-continental earthquakes; 5.7 Implications for earthquake hazards; Acknowledgements; 6 Seismogenesis of earthquakes occurring in the ancient rift basin of Kachchh, Western India; 6.1 Introduction; 6.2 Tectonic framework, structure, and tectonic evolution of Kachchh Rift basin; 6.2.1 Structure and tectonics; 6.2.2 Tectono-volcanic events; 6.2.3 Tectonic evolution and existing earthquake generation models of the Kachchh Rift zone. , 6.2.4 Identification of magmatic intrusive bodies.

Note: Ecotones Between Forest and Grassland; Preface; Contents; Contributors; Chapter 1: Introduction; 1.1 Rationale; 1.2 Case Study: The Cross Timbers; 1.3 About This Book; References; Part I: Temperate Forest-Grassland Ecotones: Prairies, Steppes, and Pampas; Chapter 2: Woodland-Grassland Ecotonal Shifts in Environmental Mosaics: Lessons Learnt from the Environmental History of the Carpathian Basin (Central Europe) During the Holocene and the Last Ice Age Based on Investigation of Paleobotanical and Mollusk Remains; 2.1 Introduction. , 2.2 Modern Woodland-Grassland Ecotone in the Carpathian Basin and Controversies Around Definitions2.3 Profiles Selected and Methods Applied in Modeling Woodland-Grassland Ecotone Shifts in the Carpathian Basin; 2.3.1 The Climate-Zonal Hypothesis Put to the Test; 2.3.2 Testing the Model of Edaphic Ecological Factors; 2.3.3 Testing the Idea of Human-Induced Ecotone Development; 2.4 The Vegetation History of the Great Hungarian Plains as Inferred from the Evaluation of Quaternary Paleoecological and Environmental Historical Data; 2.4.1 Vegetation Development During Last Ice Age. , 2.4.2 Vegetation Development During the Terminal Part of the Last Ice Age2.4.3 Vegetation Development During the Pleistocene/Holocene Transition; 2.4.4 Vegetation History of the Carpathian Basin from the Settlement of the First Farmers; 2.5 Summary; References; Chapter 3: Ecotones as Complex Arenas of Disturbance, Climate, and Human Impacts: The Trans-Andean Forest-Steppe Ecotone of Northern Patagonia; 3.1 Introduction; 3.2 Physical and Biological Setting of Forest-Steppe Ecotone of Northern Patagonia; 3.2.1 Abiotic Transition; 3.2.2 Ecosystem Properties Across the Transition. , 3.2.3 Plant Communities and Plant Diversity Across the Transition3.3 Disturbance Variation and Forest Dynamics Across the Transition; 3.3.1 Fine-Scale Disturbances; 3.3.2 Coarse-Scale Disturbances; 3.4 Direct and Disturbances-Mediated In fl uences of Climate Variability Across the Transition; 3.5 Climate, Fire, Land Use, and Long-Term Vegetation Changes Across the Transition; 3.5.1 Xeric Steppe-Woodland Belt; 3.5.2 The Nothofagus Forest-Shrubland Belt; 3.5.3 The Wet Rainforest Belt; 3.6 Conclusions; References; Chapter 4: Woody-Herbaceous-Livestock Species Interaction; 4.1 Introduction. , 4.2 Woody-Herbaceous Species Interactions and Associated Models4.3 Woodland and Grassland Stable States and Conceptual Models; 4.4 Woody-Herbaceous Ecotones; 4.5 Rates and Patterns of Woody-Herbaceous Ecotone Shift; 4.6 Woody-Herbaceous-Livestock Species Dynamics; 4.7 Other Potential Factors In fl uencing Woody-Herbaceous Species Dynamics; 4.8 Current and Future Research on Woody-Herbaceous-Livestock Species Interaction; References; Chapter 5: Woody Plant Invasions in Pampa Grasslands: A Biogeographical and Community Assembly Perspective; 5.1 Introduction. , 5.2 Woody Invasions as Hierarchical Assembly Processes.

Note: Inhalt; Über dieses Buch; Teil I Einführungen: Theorien der Erzählungen; Erzählen. Die ethisch-politische Funktion narrativer Diskurse; 1 Narrative Diskurse: Eigenschaften und Funktionen; 1.1 Die narrative Kunst der Begründung; 1.2 Ein semantisches Modell der Erzählung: Algirdas J. Greimas' Aktantentheorie; 1.3 Narrative Begründungen: Eine semantische Typologie; 1.4 Die Schuld und die Vergebung: Zum Verantwortungsmanagement narrativer Diskurse; 1.5 In medias res: Warum Erzählungen oft mit dem Ende beginnen; 1.6 Die doppelte Referenz: Das Allgemeine und das Einzigartige. , 2 Die Erzähler und ihr Publikum: Zur Öffentlichkeit narrativer Diskurse2.1 Öffentliche Urteile: Die Erzähler und ihr Publikum; 2.2 Die zwei Stimmen des Erzählers; 2.3 Die Präsenz des Erzählers in der Erzählung; 2.4 Die Öffentlichkeiten des Erzählers; 2.5 Autobiografisches Erzählen: Der innere Dialog und das Denken; 2.6 Ausblick: Die Öffentlichkeitsregime narrativer Diskurse; Literatur; »Menschen lesbarer machen«1: Narration, Diskurs,Referenz; 1 Narrationen als sozialwissenschaftliches Konzept; 1.1 Erzählungen zwischen Text und Handlung; 1.2 Typen der Erzählung. , 1.3 Zur lebensweltlichen Einbettung von Narrativen2 Zum Verhältnis von Narration und Diskurs; 2.1 Brauchen Diskurse Erzählungen?; 2.2 Narrationen als Sprech-Handlungen (über Satzniveau); 3 Erzählungen: Strukturen, Ereignisse und dieKomposition der Fabel; 3.1 Narration und Fabelkomposition; 3.2 Ebenen der Erzählung; 3.3 Kollektiv-Symbole und ihre Erzählungen; 3.4 Narrative und ihre Bedeutung für die kulturelle Reproduktion und Innovation; 4 Referenz und Erzählung: Jenseits der Innenwelt von Texten; 4.1 Öffentliche Erzählungen als Mimesis von Handlungen?. , 5 ConclusioLiteratur; Öffentliche Erzählungen und der globale Wandel des Klimas; 1 Einleitung; 2 Der Mensch als Klimageschichtenerzähler; 2.1 Was heißt Narrativisierung des Klimas?; 2.2 Narrationen als Geburtshelfer möglicher Welten; 2.3 Klimageschichten sind lebende Geschichten; 3 Globaler Klimawandel: Geburt eines Konzepts; 4 Sechs Varianten der Narrativisierung des globalenKlimawandels; 4.1 Das »globale Treibhaus« als anthropogene Katastrophe; 4.2 Anthropogene Eiszeiten: die Katastrophe des; 4.3 Die Geschichte vom »nuklearen Winter«; 4.4 »Paradiesische Warmzeiten«. , 4.5 Die ewige Wiederkehr der »Sonnenflecken«: Normalität statt Katastrophe. , 4.2 Die Konfiguration von Charakteren in öffentlichen Erzählungen4.3 Re-figuration und die Rolle des Lesers; Teil II Erzählungen in den Medien; Kollektivsymbolik und die deutsche Krise seit dem Jahr 2000; Heimat, Natur und die gute alte Zeit. Erzählungenüber Nachhaltige Entwicklung im Spannungsfeldöffentlicher und wissenschaftlicher Diskurse1; 1 Einleitung; 2 Wissenschaftliche Diskurse über Nachhaltige Entwicklung; 3 Nachhaltige Ernährung und Ernährungskommunikation; 4 Erzählungen über Ernährung in den Medien; 4.1 Polarisierende Rhetorik; 4.2 Affirmative Rhetorik; 4.3 Reflektierende Rhetorik.

Note: Nonlinear Mesoscopic Elasticity; Contents; Preface; Acknowledgements; 1 Introduction; 1.1 Systems; 1.2 Examples of Phenomena; 1.3 The Domain of Exploration; 1.4 Outline; References; 2 Microscopic/Macroscopic Formulation of the Traditional Theory of Linear and Nonlinear Elasticity; 2.1 Prefatory Remarks; 2.2 From Microscopic to Continuum; 2.2.1 A Microscopic Description; 2.2.2 Microscopic Description and Thermodynamics; 2.2.3 From Microscopic Model to Continuum Elasticity; 2.3 Continuum Elasticity and Macroscopic Phenomenology; 2.3.1 Displacement, Strain, and Stress. , 2.3.2 Dynamics of the Displacement Field2.3.3 Coupling Continuum Elasticity to Auxiliary Fields; 2.3.4 Inhomogeneous Elastic Systems; 2.4 Thermodynamics; 2.4.1 Thermodynamic Derivatives; 2.4.2 Series Expansion for ES; 2.4.3 Series Expansion for EZ; 2.4.4 Series Expansion for FT; 2.4.5 Assemble the Pieces; 2.5 Energy Scales; References; 3 Traditional Theory of Nonlinear Elasticity, Results; 3.1 Quasistatic Response; Linear and Nonlinear; 3.1.1 Quasistatic Response; Linear; 3.1.2 Quasistatic Response; Nonlinear; 3.2 Dynamic Response; Linear; 3.3 Quasistatic/Dynamic Response; Nonlinear. , 3.4 Dynamic Response Nonlinear; 3.4.1 Basic Equations; 3.4.2 Wave Propagation; 3.4.3 Resonant Bar; 3.5 Exotic Response; Nonlinear; 3.6 Green Functions; 3.6.1 Green Function, Free Space; 3.6.2 Green Function, Resonant Bar; References; 4 Mesoscopic Elastic Elements and Macroscopic Equations of State; 4.1 Background; 4.2 Elastic Elements; 4.2.1 Hertz-Mindlin Contacts; 4.2.2 Hysteretic Hertzian Contacts; 4.2.3 Hertzian Asperities; 4.2.4 Van der Waals Surfaces; 4.2.5 Other; 4.3 Effective Medium Theory; 4.4 Equations of State; Examples; 4.4.1 Hertzian Contacts; 4.4.2 Van der Waals Surfaces. , 4.4.3 Generalization and CaveatsReferences; 5 Auxiliary Fields; 5.1 Temperature; 5.2 Saturation; 5.2.1 Saturation/Strain Coupling; 5.2.2 Saturation/Strain Response; 5.3 The Conditioning Field, X; References; 6 Hysteretic Elastic Elements; 6.1 Finite Displacement Elastic Elements; Quasistatic Response; 6.1.1 Finite Displacement Elastic Elements: The Model; 6.1.2 Finite Displacement Elastic Element: Implementing the Model; 6.2 Finite Displacement Elastic Elements: Inversion; 6.3 Finite Displacement Elastic Elements: Dynamic Response; 6.3.1 Finite Displacement Elastic Element: Resonant Bar. , 6.3.2 Finite Displacement Elastic Element: Wave Mixing6.4 Models with Hysteresis; 6.5 Summary; 6.6 Models with Hysteresis, Detail; 6.6.1 Hertzian Contacts; 6.6.2 The Masing Rules; 6.6.3 The Endochronic Formalism; References; 7 The Dynamics of Elastic Systems; Fast and Slow; 7.1 Fast/Slow Linear Dynamics; 7.1.1 Quasistatic Response; 7.1.2 AC Response; 7.2 Fast Nonlinear Dynamics; 7.3 Auxiliary Fields and Slow Dynamics; 7.3.1 X = The Conditioning Field; 7.3.2 X = Temperature; 7.4 Summary; References; 8 Q and Issues of Data Modeling/Analysis; 8.1 Attenuation in Linear Elastic Systems. , 8.1.1 Wave Vector Dispersion.

Note: ""Preface""; ""Acknowledgments""; ""Contents""; ""Chapter 1 Structure and Composition of the Lower and Middle Atmosphere""; ""Chapter 2 Radiative Processes in the Lower and Middle Atmosphere""; ""Chapter 3 Dynamics of the Troposphere and Stratosphere""; ""Chapter 4 Waves in the Troposphere and Stratosphere""; ""Chapter 5 Chemical Processes in the Stratosphere and Troposphere""; ""Chapter 6 Stratospheric Ozone Depletion and Antarctic Ozone Hole""; ""Chapter 7 Transport Processes in the Stratosphere and Troposphere""; ""Chapter 8 Stratosphere�Troposphere Exchange"". , ""Chapter 9 Stratospheric Influence on Tropospheric Weather and Climate""""Acronyms""; ""List of Symbols""; ""Table of Physical Constants""; ""Answers to Selected Problems""; ""Index"".

Note: German

Note: German

Note: Front Cover; Contents; Preface; 1. What's Vis, and Why Do It?; 2. What: Data Abstraction; 3. Why: Task Abstraction; 4. Analysis: Four Levels for Validation; 5. Marks and Channels; 6. Rules of Thumb; 7. Arrange Tables; 8. Arrange Spatial Data; 9. Arrange Networks and Trees; 10. Map Color and Other Channels; 11. Manipulate View; 12. Facet into Multiple Views; 13. Reduce Items and Attributes; 14. Embed: Focus+Context; 15. Analysis Case Studies; Figure Credits; Bibliography.

Note: Zugl.: Regensburg, Univ., Diss., 2007

Note: Dissertation

Note: Table of Contents Introduction: Thermokarst Lakes of Western Siberia as Dominant Forms of Landscape and Regulators of Greenhouse Gas Exchange with the Atmosphere Chapter 1. Thermokarst Lakes: Distribution, Cycle of Development, Surface Coverage and Evolution Chapter 2. Sources of Dissolved Components in Thermokarst Lakes Chapter 3. Temperature and Gas Regime Chapter 4. Dissolved Organic Carbon Chapter 5. Microbiology of Thermokarst Lake Systems Chapter 6. Trace Elements in Thermokarst Lakes Chapter 7. Colloids in Thermokarst Lakes Chapter 8. Latitude Profile Gradients of Lakes: Substituting Space for Time Chapter 9. Possible Impact of Climate Warming on Stocks and Fluxes of Carbon and Related Elements in Western Siberian Lakes Conclusions: Thaw Lakes as Indicators of Climate Change References Index

Note: Contents Recent research developments / Geological Society, London, Special Publications, 17:xi-xii, doi:10.1144/GSL.SP.1984.017.01.01 --- A. H. F. Robertson and J. E. Dixon: Introduction: aspects of the geological evolution of the Eastern Mediterranean / Geological Society, London, Special Publications, 17:1-74, doi:10.1144/GSL.SP.1984.017.01.02 --- 1. Palaeotethys --- Editor’s introduction / Geological Society, London, Special Publications, 17:75-76, doi:10.1144/GSL.SP.1984.017.01.03 --- A. M. C. Şengör, Y. Yılmaz, and O. Sungurlu: Tectonics of the Mediterranean Cimmerides: nature and evolution of the western termination of Palaeo-Tethys / Geological Society, London, Special Publications, 17:77-112, doi:10.1144/GSL.SP.1984.017.01.04 --- Olivier Monod and Ergün Akay: Evidence for a Late Triassic-Early Jurassic orogenic event in the Taurides / Geological Society, London, Special Publications, 17:113-122, doi:10.1144/GSL.SP.1984.017.01.05 --- I. E. Kerey: Facies and tectonic setting of the Upper Carboniferous rocks of Northwestern Turkey / Geological Society, London, Special Publications, 17:123-128, doi:10.1144/GSL.SP.1984.017.01.06 --- E. Demirtaşh: Stratigraphic evidence of Variscan and early Alpine tectonics in Southern Turkey / Geological Society, London, Special Publications, 17:129-145, doi:10.1144/GSL.SP.1984.017.01.07 --- 2. Neoththys --- Levant and North African offshore: Editor’s introduction / Geological Society, London, Special Publications, 17:147-149, doi:10.1144/GSL.SP.1984.017.01.08 --- M. Delaune-Mayere: Evolution of a Mesozoic passive continental margin: Baër-Bassit (NW Syria) / Geological Society, London, Special Publications, 17:151-159, doi:10.1144/GSL.SP.1984.017.01.09 --- G. Sestini: Tectonic and sedimentary history of the NE African margin (Egypt—Libya) / Geological Society, London, Special Publications, 17:161-175, doi:10.1144/GSL.SP.1984.017.01.10 --- Gdaliahu Gvirtzman and Tuvia Weissbrod: The Hercynian Geanticline of Helez and the Late Palaeozoic history of the Levant / Geological Society, London, Special Publications, 17:177-186, doi:10.1144/GSL.SP.1984.017.01.11 --- Z. Garfunkel and B. Derin: Permian-early Mesozoic tectonism and continental margin formation in Israel and its implications for the history of the Eastern Mediterranean / Geological Society, London, Special Publications, 17:187-201, doi:10.1144/GSL.SP.1984.017.01.12 --- Yehezkeel Druckman: Evidence for Early-Middle Triassic faulting and possible rifting from the Helez Deep Borehole in the coastal plain of Israel / Geological Society, London, Special Publications, 17:203-212, doi:10.1144/GSL.SP.1984.017.01.13 --- Abdulkader M. Abed: Emergence of Wadi Mujib (Central Jordan) during Lower Cenomanian time and its regional tectonic implications / Geological Society, London, Special Publications, 17:213-216, doi:10.1144/GSL.SP.1984.017.01.14 --- F. Hirsch: The Arabian sub-plate during the Mesozoic / Geological Society, London, Special Publications, 17:217-223, doi:10.1144/GSL.SP.1984.017.01.15 --- Michel Delaloye and Jean-Jacques Wagner: Ophiolites and volcanic activity near the western edge of the Arabian plate / Geological Society, London, Special Publications, 17:225-233, doi:10.1144/GSL.SP.1984.017.01.16 --- 3. Neotethys: Turkey --- Editor’s introduction / Geological Society, London, Special Publications, 17:235-240, doi:10.1144/GSL.SP.1984.017.01.17 --- A. Poisson: The extension of the Ionian trough into southwestern Turkey / Geological Society, London, Special Publications, 17:241-249, doi:10.1144/GSL.SP.1984.017.01.18 --- A. H. F. Robertson and N. H. Woodcock: The SW segment of the Antalya Complex, Turkey as a Mesozoic-Tertiary Tethyan continental margin / Geological Society, London, Special Publications, 17:251-271, doi:10.1144/GSL.SP.1984.017.01.19 --- J. W. F. Waldron: Structural history of the Antalya Complex in the ‘Isparta angle’, Southwest Turkey / Geological Society, London, Special Publications, 17:273-286, doi:10.1144/GSL.SP.1984.017.01.20 --- A. B. Hayward: Miocene clastic sedimentation related to the emplacement of the Lycian Nappes and the Antalya Complex, S.W. Turkey / Geological Society, London, Special Publications, 17:287-300, doi:10.1144/GSL.SP.1984.017.01.21 --- Hubert Whitechurch, Thierry Juteau, and Raymond Montigny: Role of the Eastern Mediterranean ophiolites (Turkey, Syria, Cyprus) in the history of the Neo-Tethys / Geological Society, London, Special Publications, 17:301-317, doi:10.1144/GSL.SP.1984.017.01.22 --- Ingrid Reuber: Mylonitic ductile shear zones within tectonites and cumulates as evidence for an oceanic transform fault in the Antalya ophiolite, S.W. Turkey / Geological Society, London, Special Publications, 17:319-334, doi:10.1144/GSL.SP.1984.017.01.23 --- Pınar O. Yılmaz: Fossil and K-Ar data for the age of the Antalya complex, S W Turkey / Geological Society, London, Special Publications, 17:335-347, doi:10.1144/GSL.SP.1984.017.01.24 --- L. E. Ricou, J. Marcoux, and H. Whitechurch: The Mesozoic organization of the Taurides: one or several ocean basins? / Geological Society, London, Special Publications, 17:349-359, doi:10.1144/GSL.SP.1984.017.01.25 --- A. Michard, H. Whitechurch, L. E. Ricou, R. Montigny, and E. Yazgan: Tauric subduction (Malatya-Elazıǧ provinces) and its bearing on tectonics of the Tethyan realm in Turkey / Geological Society, London, Special Publications, 17:361-373, doi:10.1144/GSL.SP.1984.017.01.26 --- G. Aktaş and A. H. F. Robertson: The Maden Complex, SE Turkey: evolution of a Neotethyan active margin / Geological Society, London, Special Publications, 17:375-402, doi:10.1144/GSL.SP.1984.017.01.27 --- Cahit Helvaci and William L. Griffin: Rb-Sr geochronology of the Bitlis Massif, Avnik (Bingöl) area, S.E. Turkey / Geological Society, London, Special Publications, 17:403-413, doi:10.1144/GSL.SP.1984.017.01.28 --- Ömer T. Akıncı: The Eastern Pontide volcano-sedimentary belt and associated massive sulphide deposits / Geological Society, London, Special Publications, 17:415-428, doi:10.1144/GSL.SP.1984.017.01.29 --- A. I. Okay and N. Özgül: HP/LT metamorphism and the structure of the Alanya Massif, Southern Turkey: an allochthonous composite tectonic sheet / Geological Society, London, Special Publications, 17:429-439, doi:10.1144/GSL.SP.1984.017.01.30 --- Teoman N. Norman: The role of the Ankara Melange in the development of Anatolia (Turkey) / Geological Society, London, Special Publications, 17:441-447, doi:10.1144/GSL.SP.1984.017.01.31 --- Ayla Tankut: Basic and ultrabasic rocks from the Ankara Melange, Turkey / Geological Society, London, Special Publications, 17:449-454, doi:10.1144/GSL.SP.1984.017.01.32 --- A. I. Okay: Distribution and characteristics of the north-west Turkish blueschists / Geological Society, London, Special Publications, 17:455-466, doi:10.1144/GSL.SP.1984.017.01.33 --- N. Görür, F.Y. Oktay, İ. Seymen, and A. M. C. Şengör: Palaeotectonic evolution of the Tuzgölü basin complex, Central Turkey: sedimentary record of a Neo-Tethyan closure / Geological Society, London, Special Publications, 17:467-482, doi:10.1144/GSL.SP.1984.017.01.34 --- J. P. Lauer: Geodynamic evolution of Turkey and Cyprus based on palaeomagnetic data / Geological Society, London, Special Publications, 17:483-491, doi:10.1144/GSL.SP.1984.017.01.35 --- 4. Neotethys: Greece and the Balkans --- Editor’s introduction / Geological Society, London, Special Publications, 17:493-498, doi:10.1144/GSL.SP.1984.017.01.36 --- Robert Hall, M. G. Audley-Charles, and D. J. Carter: The significance of Crete for the evolution of the Eastern Mediterranean / Geological Society, London, Special Publications, 17:499-516, doi:10.1144/GSL.SP.1984.017.01.37 --- Michel Bonneau: Correlation of the Hellenide nappes in the south-east Aegean and their tectonic reconstruction / Geological Society, London, Special Publications, 17:517-527, doi:10.1144/GSL.SP.1984.017.01.38 --- M. Okrusch, P. Richter

Note: Table of Contents Introductory Remarks Displacement within continents Introductory remarks R. M. Shackleton Geological Society, London, Special Publications, 3, 1-7, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.01 Structural Analysis of Orogenic Belts Problems of the relationship between surface structure and deep displacements illustrated by the Zagros Range N. L. Falcon Geological Society, London, Special Publications, 3, 9-21, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.02 Some principles governing interpretation of structure in the Rocky Mountain orogenic belt F. G. Fox Geological Society, London, Special Publications, 3, 23-41, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.03 The measurement of strain and displacement in orogenic belts J. G. Ramsay Geological Society, London, Special Publications, 3, 43-79, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.04 The construction of sections in areas of highly deformed rocks W. E. A. Phillips and J. G. Byrne Geological Society, London, Special Publications, 3, 81-93, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.05 The palaeomagnetic evidence of displacements within continents D. H. Tarling Geological Society, London, Special Publications, 3, 95-113, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.06 Historical Analysis of Orogenic Belts Interpretation of stratigraphical ages in orogenic belts W. B. Harland Geological Society, London, Special Publications, 3, 115-135, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.07 Interpretation of isotopic ages in orogenic belts P. E. Brown and J. A. Miller Geological Society, London, Special Publications, 3, 137-155, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.08 A new approach to radio-isotopic dating in orogenic belts F. J. Fitch, J. A. Miller and J. G. Mitchell Geological Society, London, Special Publications, 3, 157-195, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.09 Other Analyses Orogenic belts and their parts N. Rast Geological Society, London, Special Publications, 3, 197-213, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.10 Sedimentary thicknesses in orogenic belts R. Stoneley Geological Society, London, Special Publications, 3, 215-238, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.11 Rates of change within orogenic belts J. Sutton Geological Society, London, Special Publications, 3, 239-250, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.12 The deep structure of orogenic belts—the root problem E. R. Oxburgh Geological Society, London, Special Publications, 3, 251-273, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.13 Orogeny in relation to crust and upper mantle M. H. P. Bott Geological Society, London, Special Publications, 3, 275-283, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.14 Internal features of some orogenic belts of Africa T. N. Clifford Geological Society, London, Special Publications, 3, 285-287, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.15 Closing Remarks Displacement within continents Kingsley Charles Dunham Geological Society, London, Special Publications, 3, 289-290, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.16 Discussion Geological Society, London, Special Publications, 3, 291-308, 1 January 1969, https://doi.org/10.1144/GSL.SP.1969.003.01.17

Note: Table of Contents Introduction Geological Society, London, Special Publications, 2, 1-11, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.01 The symposium meeting Geological Society, London, Special Publications, 2, 13-14, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.02 Part I: Symposium Papers Introduction to Part I Geological Society, London, Special Publications, 2, 15-16, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.03 Life in Pre-Cambrian and early Cambrian times John Watson Cowie Geological Society, London, Special Publications, 2, 17-35, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.04 The significance of certain trace-fossil ranges Roland Goldring Geological Society, London, Special Publications, 2, 37-39, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.05 Fluctuations in the evolution of Palaeozoic intertebrates Michael Robert House Geological Society, London, Special Publications, 2, 41-54, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.06 The origins of some Silurian enteletacean brachiopods Victor Gordon Walmsley Geological Society, London, Special Publications, 2, 55-56, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.07 Permo-Triassic extinction Frank Harold Trevor Rhodes Geological Society, London, Special Publications, 2, 57-76, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.08 Changes in terrestrial vertebrate faunas during the Mesozoic C. B. Cox Geological Society, London, Special Publications, 2, 77-89, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.09 Some Cretaceous-Tertiary marine faunal changes John Michael Hancock Geological Society, London, Special Publications, 2, 91-104, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.10 Major features of the evolution of echinoids Graeme Maxwell Philip Geological Society, London, Special Publications, 2, 105-106, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.11 Plant-insect relationships in Palaeozoic and later time Norman Francis Hughes and John Smart Geological Society, London, Special Publications, 2, 107-117, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.12 Biochemical evolution and the fossil record Lambert Beverly Halstead Tarlo Geological Society, London, Special Publications, 2, 119-132, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.13 Fossil birds and their adaptive radiation James Fisher Geological Society, London, Special Publications, 2, 133-154, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.14 General Discussion Geological Society, London, Special Publications, 2, 155-156, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.15 Part II: Documentation of the Fossil Record Introduction to Part II Geological Society, London, Special Publications, 2, 158-159, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.16 Plantae Plantae N. F. H. Geological Society, London, Special Publications, 2, 162, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.17 Chapter 1 Thallophyta—1 H. P. Banks, K. I. M. Chesters, N. F. Hughes, G. A. L. Johnson, H. M. Johnson and L. R. Moore Geological Society, London, Special Publications, 2, 163-180, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.18 Chapter 2 Thallophyta—2 M. Black, C. Downie, R. Ross and W. A. S. Sarjeant Geological Society, London, Special Publications, 2, 181-209, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.19 Chapter 3 Bryophyta and Charophyta* L. J. Grambast and W. S. Lacey Geological Society, London, Special Publications, 2, 211-217, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.20 Chapter 4 Pteridophyta—1 H. P. Banks, W. G. Chaloner and W. S. Lacey Geological Society, London, Special Publications, 2, 219-231, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.21 Chapter 5 Pteridophyta—2 H. P. Banks, M. G. Collett, F. R. Gnauck and N. F. Hughes Geological Society, London, Special Publications, 2, 233-245, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.22 Chapter 6 Gymnospermophyta K.L. Alvin, P. D. W. Barnard, T.M. Harris, N. F. Hughes, R. H. Wagner and A. Wesley Geological Society, London, Special Publications, 2, 247-268, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.23 Chapter 7 Angiospermae K. I. M. Chesters, F. R. Gnauck and N. F. Hughes Geological Society, London, Special Publications, 2, 269-288, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.24 Invertebrata Invertebrata M. J. S. R. Geological Society, London, Special Publications, 2, 290, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.25 Chapter 8 Protozoa F. T. Banner, W. J. Clarke, J. L. Cutbill, F. E. Eames, A. J. Lloyd, W. R. Riedel and A. H. Smout Geological Society, London, Special Publications, 2, 291-332, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.26 Chapter 9 Porifera and Archaeocyatha R. M. Finks and D. Hill Geological Society, London, Special Publications, 2, 333-345, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.27 Chapter 10 Coelenterata G. A. L. Johnson, I. D. Sutton, F. M. Taylor and G. Thomas Geological Society, London, Special Publications, 2, 347-378, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.28 Chapter 11 Bryozoa G. P. Larwood, A. W. Medd, D. E. Owen and R. Tavener-Smith Geological Society, London, Special Publications, 2, 379-395, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.29 Chapter 12 Brachiopoda D. V. Ager, P. Copper, G. M. Dunlop, G. F. Elliott, F. A. Middlemiss, A. J. Rowell, A. Williams and A. D. Wright Geological Society, London, Special Publications, 2, 397-421, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.30 Chapter 13 Mollusca: Amphineura, Monoplacophora and Gastropoda D. Curry and N. J. Morris Geological Society, London, Special Publications, 2, 423-430, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.31 Chapter 14 Mollusca: Cephalopoda (Nautiloidea) C.H. Holland Geological Society, London, Special Publications, 2, 431-443, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.32 Chapter 15 Mollusca: Cephalopoda (Ammonoidea) D. T. Donovan, F. Hodson, M. K. Howarth, M. R. House, E. T. Tozer and C. W. Wright Geological Society, London, Special Publications, 2, 445-460, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.33 Chapter 16 Mollusca: Cephalopoda (Coleoidea) D. T. Donovan and J. M. Hancock Geological Society, London, Special Publications, 2, 461-467, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.34 Chapter 17 Mollusca: Scaphopoda and Bivalvia N. J. Morris Geological Society, London, Special Publications, 2, 469-477, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.35 Chapter 18 Arthropoda: Protarthropoda and Trilobitomorpha J. W. Cowie, W. T. Dean, R. Goldring, W. D. I. Rolfe, A. W. A. Rushton, J. T. Temple and R. P. Tripp Geological Society, London, Special Publications, 2, 479-497, 1 January 1967, https://doi.org/10.1144/GSL.SP.1967.002.01.36

Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..

Note: Cover; Title Page; Copyright Page; Table of Contents; List of illustrations; Notes on contributors; Acknowledgements; 1 Socio-ecological transformations and the social sciences; PART I Challenges, contradictions and consequences of global socio-ecological change; 2 Ecological modernization theory: taking stock, moving forward; 3 The emergence of new world-systems perspectives on global environmental change; 4 China's economic growth and environmental protection: approaching a 'win-win' situation? A discussion of ecological modernization theory; 5 Eco-imperialism and environmental justice. , 6 Neoliberalism by design: changing modalities of market-based environmental governance7 Dilemmas for standardizers of sustainable consumption; PART II Climate change, energy and adaptation; 8 Climate, scenario-building and governance: comprehending the temporalities of social-ecological change; 9 From Rio to Copenhagen: multilateral agreements, disagreements and situated actions; 10 Marriage on the rocks: sociology's counsel for our struggling energy-society relationships; 11 Sustainability as social practice: new perspectives on the theory and policies of reducing energy consumption. , 12 Environmental migration: nature, society and population movementPART III Urban environmental change, governance and adaptation; 13 Climate change and urban governance: a new politics?; 14 Recovering the city level in the global environmental struggle: going beyond carbon trading; 15 Hybrid arrangements within the environmental state; 16 The new mobilities paradigm and sustainable transport: finding synergies and creating new methods; PART IV Risk, uncertainty and social learning; 17 Towards a socio-ecological foundation for environmental risk research. , 18 Uncertainty and claims of uncertainty as impediments to risk management19 Transboundary risk governance: co-constructing environmental issues and political solutions; 20 The role of professionals in managing technological hazards: the Montara blowout; 21 Social learning to cope with global environmental change and unsustainability; PART V (Re)assembling social-ecological systems; 22 The social-ecological co-constitution of nature through ecological restoration: experimentally coping with inevitable ignorance and surprise. , 23 Biological invasions as cause and consequence of 'our' changing world: social and environmental paradoxes24 Biological resources, knowledge and property; 25 Disassembling and reassembling socionatural networks: integrated natural resource management in the Great Bear Rainforest; 26 Land use tensions for the development of renewable sources of energy; Index.

Note: Vorwort zur zweiten Auflage; Vorwort; Inhalt; Abkürzungen; Einführung; Teil I; Eine kurze Geschichte der Energiewende; Fukushima und Ausstieg (2011); Fundamente der Energiewende (1980 - 1998); EnWG und EEG (1998 - 2003); Emissionshandel und Energiepreise (2003 - 2008); Netzregulierung und EEG (2004 - 2008); Krise in Europa (2009 - 2012); Teil II; Die Zukunft der Energiewende; Standortbestimmung (2013); 2050: Energiewende; Fossile Primärenergien; Die Regenerativen; Energiesystem der Zukunft; Politik für die Energiewende; 1 Braunkohle und Erdgas; 2 Auslaufbetrieb der Kernenergie ; 3 Energieeffizienz ; 4 Emissionshandel ; 5 EEG Reform ; 6 Regulierung der Stromnetze ; 7 Strommarktgestaltung ; 8 Koordinierung der Energiewende ; Zusammenfassung.

Note: Berlin, Humboldt-Univ., Diss., 2011

Note: Contents: I Grundlegungen und Orientierungen ; 1. Grundlegungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; 2. Orientierungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; II Forschungs- und Handlungsfelder der Nachhaltigkeitswissenschaften und -politik ; 1. Einführung ; 2. Wissenschaft und Forschung ; 3. Wirtschaften und Arbeiten ; 4. Raumentwicklung ; 5. Mobilität ; 6. Klimawandel und -politik ; 7. Ressourcenpolitik und Infrastruktur ; 8. Natur und Landschaft ; 9. Konsum- und Lebensstile ; 10. Zeit(en) ; 11. Governance, Partizipation, Empowerment ; III Fazit - Die Kategorie Geschlecht: Neue Perspektiven für die Nachhaltigkeitswissenschaften

Note: IntroductionTheorising Norms -- Theorising Crime -- Agent-based Modelling -- The Environment and Social Norms -- Punishment and Social Norms -- Imitation and Social Norms -- Socially Situated Social Norms -- Internalisation and Social Norms -- Modelling Norms -- Delinquent Networks -- Social Construction of Knowledge -- Morality -- We-Intentionality -- Conclusion -- Index..

Note: Contents 1 High elevation treelines 1.1 The task 1.2 Previous works 2 Definitions and conventions 2.1 The life form ‘tree’ 2.2 Lines and transitions 2.3 Limitation, stress and disturbance 2.4 Altitude-related and other environmental drivers 2.5 Treeline nomenclature 3 Treeline patterns 3.1 Treeline taxa 3.2 The summit syndrome and other treeline depressions 3.3 Mass elevation effect 3.4 Treeline elevation 3.5 Time matters 3.6 Forest structure near treeline 4 Treeline climate 4.1 Specific aspects of treeline climatology 4.2 Criteria to define temperature regimes at treeline 4.3 Treeline temperatures in different bioclimatic regions 4.3.1 Subarctic and boreal zone (45–68° N) 4.3.2 Cool temperate zone (45–47° N, 44° S) 4.3.3 Warm temperate zone (28–42° N, 36° S) 4.3.4 Subtropical zone (19° S, 19° N) 4.3.5 Equatorial tropics (6° N to 3° S) 4.3.6 Mediterranean ‘treelines’ (38–42° N) 4.3.7 The Nothofagus and Metrosideros case 4.3.8 Treeline temperatures across bioclimatic zones 4.4 Seedbed and branch temperatures 4.5 Whole forest temperatures 5 Global mountain statistics based on treeline elevation 5.1 Mountain geostatistics 5.2 Elevational belts 5.3 Global treeline ecotones 6 Structure and stature of treeline trees 6.1 Foliage properties 6.2 Wood properties 6.3 Bark properties 6.4 Root traits 6.5 Tree stature 6.6 Dry matter allocation in treeline trees 7 Growth and development 7.1 Tree growth near the treeline 7.1.1 In situ growth of seedlings 7.1.2 In situ growth of saplings and adult trees 7.2 Xylogenesis at the treeline 7.2.1 In situ cambial activity 7.2.2 Apical growth dynamics 7.3 Root growth 7.4 Phenology at the treeline 8 Evolutionary adjustments to life at the treeline 8.1 Phylogenetic selection 8.2 Genotypic responses of growth and development 8.3 Genotypic responses of physiological traits 9 Reproduction, early life stages and tree demography 9.1 Amount and quality of seeds at high elevation 9.2 Germination, seedling and sapling stage 9.3 Tree demography at the treeline 10 Freezing and other forms of stress 10.1 Stress at the treeline in a fitness context 10.2 Mechanisms and principles of freezing resistance 10.3 Freezing resistance in treeline trees 10.4 Other forms of stress at the treeline 10.4.1 Freeze-thaw cycles and hydraulic failure 10.4.2 Winter desiccation 11 Water, nutrient and carbon relations 11.1 Tree water relations during the growing season 11.2 Nutrient relations 11.3 Carbon relations 12 Treeline formation - currently, in the past and in the future 12.1 Causes of current treelines 12.2 Treelines in the recent past 12.3 Treelines in the distant past (Holocene) 12.4 Treelines in the future References Subject Index Taxonomic Index

Note: Contents Preface and acknowledgments The book website www.cambridge.org/smylie 1 Introduction and theoretical background 1.1 Scalar, vector and tensor analysis 1.2 Separation of vector fields 1.3 Vector spherical harmonics 1.4 Elasticity theory 1.5 Linear algebraic systems 1.6 Interpolation and approximation 2 Time sequence and spectral analysis 2.1 Time domain analysis 2.2 Linear optimum Wiener filters 2.3 Frequency domain analysis 2.4 Fourier series and transforms 2.5 Power spectral density estimation 2.6 Maximum entropy spectral analysis 3 Earth deformations 3.1 Equilibrium equations 3.2 The reciprocal theorem of Betti 3.3 Radial equations: spheroidal and torsional 3.4 Dynamical equations 3.5 Solutions near the geocentre 3.6 Numerical integration of the radial equations 3.7 Fundamental, regular solutions in the inner core 4 Earth's rotation: observations and theory 4.1 Reference frames 4.2 Polar motion and wobble 4.3 The dynamics of polar motion and wobble 4.4 Nutation and motion of the celestial pole 5 Earth's figure and gravitation 5.1 Historical development 5.2 External gravity and figure 5.3 Equilibrium theory of the internal figure 5.4 Gravity coupling 6 Rotating fluids and the outer core 6.1 The inertial wave equation 6.2 Dynamics of the fluid outer core 6.3 Scaling of the core equations 6.4 Compressibility and density stratification 7 The subseisniic equation and boundary conditions 7.1 The subseismic wave equation 7.2 Deformation of the shell and inner core 8 Variational methods and core modes 8.1 A subseismic variational principle 8.2 Representation of the functional 8.3 Finite element support functions 8.4 Boundary conditions and constraints 8.5 Numerical implementation and results 8.6 Rotational splitting and viscosity 8.7 A viscosity profile for the outer core 9 Static deformations and dislocation theory 9.1 The elasticity theory of dislocations 9.2 The theory for realistic Earth models 9.3 Changes in the inertia tensor and the secular polar shift Appendix A Elementary results from vector analysis A.1 Vector identities A.2 Vector calculus identities A.3 Integral theorems Appendix B Properties of Legendre functions B.1 Recurrence relations B.2 Evaluation of Legendre functions Appendix C Numerical Earth models C.1 The Earth models References Fortran index Subject index

Note: Front cover; Title page; Copyright page; Contents; Dedication; Friends of the Earth: rethinking travel; Foreword; Preface; Introduction; PART 1: THINKING BEYOND FLYING; Chapter 1: To fly or not to fly?; Chapter 2: Deciding never to fly again; Chapter 3: Young people and climate change; Chapter 4: Waking up to the downsides of flying; Chapter 5: Slow and low - the way to go: a systems view of travel emissions; PART 2: BUSINESS BEYOND FLYING; Chapter 6: A green travel experiment; Chapter 7: Trains versus planes: building a low-carbon travel agency. , Chapter 8: Going cold turkey: a law practice without any flightsChapter 9: The no-flying conference: Signs of Change; Chapter 10: Slowlier than thou: why flight-free travel is about better, not less; PART 3: SAVOURING THE JOURNEY; Chapter 11: The human engine: bicycling to Beijing; Chapter 12: Walking distance; Chapter 13: bike2oz: the world going through you instead of around you; Chapter 14: A small matter of distance: trying not to fly to climate talks; Chapter 15: Travel on a hot planet: exploring the global tourist industry overland; How to fly less; Index; Other Green Books titles. , About Green Books.

Note: Contents; Preface; 1 Introduction; 2 Fundamentals of rock failure physics; 2.1 Mechanical properties and constitutive relations; 2.1.1 Elastic deformation; 2.1.2 Ductile deformation; 2.1.3 Fracture; 2.1.4 Friction; 2.2 Basics of rock fracture mechanics; 2.2.1 Energy release rate and resistance to rupture growth; 2.2.2 Stress concentration and cohesive zone model; 2.2.3 Breakdown zone model for shear failure; 2.2.4 j-integral and energy criterion for shear failure; 2.2.5 Relation between resistance to rupture growth and constitutive relation parameters. , 3 Laboratory-derived constitutive relations for shear failure3.1 Shear failure of intact rock; 3.1.1 Method and apparatus used; 3.1.2 Constitutive relations derived from data on the shear failure of intact rock; 3.1.3 Geometric irregularity of shear-fractured surfaces and characteristic length; 3.2 Frictional slip failure on precut rock interface; 3.2.1 Method and apparatus used; 3.2.2 Geometric irregularity of precut fault surfaces and characteristic length; 3.2.3 Constitutive relations derived from data on frictional stick-slip failure. , 3.2.4 Laboratory-derived relationships between physical quantities observed during dynamic slip rupture propagation3.3 Unifying constitutive formulation and a constitutive scaling law; 3.3.1 Unification of constitutive relations for shear fracture and for frictional slip failure; 3.3.2 A constitutive scaling law; 3.3.3 Critical energy required for shear fracture and for frictional stick-slip failure; 3.3.4 Stabilityinstability of the breakdown process; 3.3.5 Breakdown zone size; 3.4 Dependence of constitutive law parameters on environmental factors; 3.4.1 Introduction. , 3.4.2 Dependence of shear failure strength on environmental factors3.4.3 Dependence of breakdown stress drop on environmental factors; 3.4.4 Dependence of breakdown displacement on environmental factors; 4 Constitutive laws for earthquake ruptures; 4.1 Basic foundations for constitutive formulations; 4.2 Rate-dependent constitutive formulations; 4.3 Slip-dependent constitutive formulations; 4.4 Depth dependence of constitutive law parameters; 5 Earthquake generation processes; 5.1 Shear failure nucleation processes observed in the laboratory; 5.1.1 Introduction; 5.1.2 Experimental method. , 5.1.3 Nucleation phases observed on faults with different surface roughnessesRough fault; Smooth fault; Extremely smooth fault; 5.1.4 Scaling of the nucleation zone size; 5.2 Earthquake rupture nucleation; 5.2.1 Seismogenic background; 5.2.2 Physical modeling and theoretical derivation of the nucleation zone size; 5.2.3 Comparison of theoretical relations with seismological data; 5.2.4 Foreshock activity associated with the nucleation process; 5.3 Dynamic propagation and generation of strong motion seismic waves; 5.3.1 Slip velocity and slip acceleration in the breakdown zone. , 5.3.2 The cutoff frequency fs max of the power spectral density of slip acceleration at the source.

Note: Cover; Contents; Preface and Overview; Acknowledgments; Introduction to the 2014 Edition; 1. The Distinctiveness of Comparative Social Science; 2. Heterogeneity and Causal Complexity; 3. Case-Oriented Comparative Methods; 4. The Variable-Oriented Approach; 5. Combined Versus Synthetic Comparative Strategies; 6. A Boolean Approach to Qualitative Comparison: Basic Concepts; 7. Extensions of Boolean Methods of Qualitative Comparison; 8. Applications of Boolean Methods of Qualitative Comparison; 9. The Dialogue of Ideas and Evidence in Social Research; Bibliography; Index.

Note: ""Cover""; ""Contents""; ""Acknowledgments""; ""Chapter 1 Introduction""; ""1.1 Types of Disease""; ""1.2 Characterization of Diseases""; ""1.3 Control of Infectious Diseases""; ""1.4 What Are Mathematical Models?""; ""1.5 What Models Can Do""; ""1.6 What Models Cannot Do""; ""1.7 What Is a Good Model?""; ""1.8 Layout of This Book""; ""1.9 What Else Should You Know?""; ""Chapter 2 Introduction to Simple Epidemic Models""; ""2.1 Formulating the Deterministic SIR Model""; ""2.1.1 The SIR Model Without Demography""; ""2.1.1.1 The Threshold Phenomenon""; ""2.1.1.2 Epidemic Burnout"". , ""2.1.1.3 Worked Example: Influenza in a Boarding School""""2.1.2 The SIR Model With Demography""; ""2.1.2.1 The Equilibrium State""; ""2.1.2.2 Stability Properties""; ""2.1.2.3 Oscillatory Dynamics""; ""2.1.2.4 Mean Age at Infection""; ""2.2 Infection-Induced Mortality and SI Models""; ""2.2.1 Mortality Throughout Infection""; ""2.2.1.1 Density-Dependent Transmission""; ""2.2.1.2 Frequency Dependent Transmission""; ""2.2.2 Mortality Late in Infection""; ""2.2.3 Fatal Infections""; ""2.3 Without Immunity: The SIS Model""; ""2.4 Waning Immunity: The SIRS Model"". , ""2.5 Adding a Latent Period: The SEIR Model""""2.6 Infections with a Carrier State""; ""2.7 Discrete-Time Models""; ""2.8 Parameterization""; ""2.8.1 Estimating R[sub(0)] from Reported Cases""; ""2.8.2 Estimating R[sub(0)] from Seroprevalence Data""; ""2.8.3 Estimating Parameters in General""; ""2.9 Summary""; ""Chapter 3 Host Heterogeneities""; ""3.1 Risk-Structure: Sexually Transmitted Infections""; ""3.1.1 Modeling Risk Structure""; ""3.1.1.1 High-Risk and Low-Risk Groups""; ""3.1.1.2 Initial Dynamics""; ""3.1.1.3 Equilibrium Prevalence""; ""3.1.1.4 Targeted Control"". , ""3.1.1.5 Generalizing the Model""""3.1.1.6 Parameterization""; ""3.1.2 Two Applications of Risk Structure""; ""3.1.2.1 Early Dynamics of HIV""; ""3.1.2.2 Chlamydia Infections in Koalas""; ""3.1.3 Other Types of Risk Structure""; ""3.2 Age-Structure: Childhood Infections""; ""3.2.1 Basic Methodology""; ""3.2.1.1 Initial Dynamics""; ""3.2.1.2 Equilibrium Prevalence""; ""3.2.1.3 Control by Vaccination""; ""3.2.1.3 Parameterization""; ""3.2.2 Applications of Age Structure""; ""3.2.2.1 Dynamics of Measles""; ""3.2.2.2 Spread and Control of BSE""; ""3.3 Dependence on Time Since Infection"". , ""3.3.1 SEIR and Multi-Compartment Models""""3.3.2 Models with Memory""; ""3.3.3 Application: SARS""; ""3.4 Future Directions""; ""3.5 Summary""; ""Chapter 4 Multi-Pathogen/Multi-Host Models""; ""4.1 Multiple Pathogens""; ""4.1.1 Complete Cross-Immunity""; ""4.1.1.1 Evolutionary Implications""; ""4.1.2 No Cross-Immunity""; ""4.1.2.1 Application: The Interaction of Measles and Whooping Cough""; ""4.1.2.2 Application: Multiple Malaria Strains""; ""4.1.3 Enhanced Susceptibility""; ""4.1.4 Partial Cross-Immunity""; ""4.1.4.1 Evolutionary Implications"". , ""4.1.4.2 Oscillations Driven by Cross-Immunity"".

Note: Problemanalyse und ÜberblickNeue Institutionen: Zukunftsräte -- Neue Institutionen: Ombudspersonen -- Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten -- Ombudspersonen in Unternehmen?..

Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.

Note: Vorwort; Inhaltsverzeichnis; 1 Einführung; 1.1 Grundlegende Begriffe; 1.2 Schutzziele; 1.3 Schwachstellen, Bedrohungen, Angriffe; 1.3.1 Bedrohungen; 1.3.2 Angriffs- undAngreifer-Typen; 1.3.3 Rechtliche Rahmenbedingungen; 1.4 ComputerForensik; 1.5 Sicherheitsrichtlinie; 1.6 Sicherheitsinfrastruktur; 2 Spezielle Bedrohungen; 2.1 Einführung; 2.2 Buffer-Overflow; 2.2.1 Einführung; 2.2.2 Angriffe; 2.2.3 Gegenmaßnahmen; 2.3 Computerviren; 2.3.1 Eigenschaften; 2.3.2 Viren-Typen; 2.3.3 Gegenmaßnahmen; 2.4 Würmer; 2.5 Trojanisches Pferd; 2.5.1 Eigenschaften; 2.5.2 Gegenmaßnahmen; 2.6 Bot-Netze undSpam. , 2.6.1 Bot-Netze2.6.2 Spam; 2.7 MobilerCode; 2.7.1 Eigenschaften; 2.7.2 Sicherheitsbedrohungen; 2.7.3 Gegenmaßnahmen; 2.7.4 MobileApps; 3 Internet-(Un-)Sicherheit; 3.1 Einführung; 3.2 Internet-Protokollfamilie; 3.2.1 ISO/OSI-Referenzmodell; 3.2.2 DasTCP/IP-Referenzmodell; 3.2.3 Das Internet-Protokoll IP; 3.2.4 DasTransmissionControlProtokoll TCP; 3.2.5 DasUserDatagramProtocolUDP; 3.2.6 DHCP und NAT; 3.3 Sicherheitsprobleme; 3.3.1 Sicherheitsprobleme von IP; 3.3.2 Sicherheitsprobleme von ICMP; 3.3.3 Sicherheitsprobleme vonARP; 3.3.4 Sicherheitsprobleme vonUDPundTCP. , 3.4 Sicherheitsprobleme vonNetzdiensten3.4.1 DomainNameService (DNS); 3.4.2 NetworkFileSystem(NFS); 3.4.3 WeitereDienste; 3.5 Web-Anwendungen; 3.5.1 World Wide Web (WWW); 3.5.2 Sicherheitsprobleme; 3.5.3 OWASPTop-TenSicherheitsprobleme; 3.6 Analysetools undSystemhärtung; 4 Security Engineering; 4.1 Entwicklungsprozess; 4.1.1 AllgemeineKonstruktionsprinzipien; 4.1.2 Phasen; 4.1.3 BSI-Sicherheitsprozess; 4.2 Strukturanalyse; 4.3 Schutzbedarfsermittlung; 4.3.1 Schadensszenarien; 4.3.2 Schutzbedarf; 4.4 Bedrohungsanalyse; 4.4.1 Bedrohungsmatrix; 4.4.2 Bedrohungsbaum; 4.5 Risikoanalyse. , 4.5.1 Attributierung4.5.2 Penetrationstests; 4.6 Sicherheitsarchitektur und Betrieb; 4.6.1 Sicherheitsstrategie undSicherheitsmodell; 4.6.2 Systemarchitektur undValidierung; 4.6.3 Aufrechterhaltung im laufenden Betrieb; 4.7 Sicherheitsgrundfunktionen; 4.8 Realisierung der Grundfunktionen; 4.9 Security Development Lifecycle (SDL); 4.9.1 Die Entwicklungsphasen; 4.9.2 Bedrohungs- und Risikoanalyse; 5 Bewertungskriterien; 5.1 TCSEC-Kriterien; 5.1.1 Sicherheitsstufen; 5.1.2 Kritik am Orange Book; 5.2 IT-Kriterien; 5.2.1 Mechanismen; 5.2.2 Funktionsklassen; 5.2.3 Qualität; 5.3 ITSEC-Kriterien. , 5.3.1 Evaluationsstufen5.3.2 Qualität und Bewertung; 5.4 Common Criteria; 5.4.1 Überblick über dieCC; 5.4.2 CC-Funktionsklassen; 5.4.3 Schutzprofile; 5.4.4 Vertrauenswürdigkeitsklassen; 5.5 Zertifizierung; 6 Sicherheitsmodelle; 6.1 Modell-Klassifikation; 6.1.1 Objekte undSubjekte; 6.1.2 Zugriffsrechte; 6.1.3 Zugriffsbeschränkungen; 6.1.4 Sicherheitsstrategien; 6.2 Zugriffskontrollmodelle; 6.2.1 Zugriffsmatrix-Modell; 6.2.2 RollenbasierteModelle; 6.2.3 Chinese-Wall Modell; 6.2.4 Bell-LaPadula Modell; 6.3 Informationsflussmodelle; 6.3.1 Verbands-Modell; 6.4 Fazit undAusblick. , 7 Kryptografische Verfahren.

Note: List of Figures; Acknowledgements; Prologue; Chapter One Introduction; Chapter Two The Future Told; Chapter Three The Future Tamed; Chapter Four Futures Traded; Chapter Five Futures Transformed; Chapter Six Futures Traversed; Chapter Seven Futures Thought; Chapter Eight Futures Tended; Chapter Nine Futures Transcended; Epilogue; Glossary of Key Terms; Bibliography; Name Index; Subject Index.

Note: Particle Drifts and the First Adiabatic InvariantParticle Trapping, Drift Shells and the Second Adiabatic Invariant -- Periodic Drift Motion and the Third Adiabatic Invariant -- Trapped Particle Distributions and Flux Mapping -- Violation of the Adiabatic Invariants and Trapped Particle Diffusion -- Introduction to Plasma Physics..

Note: The Application of IR Spectroscopy to the Investigation of MineralsThe Discrete Approach -- The Full-Profile Analysis -- Polymerization of coordination polyhedra and structure topology -- Hydrogen-bearing groups and hydrogen bonding -- Solid-solution series -- Force parameters of cations in silicates -- IR spectra of minerals and reference samples data -- Borates, including sulfato-borates and arsenato-borates -- Carbides and carbonates -- Organic compounds and salts of organic acids -- Ammino-complexes, nitrates and sulfato-nitrates -- Oxides and hydroxides -- Fluorides -- Silicates -- Phosphates -- Sulfates, carbonato-sulfates, phosphato-sulfates and sulfides -- Chlorides -- Vanadates and vanadium oxides -- Chromates -- Arsenates, arsenites and sulfato-arsenates -- Selenites, molybdates, tellurites, tellurates, iodites, wolframates and wolfram oxides..

Note: Inhalt: 1 Einleitung. - 1.1 Alltägliche Probleme. - 1.2 Uni- und multivariate Daten. - 1.3 Wege ins Statistiklabyrinth. - 2 Statistische Grundlagen. - 2.1 Einführung in die Terminologie. - 2.2 Datentypen -Skalenniveaus. - 2.3 Korrelation. - 2.4 Regression. - 2.5 Lineare Regression. - 2.6 Multiplelineare Regression. - 2.7 Unimodale Modelle - die Gauß'sche Regression. - 2.8 Logistische und Gauß'sche logistische Regression. - 2.9 Interaktionen. - 2.10 Gewichtetes Mittel. - 2.11 Partielle Analysen. - 3 Datenmanipulationen. - 3.1 Normalverteilung und Transformationen. - 3.2 Standardisierungen. - 3.3 Transponieren, Umkodieren und Maskieren. - 4 Ähnlichkeits- und Distanzmaße. - 4.1 Qualitative Ähnlichkeitsmaße. - 4.2 Quantitative Ähnlichkeitsmaße. - 4.3 Distanzmaße. - 4.4 Vergleich der geschilderten Koeffizienten. - 5 Ordinationen - das Prinzip. - 5.1 Dimensionsreduktion als Analysestrategie. - 5.2 Polare Ordination. - 6 Korrespondenzanalyse (CA). - 6.1 Das Prinzip. - 6.2 Mathematische Artefakte - Probleme der CA. - 6.3 DCA {Detrended Correspondence Analysis). - 6.4 Zusammenfassendes zu Problemen der CA und DCA. - 7 Interpretation von CA und DCA. - 7.1 Zur Skalierung und Interpretation der Ordinationsdiagramme. - 7.2 Umweltvariablen-Interaktionen von Effekten. - 7.3 Ordination und Umweltdaten. - 8 Kanonische Ordination (constrained ordination). - 8.1 Prinzip der Kanonischen Korrespondenzanalyse (CCA). - 8.2 Interpretation eines CCA-Diagramms. - 8.3 Forward selection bei kanonischen Ordinationen. - 8.4 Überprüfung einer CCA. - 9 Hauptkomponentenanalyse (PCA). - 9.1 Das Prinzip - geometrische Herleitung. - 9.2 Das Prinzip - der mathematische Ansatz. - 9.3 Optionen bei einer PCA. - 9.4 Stärken und Schwächen der PCA. - 9.5 Faktorenanalyse. - 10 Lineare Methoden und Umweltdaten: PCA und RDA. - 10.1 Indirekte Ordination. - 10.2 Kanonische Ordination - Prinzip der Redundanzanalyse. - 10.3 Interpretation einer RDA. - 11 Partielle Ordination und variance partitioning. - 11.1 Kovariablen. - 11.2 Partielle PCA, CA, DCA. - 11.3 Partielle kanonische Ordination. - 11.4 Variance partitioning. - 12 Multidimensionale Skalierung. - 12.1 Der andere Weg zum Ziel. - 12.2 Metrische Multidimensionale Skalierung - Hauptkoordinatenanalyse. - 12.3 Nichtmetrische Multidimensionale Skalierung. - 12.3.1 Das Prinzip. - 12.3.2 NMDS - Optionen und Probleme. - 12.3.3 Ablauf einer NMDS. - 13 Klassifikation - das Prinzip. - 13.1 Das Wesen von Klassifikationen. - 13.2 Die wichtigsten Klassifikationsstrategien. - 14 Agglomerative Klassifikationsverfahren. - 14.1Clusteranalyse - Grundlagen. - 14.2 Auswertung von Dendrogrammen. - 15 Divisive Klassifikationsverfahren. - 15.1 Ordination Space Partitioning. - 15.2 TWINSPAN. - 15.3 Ablauf einer TWINSPAN-Analyse. - 15.4 Kritik an der TWINSPAN-Analyse. - 16 Sonstige Verfahren zur Beschreibung von Gruppenstrukturen. - 16.1 Nichthierarchische agglomerative Verfahren. - 16.2 Nichthierarchische divisive Verfahren. - 16.3 Numerische "treue"-basierte Verfahren. - 16.4 Diskriminanzanalyse. - 16.4.1 Das Prinzip. - 16.4.2 Voraussetzungen. - 16.4.3 Gütekriterien/Prüfung der Ergebnisse. - 17 Permutationsbasierte Tests. - 17.1 Das Prinzip von Permutationstests. - 17.2 Test auf Signifikanz von Ordinationsachsen. - 17.3 Mantel-Test. - 17.4 Gruppenvergleiche - Mantel-Tests und MRPP. - 17.5 Procrustes-Analysen. - 17.6 Indicator Species Analysis. - 17.7 Ausblick Randomisierungsverfahren. - Literatur. - Sachverzeichnis.

Note: Inhalt 1 Einleitung 2 Der erste Eindruck - Das Anmeldegespräch 2.1 Ein Beispiel 2.2 Die Raumsituation 2.3 Die Kommunikationssituation mit Kunden 2.3.1 Gast und Gastgeber 2.3.2 Wir kommunizieren ständig 2.3.3 Wie wirke ich auf andere? 2.3.4 Beziehungs- und Sachaspekt der Kommunikation 2.3.5 Rolleneinnahme und Gesamthaltung der Bibliothek 2.4 Die Gesprächssituation 2.4.1 Augenhöhe und Respekt 2.4.2 Einstellen auf verschiedene Gesprächspartner 2.4.3 Der Gesprächsverlauf 2.4.4 Verständlichkeit und Anschaulichkeit 2.4.5 Schwierige Situationen im Anmeldegespräch 2.5 Vertiefung 3 Professionell beraten - Das Auskunftsgespräch 3.1 Ein Beispiel 3.2 Verantwortung im Gespräch übernehmen - Rollenklarheit 3.3 Reden wir über das Gleiche? 3.4 Durch die Phasen des Gesprächs steuern 3.4.1 Kontakt aufnehmen 3.4.2 Die Ausgangsfrage stellen 3.4.3 Nachfragen 3.4.4 Absichern 3.4.5 Lösungen entwickeln und anbieten 3.4.6 Vereinbarung treffen 3.4.7 Verabschieden 3.5 Die richtigen Fragen stellen 3.6 Störungen in der Auskunftssituation und die Etablierung von Standards 3.7 Tipps im Auskunftsgespräch 3.8 Vertiefung 4 Schulungen und Führungen entwickeln 4.1 Ein Beispiel 4.2 Lerntheoretische Hintergründe 4.2.1 Das Gedächtnis: Wie merken wir uns etwas? 4.2.2 Lerntypen: Wer lernt wie? 4.2.3 Lernpyramide: Mit welchen Lernmethoden lernen wir am effektivsten? 4.2.4 Die Hirnforschung: Wie lernt unser Gehirn am besten? 4.3 Modelle der Didaktik 4.3.1 Instruktionsorientierte Didaktik 4.3.2 Kompetenzorientierte Didaktik 4.4 Die Rolle der Lehrenden 4.5 Auftragsklärung 4.6 Die Konzeptentwicklung in sechs Schritten 4.6.1 Mit der Zielgruppe beschäftigen 4.6.2 Lernziele entwickeln 4.6.3 Themen sammeln und sortieren 4.6.4 Methodik festlegen 4.6.5 Lernkreislauf entwickeln 4.6.6 Dramaturgie und Zeitplan festlegen 4.7 Methodenpool 4.8 Schwierige Situationen in Schulungen 4.9 Wir lernen weiter: Eine Methode für das Schulungsteam 4.10 Vertiefung 5 Schwierige Situationen mit Kunden bewältigen 5.1 Ein Beispiel 5.2 Der Hintergrund 5.2.1 Ebenen der Kommunikation 5.2.2 Vier Reaktionsmöglichkeiten 5.2.3 Der Teufelskreis in der Kommunikation 5.3 Was lässt manche Menschen schwierig werden? 5.3.1 Ein Beispiel 5.3.2 Menschliche Bedürfnisse und Aggressionen 5.3.3 Wie wir den Konflikt betrachten - verschiedene Konfliktebenen 5.4 Das Dilemma der guten Mitarbeiterin 5.5 Die Entschärfung der Situation 5.6 Formulierungstipps - kleines Glossar der hilfreichen Worte 5.7 Kommunikative Basics für schwierige Situationen 5.7.1 So tun als ob 5.7.2 Distanz wahren 5.7.3 Die Flucht nach vornantreten 5.7.4 Verlierer und Schein-Sieger 5.7.5 Eigene Irrtümer vermeiden 5.8 Fallbeispiele 5.8.1 Typologie nach Fritz Riemann 5.8.2 Fünf Fälle und Handlungsmöglichkeiten 5.9 Deeskalationsstrategien - wenn es ganz schwierig wird 5.10 Vertiefung 6 Beschwerdemanagement in Bibliotheken 6.1 Ein Beispiel 6.2 Was ist Beschwerdemanagement? 6.3 Die Komponenten eines Beschwerdemanagement-Systems 6.3.1 Beschwerdestimulierung 6.3.2 Beschwerdekanäle 6.3.3 Beschwerdeannahme 6.3.4 Beschwerdebearbeitung 6.3.5 Beschwerdereaktion 6.3.6 Beschwerdeauswertung 6.3.7 Beschwerdereporting (öffentlich) 6.4 Die Kommunikationssituation der Beschwerde 6.4.1 Worüber beschweren sich Kunden der Bibliothek? 6.4.2 Beschwerdeschreiben verstehen und beantworten 6.4.3 Unzufriedenheit und Schweregrad der Beschwerde 6.4.4 Die Entschärfung der Situation 6.4.5 Ein Gesprächsleitfaden für Beschwerdegespräche 6.4.6 Deeskalieren 6.4.7 Tipps für die Gesprächssituation 6.4.8 Mitarbeiter einbeziehen und schulen 6.5 Vertiefung 7 Kundenorientierung in der Bibliothek 7.1 Ein Beispiel 7.2 Was heißt Kundenorientierung in der Bibliothek? 7.3 Vom Nutzer zum Kunden 7.4 Von der Produkt- zur Kundenorientierung 7.5 Ein Gesamtkonzept zur Einführung von Kundenorientierung 7.6 Eins greift ins andere - Kundenzentrierung und Mitarbeiterorientierung 7.7 Gemeinsame Verhaltensstandards einführen 7.7.1 Was sind Leistungsstandards 7.7.2 Kontaktsituationen mit Kunden und mögliche Verhaltensstandards 7.8 Damit alle an einem Strang ziehen 7.9 Vertiefung 8 Sicher und gewandt auftreten 8.1 Ein Beispiel 8.2 Die eigene Einstellung 8.2.1 Persönliche Denkmuster 8.2.2 Innere Dialoge 8.3 Woran wir arbeiten können - das rhetorische Handwerkszeug 8.4 Sicheres Auftreten braucht Übung 8.5 Erklären und überzeugen 8.6 Anschaulich und lebendig sprechen 8.7 Präsenz zeigen 8.8 Stimmlich überzeugen 8.9 Lampenfieber - die Spannung nutzen 8.10 Vertiefung Literatur und Internet-Links Sachregister Über die Autorin

Note: CONTENTS Preface Photo Credits Computer Codes 1 Introduction 1-1 Why Microwaves for Remote Sensing? 1-2 A Brief Overview of Microwave Sensors 1-3 A Short History of Microwave Remote Sensing 1-3.1 Radar 1-3.2 Radiometers 1-4 The Electromagnetic Spectrum 1-5 Basic Operation and Applications of Radar 1-5.1 Operation of Remote-Sensing Radars 1-5.2 Applications of Remote-Sensing Radars 1-6 Basic Operation and Applications of Radiometers 1-6.1 Radiometer Operation 1-6.2 Applications of Microwave Radiometry 1-7 Image Examples 2 Electromagnetic Wave Propagation 2-1 EM Plane Waves 2-1.1 Constitutive Parameters 2-1.2 Maxwell's Equations 2-1.3 Complex Permittivity 2-1.4 Wave Equations 2-2 Plane-Wave Propagation in Lossless Media 2-2.1 Uniform Plane Waves 2-2.2 General Relation between E and H 2-3 Wave Polarization in a Lossless Medium 2-3.1 Linear Polarization 2-3.2 Circular Polarization 2-3.3 Elliptical Polarization 2-4 Plane Wave Propagation in Lossy Media 2-4.1 Low Loss Dielectric 2-4.2 Good Conductor 2-5 Electromagnetic Power Density 2-5.1 Plane Wave in a Lossless Medium 2-5.2 Plane Wave in a Lossy Medium 2-5.3 Decibel Scale tor Power Ratios 2-6 Wave Reflection and Transmission at Normal Incidence 2-6.1 Boundary between Lossless Media 2-6.2 Boundary between Lossy Media 2-7 Wave Reflection and Transmission at Oblique Incidence 2-7.1 Horizontal Polarization—Lossless Media 2-7.2 Vertical Polarization 2-8 Reflectivity and Transmissivity 2-9 Oblique Incidence onto a Lossy Medium 2- 10 Oblique Incidence onto a Two-Layer Composite 2-10.1 Input Parameters 2-10.2 Propagation Matrix Method 2-10.3 Multiple Reflection Method 3 Remote-Sensing Antennas 3-1 The Hertzian Dipole 3-2 Antenna Radiation Characteristics 3-2.1 Antenna Pattern 3-2.2 Beam Dimensions 3-2.3 Antenna Directivity 3-2.4 Antenna Gain 3-2.5 Radiation Efficiency 3-2.6 Effective Area of a Receiving Antenna 3-3 Friis Transmission Formula 3-4 Radiation by Large-Aperture Antennas 3-5 Rectangular Aperture with Uniform Field Distribution 3-5.1 Antenna Pattern in x-y Plane 3-5.2 Beamwidth 3-5.3 Directivity and Effective Area 3-6 Circular Aperture with Uniform Field Illumination 3-7 Nonuniform-Amplitude Illumination 3-8 Beam Efficiency 3-9 Antenna Arrays 3-10 N-Element Array with Uniform Phase Distribution 3-10.1 Uniform Amplitude Distribution 3-10.2 Grating Lobes 3-10.3 Binomial Distribution 3-11 Electronic Scanning of Arrays 3-12 Antenna Types 3-12.1 Horn Antennas 3-12.2 Slot Antennas 3-12.3 Microstrip Antennas 3-13 Active Antennas 3-13.1 Advantages of Active Antennas 3-13.2 Digital Beamforming with Active Antennas 4 Microwave Dielectric Properties of Natural Earth Materials 4-1 Pure-Water Single-Debye Dielectric Model (f 〈 50 GHz) 4-2 Saline-Water Double-Debye Dielectric Model (f〈 1000 GHz) 4-3 Dielectric Constant of Pure Ice 4-4 Dielectric Mixing Models for Heterogeneous Materials 4-4.1 Randomly Oriented Ellipsoidal Inclusions 4-4.2 Polder-van Santen/de Loor Formulas 4-4.3 Tinga-Voss-Blossey (TVB) Formulas 4-4.4 Other Dielectric Mixing Formulas 4-5 Sea Ice 4-5.1 Dielectric Constant of Brine 4-5.2 Brine Volume Fraction 4-5.3 Dielectric Properties 4-6 Dielectric Constant of Snow 4-6.1 Dry Snow 4-6.2 Wet Snow 4-7 Dielectric Constant of Dry Rocks 4-7.1 Powdered Rocks 4-7.2 Solid Rocks 4-8 Dielectric Constant of Soils 4-8.1 Dry Soil 4-8.2 Wet Soil 4-8.3 εsoil in 0.3-1.5 GHz Band 4-9 Dielectric Constant of Vegetation 4-9.1 Dielectric Constant of Canopy Constituents 4-9.2 Dielectric Model 5 Radar Scattering 5-1 Wave Polarization in a Spherical Coordinate System 5-2 Scattering Coordinate Systems 5-2.1 Forward Scattering Alignment (FSA) Convention 5-2.2 Backscatter Alignment (BSA) Convention 5-3 Scattering Matrix 5-3.1 FSA Convention 5-3.2 BSA Convention 5-3.3 Stokes Parameters and Mueller Matrix 5-4 Radar Equation 5-5 Scattering from Distributed Targets 5-5.1 Narrow-Beam Scatterometer 5-5.2 Imaging Radar 5-5.3 Specific Intensities for Distributed Target 5-6 RCS Statistics 5-7 Rayleigh Fading Model 5-7.1 Underlying Assumptions 5-7.2 Linear Detection 5-7.3 Square-Law Detection 5-7.4 Interpretation 5-8 Multiple Independent Samples 5-8.1 N-Look Amplitude Image 5-8.2 N-Look Intensity Image 5-8.3 N-Look Square-Root Intensity Image 5-8.4 Spatial Resolution vs. Radiometric Resolution 5-8.5 Applicability of the Rayleigh Fading Model 5-9 Image Texture and Despeckle Filtering . 5-9.1 Image Texture 5-9.2 Despeckling Filters 5-10 Coherent and Noncoherent Scattering 5-10.1 Surface Roughness 5-10.2 Bistatic Scattering 5-10.3 Specular Reflectivity 5-10.4 Bistatic-Scattering Coefficient 5-10.5 Backscattering Response of a Smooth Surface 5-11 Polarization Synthesis 5-11.1 RCS Polarization Response 5-11.2 Distributed Targets 5-11.3 Mueller Matrix Approach 5-12 Polarimetric Scattering Statistics 5-13 Polarimetric Analysis Tools 5-13.1 Scattering Covariance Matrix 5-13.2 Eigenvector Decomposition 5-13.3 Useful Polarimetric Parameters 5-13.4 Image Examples 5-13.5 Freeman-Durden Decomposition 6 Microwave Radiometry and Radiative Transfer 6-1 Radiometric Quantities 6-2 Thermal Radiation 6-2.1 Quantum Theory of Radiation 6-2.2 Planck's Blackbody Radiation Law 6-2.3 The Rayleigh-Jeans Law 6-3 Power-Temperature Correspondence 6-4 Radiation by Natural Materials 6-4.1 Brightness Temperature 6-4.2 Brightness Temperature Distribution 6-4.3 Antenna Temperature 6-5 Antenna Efficiency Considerations 6-5.1 Beam Efficiency 6-5.2 Radiation Efficiency 6-5.3 Radiometer Measurement Ambiguity 6-6 Theory of Radiative Transfer 6-6.1 Equation of Radiative Transfer 6-6.2 Brightness-Temperature Equation 6-6.3 Brightness Temperature of a Stratified Medium 6-6.4 Brightness Temperature of a Scatter-Free Medium 6-6.5 Upwelling and Downwelling Atmospheric Brightness Temperatures 6-7 Terrain Brightness Temperature 6-7.1 Brightness Transmission Across a Specular Boundary 6-7.2 Emission by a Specular Surface 6-7.3 Emissivity of a Rough Surface 6-7.4 Extreme Surface Conditions 6-7.5 Emissivity of a Two-Layer Composite 6-8 Downward-Looking Satellite Radiometer 6-9 Polarimetric Radiometry 6-10 Stokes Parameters and Periodic Structures 7 Microwave Radiometric Systems 7-1 Equivalent Noise Temperature 7-2 Characterization of Noise 7-2.1 Noise Figure 7-2.2 Equivalent Input Noise Temperature 7-2.3 Noise Temperature of a Cascaded System 7-2.4 Noise Temperature of a Lossy Two-Port Device 7-3 Receiver and System Noise Temperatures 7-3.1 Receiver Alone 7-3.2 Total System Including Antenna 7-4 Radiometer Operation 7-4.1 Measurement Accuracy 7-4.2 Total-Power Radiometer 7-4.3 Radiometric Resolution 7-5 Effects of Receiver Gain Variations 7-6 Dicke Radiometer 7-7 Balancing Techniques 7-7.1 Reference-Channel Control Method 7-7.2 Antenna-Channel Noise-Injection Method 7-7.3 Pulsed Noise-Injection Method 7-7.4 Gain-Modulation Method 7-8 Automatic-Gain-Control (AGC) Techniques 7-9 Noise-Adding Radiometer 7-10 Summary of Radiometer Properties 7-11 Radiometer Calibration Techniques 7-11.1 Receiver Calibration 7-11.2 Calibration Sources 7-11.3 Effects of Impedance Mismatches 7-11.4 Antenna Calibration 7-11.5 Cryoload Technique 7-11.6 Bucket Technique 7-12 Imaging Considerations 7-12.1 Scanning Configurations 7-12.2 Radiometer Uncertainty Principle 7-13 Interferometric Aperture Synthesis 7-13.1 Image Reconstruction 7-13.2 MIR Radiometric Sensitivity 7-14 Polarimetric Radiometer 7-14.1 Coherent Detection 7-14.2 Incoherent Detection 7-15 Calibration of Polarimetric Radiometers 7-15.1 Forward Model for a Fully Polarimetric Radiometer 7-15.2 Forward Model for the Polarimetric Calibration Source 7-15.3 Calibration by Inversion of the Forward Models 7-16 Digital Radiometers 8 Microwave Interaction with Atmospheric Constituents 8-1 Standard Atmosphere 8-1.1 Atmospheric Composition 8-1.2 Temperature Profile 8-1.3 Density Profile 8-1.4 Pressure Profi

Note: Weathering Processes Lichen weathering of minerals: implications for pedogenesis M. J. Wilson D. Jones https://doi.org/10.1144/GSL.SP.1983.011.01.01 Porewater reactions in the unsaturated zone with special reference to groundwater quality in England D. A. Spears https://doi.org/10.1144/GSL.SP.1983.011.01.02 A review of experimental weathering of basic igneous rocks David C. Cawsey and Paul Mellon https://doi.org/10.1144/GSL.SP.1983.011.01.03 Kaolinites, Laterites and Bauxites Kaolinisation and the formation of silicified wood on late Jurassic Gondwana surfaces H. Wopfner https://doi.org/10.1144/GSL.SP.1983.011.01.04 Kaolinitic weathering profiles in Brittany: genesis and economic importance J. Esteoule-Choux https://doi.org/10.1144/GSL.SP.1983.011.01.05 The origin and occurrence of Devon Ball Clays A. Vincent https://doi.org/10.1144/GSL.SP.1983.011.01.06 The Ayrshire Bauxitic Clay: an allochthonous deposit? S. K. Monro F. C. Loughnan and M. C. Walker https://doi.org/10.1144/GSL.SP.1983.011.01.07 Base metal concentrations in kaolinised and silicified lavas of the Central Burma volcanics T. R. Marshall B. J. Amos D. Stephenson https://doi.org/10.1144/GSL.SP.1983.011.01.08 A low level laterite profile from Uganda and its relevance to the question of parent material influence on the chemical composition of laterites M. J. McFarlane https://doi.org/10.1144/GSL.SP.1983.011.01.09 Palaeoenvironment of lateritic bauxites with vertical and lateral differentiation Ida Valeton https://doi.org/10.1144/GSL.SP.1983.011.01.10 Geochemistry of a nickeliferous laterite profile, Liberdade, Brazil J. Esson https://doi.org/10.1144/GSL.SP.1983.011.01.11 Red Beds Reddening of tropical coastal dune sands R. Gardner https://doi.org/10.1144/GSL.SP.1983.011.01.12 Post-depositional reddening of late Quaternary coastal dune sands, north-eastern Australia K. Pye https://doi.org/10.1144/GSL.SP.1983.011.01.13 Origin of red beds in a moist tropical climate (Etruria Formation, Upper Carboniferous, UK) B. M. Besly P. Turner https://doi.org/10.1144/GSL.SP.1983.011.01.14 Duricrusts: Calcretes, Silcretes and Gypcretes Environment of silcrete formation: a comparison of examples from Australia and the Cologne Embayment, West Germany H. Wopfner https://doi.org/10.1144/GSL.SP.1983.011.01.15 Silcrete in Western Australia: geomorphological settings, textures, structures, and their genetic implications W. J. E. van de Graaff https://doi.org/10.1144/GSL.SP.1983.011.01.16 Geochemistry of weathering profile silcretes, southern Cape Province, South Africa M. A. Summerfield https://doi.org/10.1144/GSL.SP.1983.011.01.17 Pliocene channel calcrete and suspenparallel drainage in West Texas and New Mexico C. C. Reeves, Jr https://doi.org/10.1144/GSL.SP.1983.011.01.18 Concentration of uranium and vanadium in calcretes and gypcretes Donald Carlisle https://doi.org/10.1144/GSL.SP.1983.011.01.19 Ancient duricrusts and related rocks in perspective: a contribution from the Old Red Sandstone John Parnell https://doi.org/10.1144/GSL.SP.1983.011.01.20 A process-response model for the formation of pedogenic calcretes Colin F. Klappa https://doi.org/10.1144/GSL.SP.1983.011.01.21 Stable isotope abundances in calcretes A. S. Talma F. Netterberg https://doi.org/10.1144/GSL.SP.1983.011.01.22 A Geotechnical classification of calcretes and other pedocretes F. Netterberg J. H. Caiger https://doi.org/10.1144/GSL.SP.1983.011.01.23 Karstic residual fluorite-baryte deposits at two localities in Derbyshire R. P. Shaw https://doi.org/10.1144/GSL.SP.1983.011.01.24 Cenozoic pedogenesis and landform development in south-east England John A. Catt https://doi.org/10.1144/GSL.SP.1983.011.01.25

Note: Contents Contents Preface Acknowledgements Part 1: Making Sediment Introduction Clastic sediment as a chemical and physical breakdown product 1.1 Introduction: clastic sediments—'accidents' of weathering 1.2 Silicate minerals and chemical weathering 1.3 Solute flux: rates and mechanisms of silicate chemical weathering 1.4 Physical weathering 1.5 Soils as valves and filters for the natural landscape 1.6 Links between soil age, chemical weathering and weathered-rock removal 1.7 Provenance: siliciclastic sediment-sourcing Further reading 2 Carbonate, siliceous, iron-rich and evaporite sediments 2.1 Marine vs. freshwater chemical composition and fluxes 2.2 The calcium carbonate system in the oceans 2.3 Ooid carbonate grains 2.4 Carbonate grains from marine plants and animals 2.5 Carbonate muds, oozes and chalks 2.6 Other carbonate grains of biological origins 2.7 Organic productivity, sea-level and atmospheric controls of biogenic CaCO3 deposition rates 2.8 CaCO3 dissolution in the deep ocean and the oceanic CaCO3 compensation mechanism 2.9 The carbonate system on land 2.10 Evaporite salts and their inorganic precipitation as sediment 2.11 Silica and pelagic plankton 2.12 Iron minerals and biomineralizers 2.13 Desert varnish 2.14 Phosphates 2.15 Primary microbial-induced sediments: algal mats and stromatolites Further reading 3 Sediment grain properties 3.1 General 3.2 Grain size 3.3 Grain-size distributions 3.4 Grain shape and form 3.5 Bulk properties of grain aggregates Further reading Part 2: Moving Fluid Introduction 4 Fluid basics 4.1 Material properties of fluids 4.2 Fluid kinematics 4.3 Fluid continuity with constant density 4.4 Fluid dynamics 4.5 Energy, mechanical work and power Further reading 5 Types of fluid motion 5.1 Osborne Reynolds and flow types 5.2 The distribution of velocity in viscous flows: the boundary layer 5.3 Turbulent flows 5.4 The structure of turbulent shear flows 5.5 Shear flow instabilities, flow separation and secondary currents 5.6 Subcritical and supercritical flows: the Froude number and hydraulic jumps 5.7 Stratified flow generally 5.8 Water waves 5.9 Tidal flow—long-period waves Further reading Part 3: Transporting Sediment Introduction 6 Sediment in fluid and fluid flow—general 6.1 Fall of grains through stationary fluids 6.2 Natural flows carrying particulate material are complex 6.3 Fluids as transporting machines 6.4 Initiation of grain motion 6.5 Paths of grain motion 6.6 Categories of transported sediment 6.7 Some contrasts between wind and water flows 6.8 Cohesive sediment transport and erosion 6.9 A warning: nonequilibrium effects dominate natural sediment transport systems 6.10 Steady state, deposition or erosion: the sediment continuity equation and competence vs. capacity Further reading 7 Bedforms and sedimentary structures in flows and under waves 7.1 Trinity of interaction: turbulent flow, sediment transport and bedform development 7.2 Water-flow bedforms 7.3 Bedform phase diagrams for water flows 7.4 Water flow erosional bedforms on cohesive beds 7.5 Water wave bedforms 7.6 Combined flows: wave-current ripples and hummocky cross-stratification 7.7 Bedforms and structures formed by atmospheric flows Further reading 8 Sediment gravity flows and their deposits 8.1 Introduction 8.2 Granular flows 8.3 Debris flows 8.4 Turbidity flows 8.5 Turbidite evidence for downslope transformation from turbidity to debris flows Further reading 9 Liquefaction, fluidization and sliding sediment deformation 9.1 Liquefaction 9.2 Sedimentary structures formed by and during liquefaction 9.3 Submarine landslides, growth faults and slumps 9.4 Desiccation and synaeresis shrinkage structures Further reading Part 4: Major External Controls on Sedimentation and Sedimentary Environments Introduction 10 Major external controls on sedimentation 10.1 Climate 10.2 Global climates: a summary 10.3 Sea-level changes 10.4 Tectonics 10.5 Sediment yield, denudation rate and the sedimentary record Further reading Part 5: Continental Sedimentary Environments Introduction 11 Rivers 11.1 Introduction 11.2 River networks, hydrographs,patterns and long profiles 11.3 Channel form 11.4 Channel sediment transport processes, bedforms and internal structures 11.5 The floodplain 11.6 Channel belts, alluvial ridges and avulsion 11.7 River channel changes, adjustable variables and equilibrium 11.8 Alluvial architecture: product of complex responses 11.9 Alluvial architecture: scale, controls and time Further reading 12 Subaerial Fans: Alluvial and Colluvial 12.1 Introduction 12.2 Controls on the size (area) and gradient of fans 12.3 Physical processes on alluvial fans 12.4 Debris-flow-dominated alluvial fans 12.5 Stream-flow-dominated alluvial fans 12.6 Recognition of ancient alluvial fans and talus cones Further reading 13 Aeolian Sediments in Low-Latitude Deserts 13.1 Introduction 13.2 Aeolian system state 13.3 Physical processes and erg formation 13.4 Erg margins and interbedform areas 13.5 Erg and draa evolution and sedimentary architecture 13.6 Erg construction, stasis and destruction: climate and sea-level controls 13.7 Ancient desert facies Further reading 14 Lakes 14.1 Introduction 14.2 Lake stratification 14.3 Clastic input by rivers and the effect of turbidity currents 14.4 Wind-forced physical processes 14.5 Temperate lake chemical processes and cycles 14.6 Saline lake chemical processes and cycles 14.7 Biological processes and cycles 14.8 Modern temperate lakes and their sedimentary facies 14.9 Lakes in the East African rifts 14.10 Lake Baikal 14.11 The succession of facies as lakes evolve 14.12 Ancient lake facies Further reading 15 Ice 15.1 Introduction 15.2 Physical processes of ice flow 15.3 Glacier flow, basal lubrication and surges 15.4 Sediment transport, erosion and deposition by flowing ice 15.5 Glacigenic sediment: nomenclature and classification 15.6 Quaternary and modern glacial environments and facies 15.7 Ice-produced glacigenic erosion and depositional facies on land and in the periglacial realm 15.8 Glaciofluvial processes on land at and within the ice-front 15.9 Glacimarine environments 15.10 Glacilacustrine environments 15.11 Glacial facies in the pre-Quaternary geological record: case of Cenozoic Antarctica Further reading Part 6: Marine Sedimentary Environments Introduction 16. Estuaries 16.1 Introduction 16.2 Estuarine dynamics 16.3 Modern estuarine morphology and sedimentary environments 16.4 Estuaries and sequence stratigraphy Further reading 17. River and Fan Deltas 17.1 Introduction to river deltas 17.2 Basic physical processes and sedimentation at the river delta front 17.3 Mass movements and slope failure on the subaqueous delta 17.4 Organic deposition in river deltas 17.5 River delta case histories 17.6 River deltas and sea-level change 17.7 Ancient river delta deposits 17.8 Fan deltas Further reading 18. Linear Siliciclastic Shorelines 18.1 Introduction 18.2 Beach processes and sedimentation 18.3 Barrier-inlet-spit systems and their deposits 18.4 Tidal flats, salt marsh and chenier ridges 18.5 Ancient clastic shoreline facies Further reading 19 Siliciclastic Shelves 19.1 Introduction: shelf sinks and lowstand bypass 19.2 Shelf water dynamics 19.3 Holocene highstand shelf sediments: general 19.4 Tide-dominated, low river input, highstand shelves 19.5 Tide-dominated, high river input, highstand shelves 19.6 Weather-dominated highstand shelves Further reading 20 Calcium-carbonate-evaporite Shorelines, Shelves and Basins 20.1 Introduction: calcium carbonate 'nurseries' and their consequences 20.2 Arid carbonate tidal flats, lagoons and evaporite sabkhas 20.3 Humid carbonate tidal flats and marshes 20.4 Lagoons and bays 20.5 Tidal delta and margin-spillover carbonate tidal sands 20.6 Open-shelf carbonate ramps 20.7 Platform margin reefs and carbonate build-ups 20.8 Platform margin slopes and basins 20.9 Carbonate sediments, cycles and sea-level change 20.10 Displacement and destruction of carbonate environments: silicicl