ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • Books  (390)
  • Online Books  (390)
  • 2010-2014  (325)
  • 1980-1984  (66)
  • 1930-1934  (1)
  • 1925-1929
  • 2011  (203)
  • 2010  (124)
  • 1982  (66)
  • 1928  (1)
Collection
  • Books  (390)
Source
Language
Years
Year
Classification
Branch Library
  • 1
    Call number: PIK 16-89825
    Type of Medium: Monograph available for loan
    Pages: Getr. Zählung , Ill., graph. Darst.
    Edition: Online-Ausg. Berlin Humboldt-Universität zu Berlin, Universitätsbibliothek 2011 〈〈Nach einem Exemplar der Humboldt-Universität zu Berlin, Universitätsbibliothek mit der Signatur: 〉〉Diss Geo11 P134
    Language: German
    Note: Berlin, Humboldt-Univ., Diss., 2011
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    Call number: ISO 50001
    Type of Medium: Non-book medium
    Pages: Online Ressource
    Series Statement: ISO 50001:2011
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 4
    Call number: IASS 16.90013
    Description / Table of Contents: The 2008-10 financial crisis and the global recession it created is a complex phenomenon that warrants detailed examination. The various essays in this book utilise several alternative paradigms to provide a plausible explanation and a credible cure. Great detail is given to this important analysis from different theoretical perspectives, presenting a clearer understanding of what went wrong and expounding misinterpretations of current theories and practices. Fourteen insightful chapters by eminent scholars investigate the background of the crisis and draw lessons for economic theory and polic
    Type of Medium: Monograph available for loan
    Pages: ix, 260 Seiten
    ISBN: 9781849807456 , 1283072130 (ebk) , 9781283072137 (MyiLibrary) , 9781849807463 (electronic) , 1855754827 (print)
    Language: English
    Note: CONTENTS; List of Figures; List of Tables; List of Contributors; Introduction; PART I: ECONOMISTS ON TRIAL; 1. Who predicted the crisis and what can we learn from them? ; 2 A brief note on economic recessions, banking reform and the future of capitalism; 3 Understanding crisis: on the meaning of uncertainty and probability; 4 Financial crisis and risk measurement: the historical perspective and a new methodology; 5 Did economic analysis fail in the current financial crisis?; PART II: WHAT DOES HISTORY TELL US? ; 6 Does the current global crisis remind us of the Great Depression?. , 7 Innovation, growth, cycles and finance: three (or four or more) stories from the 1930s and their lessons8 Epic Recession and economic theory; 9 Did asset prices cause the current crisis?; 10 The role of the history of economic thought in the development of economic theory and policy; PART III: COUNTRY CASES IN A GLOBAL CRISIS; 11. Testimony to the Financial Crisis Inquiry Commission by Alan Greenspan; 12 Long-term depression and new markets: economists and the 2008 recession; 13 Manifestations of the global crisis in a small open economy. , 14 The aftermath of a long decade of real nil interest rates (Spain 1996-2008)Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    Non-book medium
    Non-book medium
    Heidelberg : Spektrum der Wissenschaft Verlagsgesellschaft
    Call number: (OCoLC)838497963
    Type of Medium: Non-book medium
    Pages: Online-Ressource (114 Seiten) , Illustrationen
    Series Statement: Sterne und Weltraum 50.2011,5
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    Monograph available for loan
    Monograph available for loan
    Basingstoke, England : Palgrave Macmillan
    Call number: PIK B 160-16-90200
    Description / Table of Contents: This updated and revised edition outlines strategies and models for how to use technology and knowledge to improve performance, create jobs and increase income. It shows what skills will be required to produce, sell and manage performance over time, and how manual jobs can contribute to reduce the consumption of non-renewable resources
    Type of Medium: Monograph available for loan
    Pages: XXIII, 349 Seiten , graph. Darst.
    Edition: 2nd edition
    ISBN: 0230584667 (hbk.) , 9781349369195 (pbk.) , 9780230584662 (hbk.)
    Language: English
    Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Monograph available for loan
    Monograph available for loan
    University Park, Pa : Pennsylvania State University Press
    Call number: IASS 16.90520
    Description / Table of Contents: "An interdisciplinary study of democratic theory, empirical political science, psychology, and philosophy. Proposes a multidimensional process model of empathy that incorporates both affective and cognitive features to demonstrate the importance of empathy in fulfilling democracy's promise of giving equal consideration to all citizens in collective decisions"--Provided by publisher
    Type of Medium: Monograph available for loan
    Pages: viii, 221 S. , graph. Darst.
    ISBN: 9780271036595 (cloth) , 9780271036601 (pbk)
    Language: English
    Note: The democratic promiseThe deliberative turn in democratic theory -- The elusive concept of empathy -- Empathy in deliberative theory -- Empathy's importance : the empirical evidence -- Deliberative democracy and its critics -- Empathy and democracy..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Call number: 3/S 07.0034(2016)
    In: Annual report
    Type of Medium: Monograph available for loan
    Pages: 51 Seiten
    ISSN: 1865-6439 , 1865-6447
    Parallel Title: Erscheint auch als Annual report ... / Helmholtz Association of German Research Centres
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    Monograph available for loan
    Monograph available for loan
    Paris : OECD
    Call number: PIK P 113-10-0202
    Description / Table of Contents: This joint IEA/NEA report on electricity generating costs presents the latest data available for a wide variety of fuels and technologies, including coal and gas (with and without carbon capture), nuclear, hydro, onshore and offshore wind, biomass, solar, wave and tidal as well as combined heat and power (CHP).  It provides levelised costs of electricity (LCOE) per MWh for almost 200 plants, based on data covering 21 countries (including four major non-OECD countries), and several industrial companies and organisations.  For the first time, the report contains an extensive sensitivit
    Type of Medium: Monograph available for loan
    Pages: 215 S. : graph. Darst.
    ISBN: 9789264084308
    Language: English
    Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Journal available for loan
    Journal available for loan
    Tübingen : Mohr Siebeck ; 1.1884 - 48.1931; N.F. 1.1932/33 - 10.1943/44(1945),3; 11.1948/49(1949) -
    Call number: ZS 22.95039
    Type of Medium: Journal available for loan
    Pages: Online-Ressource
    ISSN: 1614-0974 , 0015-2218 , 0015-2218
    Language: German , English
    Note: N.F. entfällt ab 57.2000. - Volltext auch als Teil einer Datenbank verfügbar , Ersch. ab 2000 in engl. Sprache mit dt. Hauptsacht.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    Call number: 10.1144/GSL.SP.1982.010.01.01
    In: Special publications / the Geological Society, London, Volume 10
    Description / Table of Contents: This book is a collection of papers on an aspect of plate tectonics of which our understanding is at present limited. In the mid-1970s, prior to the recent phase of IPOD active margin drill- ing, few geologists would have anticipated that at the start of the 1980s so many new questions concerning the nature of tectonic and sedimentary processes in forearc regions would have come to light.
    Type of Medium: 12
    Pages: 1 Online-Ressource (VII, 576 Seiten)
    ISBN: 0632007087
    Series Statement: Special publications / the Geological Society, London 10
    Language: English
    Note: Table of Contents Japan The Shimanto Belt of Japan: Cretaceous-lower Miocene active-margin sedimentation A. Taira, H. Okada,J. H. Whitaker, and A. J. Smith https://doi.org/10.1144/GSL.SP.1982.010.01.01 Sedimentation across the Japan Trench off northern Honshu Island Roland von Huene and Michael A. Arthur https://doi.org/10.1144/GSL.SP.1982.010.01.02 Tectonics of some forearc fold belts in and around the arc-arc crossing area in central Japan Yujiro Ogawa https://doi.org/10.1144/GSL.SP.1982.010.01.03 Forearc geological structure of the Japanese Islands Tsunemasa Shiki and Yoshibumi Misawa https://doi.org/10.1144/GSL.SP.1982.010.01.04 Central America Facies belts of the Middle America Trench and forearc region, southern Mexico: results from Leg 66 DSDP J. Casey Moore, Joel S. Watkins, Kenneth J. McMillen, Stephen B. Bachman, Jeremy K. Leggett, Neil Lundberg, Thomas H. Shipley, Jean-Francois Stephan, Floyd W. Beghtel, Arif Butt, Borys M. Didyk, Nobuaki Niitsuma, Les E. Shephard, and Herbert Stradner https://doi.org/10.1144/GSL.SP.1982.010.01.05 Tectonic processes along the Middle America Trench inner slope Thomas H. Shipley, John W. Ladd, Richard T. Buffler, and Joel S. Watkins https://doi.org/10.1144/GSL.SP.1982.010.01.06 Sedimentation in different tectonic environments of the Middle America Trench, southern Mexico and Guatemala Kenneth J. McMillen, Robert H. Enkeboll, J. Casey Moore, Thomas H. Shipley, and John W. Ladd https://doi.org/10.1144/GSL.SP.1982.010.01.07 A summary of Deep Sea Drilling Project Leg 67 shipboard results from the Mid-America Trench transect off Guatemala Roland von Huene, Jean Aubouin, Jacques Azema, Grant Blackinton, Jerry A. Carter, William T. Coulbourn, Darrel S. Cowan, Joseph A. Curiale, Carlos A. Dengo, Richard W. Faas, William Harrison, Reinhard Hesse, Donald M. Hussong, John W. Ladd, … View all authors https://doi.org/10.1144/GSL.SP.1982.010.01.08 Evolution of the slope landward of the Middle America Trench, Nicoya Peninsula, Costa Rica Neil Lundberg https://doi.org/10.1144/GSL.SP.1982.010.01.9 South America Cenozoic structure, stratigraphy and tectonics of the central Peru forearc L. D. Kulm, T. M. Thornburg, and H.-J. Schrader J. M. Resig https://doi.org/10.1144/GSL.SP.1982.010.01.10 Forearc and other basins, continental margin of northern and southern Peru and adjacent Ecuador and Chile R. Moberly, G. L. Shepherd, and W. T. Coulbourn https://doi.org/10.1144/GSL.SP.1982.010.01.11 The geology of the western part of the Borbón Basin, North-west Ecuador C. D. R. Evans and J. E. Whittaker https://doi.org/10.1144/GSL.SP.1982.010.01.12 Aleutians Ancient plate boundaries in the Bering Sea region M. S. Marlow, A. K. Cooper, D. W. Scholl, and H. McLean https://doi.org/10.1144/GSL.SP.1982.010.01.13 The Chugach Terrane, a Cretaceous trench-fill deposit, southern Alaska Tor H. Nilsen and Gian G. Zuffa https://doi.org/10.1144/GSL.SP.1982.010.01.14 Structural evolution of coherent terranes in the Ghost Rocks Formation, Kodiak Island, Alaska Tim Byrne https://doi.org/10.1144/GSL.SP.1982.010.01.15 Asia and Australasia Sedimentation in the Sunda Trench and forearc region Gregory F. Moore, Joseph R. Curray, and Frans J. Emmel https://doi.org/10.1144/GSL.SP.1982.010.01.16 Development of the North Island Subduction System, New Zealand Gerrit J. van der Lingen https://doi.org/10.1144/GSL.SP.1982.010.01.17 Atlantic The Barbados Ridge Complex: tectonics of a mature forearc system G. K. Westbrook https://doi.org/10.1144/GSL.SP.1982.010.01.18 Sedimentology and structure of the Scotland Group, Barbados C. J. Pudsey and H. G. Reading https://doi.org/10.1144/GSL.SP.1982.010.01.19 Subduction and tectonics on the continental margin off northern Spain: observations with the submersible Cyana Jacques-André Malod, Gilbert Boillot, Claude Lepvier, Georges Mascle, and Josette Taugourdeau-Lantz Raymond Capdevila, Pierre-Alain Dupeuble, and Carla Müller https://doi.org/10.1144/GSL.SP.1982.010.01.20 Mediterranean Subduction in the Hellenic Trench: probable role of a thick evaporitic layer based on Seabeam and submersible studies X. Le Pichon, P. Huchon, J. Angelier, N. Lybéris, J. Boulin, and D. Bureau J.P. Cadet, J. Dercourt, G. Glaçon, H. Got, D. Karig, J. Mascle, L.E. Ricou, and F. Thiebault https://doi.org/10.1144/GSL.SP.1982.010.01.21 Detailed tectonic trends on the central part of the Hellenic Outer Ridge and in the Hellenic Trench System N. H. Kenyon, R. H. Belderson, and A. H. Stride https://doi.org/10.1144/GSL.SP.1982.010.01.22 The structure of the Calabro-Sicilian Arc: result of a post-orogenic intra-plate deformation Forese Carlo Wezel https://doi.org/10.1144/GSL.SP.1982.010.01.23 Makran of Iran and Pakistan Deformation of the Makran accretionary sediment prism in the Gulf of Oman (north-west Indian Ocean) Robert S. White https://doi.org/10.1144/GSL.SP.1982.010.01.24 The Late Cretaceous-Cenozoic history of western Baluchistan Pakistan—the northern margin of the Makran subduction complex Russell S. Arthurton, Abul Farah, and Wahiduddin Ahmed https://doi.org/10.1144/GSL.SP.1982.010.01.25 The Makran, Southeastern Iran: the anatomy of a convergent plate margin active from Cretaceous to Present G. J. H. McCall and R. G. W. Kidd https://doi.org/10.1144/GSL.SP.1982.010.01.26 California The Coastal Belt of the Franciscan: youngest phase of northern California subduction Steven B. Bachman https://doi.org/10.1144/GSL.SP.1982.010.01.27 The Franciscan Complex of northernmost California: sedimentation and tectonics K. R. Aalto https://doi.org/10.1144/GSL.SP.1982.010.01.28 Sedimentation, metamorphism and tectonic accretion of the Franciscan assemblage of northern California M. C. Blake, Jr, A. S. Jayko, and D. G. Howell https://doi.org/10.1144/GSL.SP.1982.010.01.29 Deformation of partly dewatered and consolidated Franciscan sediments near Piedras Blancas Point, California Darrel S. Cowan https://doi.org/10.1144/GSL.SP.1982.010.01.30 Initiation and evolution of the Great Valley forearc basin of northern and central California, U.S.A. Raymond V. Ingersoll https://doi.org/10.1144/GSL.SP.1982.010.01.31 Forearc Terranes in Orogenic Belts Cretaceous-Palaeogene Flysch Zone of the East Alps and Carpathians: identification and plate-tectonic significance of ‘dormant’ and ‘active’ deep-sea trenches in the Alpine-Carpathian Arc Reinhard Hesse https://doi.org/10.1144/GSL.SP.1982.010.01.32 The anatomy of a Lower Palaeozoic accretionary forearc: the Southern Uplands of Scotland J. K. Leggett W. S. McKerrow and D. M. Casey https://doi.org/10.1144/GSL.SP.1982.010.01.33 Sedimentology, volcanism, structure and metamorphism of the northern margin of a Lower Palaeozoic accretionary complex; Bail Hill-Abington area of the Southern Uplands of Scotland Barry C. Hepworth, Grahame J. H. Oliver, and Michael J. McMurtry https://doi.org/10.1144/GSL.SP.1982.010.01.34 Facies, Petrology and Models Sedimentary facies associations within subduction complexes Michael B. Underwood and Steven B. Bachman https://doi.org/10.1144/GSL.SP.1982.010.01.35 Composition of modern deep-sea sands from arc-related basins J. Barry Maynard, Renzo Valloni, and Ho-Shing Yu https://doi.org/10.1144/GSL.SP.1982.010.01.36 Initiation of subduction zones: implications for arc evolution and ophiolite development D. E. Karig https://doi.org/10.1144/GSL.SP.1982.010.01.37
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: IASS 16.89972
    Description / Table of Contents: "The scale, effectiveness and legitimacy of global governance lag far behind the world's needs. This path-breaking book examines how far civil society involvement provides an answer to these problems. Does civil society make global governance more democratic? Have citizen action groups raised the accountability of global bodies that deal with challenges such as climate change, financial crises, conflict, disease and inequality? What circumstances have promoted (or blocked) civil society efforts to make global governance institutions more democratically accountable? What could improve these outcomes in the future? The authors base their argument on studies of thirteen global institutions, including the UN, G8, WTO, ICANN and IMF. Specialists from around the world critically assess what has and has not worked in efforts to make global bodies answer to publics as well as states. Combining intellectual depth and political relevance, Building Global Democracy? will appeal to students, researchers, activists and policymakers"--
    Type of Medium: Monograph available for loan
    Pages: xxv, 397 S.
    ISBN: 9780521140553
    Language: English
    Note: Machine generated contents note: Introduction Jan Aart Scholte; 1. Global governance, accountability and civil society Jan Aart Scholte; 2. Civil society and accountability of the United Nations Kerstin Martens; 3. The World Bank and democratic accountability: the role of civil society Alnoor Ebrahim and Steven Herz; 4. Civil society and IMF accountability Jan Aart Scholte; 5. Civil society and the WTO: contesting accountability Marc Williams; 6. Civil society and accountability in the Commonwealth Timothy M. Shaw and Pamela K. Mbabazi; 7. The organisation of the Islamic conference, accountability and civil society Saied Reza Ameli; 8. Civil society and patterns of accountability in the OECD Morten Ougaard; 9. Civil society and G8 accountability Peter I. Hajnal; 10. Structuring accountability: the Asia-Europe meeting Julie Gilson; 11. Civil society and accountability in global governance of climate change Peter Newell; 12. Civil society and accountability promotion in the global fund Carolyn Long and Nata Duvvury; 13. Accountability in private global governance: ICANN and civil society Mawaki Chango; 14. Civil society and the World Fair Trade Organisation: developing responsive accountability Heidi Ullrich; Conclusion Jan Aart Scholte..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 13
    Monograph available for loan
    Monograph available for loan
    Princeton [u.a.] : Princeton University Press
    Call number: PIK O 071-16-89977
    Description / Table of Contents: For epidemiologists, evolutionary biologists, and health-care professionals, real-time and predictive modeling of infectious disease is of growing importance. This book provides a timely and comprehensive introduction to the modeling of infectious diseases in humans and animals, focusing on recent developments as well as more traditional approaches. Matt Keeling and Pejman Rohani move from modeling with simple differential equations to more recent, complex models, where spatial structure, seasonal ""forcing,"" or stochasticity influence the dynamics, and where computer simulation needs to
    Type of Medium: Monograph available for loan
    Pages: XI, 366 Seiten , graph. Darst.
    ISBN: 9780691116174
    Language: English
    Note: ""Cover""; ""Contents""; ""Acknowledgments""; ""Chapter 1 Introduction""; ""1.1 Types of Disease""; ""1.2 Characterization of Diseases""; ""1.3 Control of Infectious Diseases""; ""1.4 What Are Mathematical Models?""; ""1.5 What Models Can Do""; ""1.6 What Models Cannot Do""; ""1.7 What Is a Good Model?""; ""1.8 Layout of This Book""; ""1.9 What Else Should You Know?""; ""Chapter 2 Introduction to Simple Epidemic Models""; ""2.1 Formulating the Deterministic SIR Model""; ""2.1.1 The SIR Model Without Demography""; ""2.1.1.1 The Threshold Phenomenon""; ""2.1.1.2 Epidemic Burnout"". , ""2.1.1.3 Worked Example: Influenza in a Boarding School""""2.1.2 The SIR Model With Demography""; ""2.1.2.1 The Equilibrium State""; ""2.1.2.2 Stability Properties""; ""2.1.2.3 Oscillatory Dynamics""; ""2.1.2.4 Mean Age at Infection""; ""2.2 Infection-Induced Mortality and SI Models""; ""2.2.1 Mortality Throughout Infection""; ""2.2.1.1 Density-Dependent Transmission""; ""2.2.1.2 Frequency Dependent Transmission""; ""2.2.2 Mortality Late in Infection""; ""2.2.3 Fatal Infections""; ""2.3 Without Immunity: The SIS Model""; ""2.4 Waning Immunity: The SIRS Model"". , ""2.5 Adding a Latent Period: The SEIR Model""""2.6 Infections with a Carrier State""; ""2.7 Discrete-Time Models""; ""2.8 Parameterization""; ""2.8.1 Estimating R[sub(0)] from Reported Cases""; ""2.8.2 Estimating R[sub(0)] from Seroprevalence Data""; ""2.8.3 Estimating Parameters in General""; ""2.9 Summary""; ""Chapter 3 Host Heterogeneities""; ""3.1 Risk-Structure: Sexually Transmitted Infections""; ""3.1.1 Modeling Risk Structure""; ""3.1.1.1 High-Risk and Low-Risk Groups""; ""3.1.1.2 Initial Dynamics""; ""3.1.1.3 Equilibrium Prevalence""; ""3.1.1.4 Targeted Control"". , ""3.1.1.5 Generalizing the Model""""3.1.1.6 Parameterization""; ""3.1.2 Two Applications of Risk Structure""; ""3.1.2.1 Early Dynamics of HIV""; ""3.1.2.2 Chlamydia Infections in Koalas""; ""3.1.3 Other Types of Risk Structure""; ""3.2 Age-Structure: Childhood Infections""; ""3.2.1 Basic Methodology""; ""3.2.1.1 Initial Dynamics""; ""3.2.1.2 Equilibrium Prevalence""; ""3.2.1.3 Control by Vaccination""; ""3.2.1.3 Parameterization""; ""3.2.2 Applications of Age Structure""; ""3.2.2.1 Dynamics of Measles""; ""3.2.2.2 Spread and Control of BSE""; ""3.3 Dependence on Time Since Infection"". , ""3.3.1 SEIR and Multi-Compartment Models""""3.3.2 Models with Memory""; ""3.3.3 Application: SARS""; ""3.4 Future Directions""; ""3.5 Summary""; ""Chapter 4 Multi-Pathogen/Multi-Host Models""; ""4.1 Multiple Pathogens""; ""4.1.1 Complete Cross-Immunity""; ""4.1.1.1 Evolutionary Implications""; ""4.1.2 No Cross-Immunity""; ""4.1.2.1 Application: The Interaction of Measles and Whooping Cough""; ""4.1.2.2 Application: Multiple Malaria Strains""; ""4.1.3 Enhanced Susceptibility""; ""4.1.4 Partial Cross-Immunity""; ""4.1.4.1 Evolutionary Implications"". , ""4.1.4.2 Oscillations Driven by Cross-Immunity"".
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 14
    Monograph available for loan
    Monograph available for loan
    Cambridge, Mass. [u.a.] : MIT Press
    Call number: PIK B 020-16-89772
    Type of Medium: Monograph available for loan
    Pages: XXVII, 1064 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 0262232588 (hbk.) , 9780262232586
    Language: English
    Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Monograph available for loan
    Monograph available for loan
    Princeton and Oxford : Princeton University Press,
    Call number: M 17.90645
    Description / Table of Contents: Cover; Title; Copyright; Contents; List of Illustrations; Preface; PART ONE: What Has Controlled Earth's Climate?; CHAPTER ONE: Climate and Human History; PART TWO: Nature in Control; CHAPTER TWO: Slow Going for a Few Million Years; CHAPTER THREE: Linking Earth's Orbit to Its Climate; CHAPTER FOUR: Orbital Changes Control Ice-Age Cycles; CHAPTER FIVE: Orbital Changes Control Monsoon Cycles; CHAPTER SIX: Stirrings of Change; PART THREE: Humans Begin to Take Control; CHAPTER SEVEN: Early Agriculture and Civilization; CHAPTER EIGHT: Taking Control of Methane
    Description / Table of Contents: CHAPTER NINE: Taking Control of CO[sub(2)]CHAPTER TEN: Have We Delayed a Glaciation?; CHAPTER ELEVEN: Challenges and Responses; PART FOUR: Disease Enters the Picture; CHAPTER TWELVE: But What about Those CO[sub(2)] "Wiggles"?; CHAPTER THIRTEEN: The Horsemen of the Apocalypse: Which One?; CHAPTER FOURTEEN: Pandemics, CO[sub(2)], and Climate; PART FIVE: Humans in Control; CHAPTER FIFTEEN: Greenhouse Warming: Tortoise and Hare; CHAPTER SIXTEEN: Future Warming: Large or Small?; CHAPTER SEVENTEEN: From the Past into the Distant Future; EPILOGUE; CHAPTER EIGHTEEN: Global-Change Science and Politics
    Description / Table of Contents: CHAPTER NINETEEN: Consuming Earth's GiftsAfterword to the Princeton Science Library Edition; Bibliography; Figure Sources; Index; A; B; C; D; E; F; G; H; I; K; L; M; N; O; P; R; S; T; U; V; W; Y
    Description / Table of Contents: The impact on climate from 200 years of industrial development is an everyday fact of life, but did humankind''s active involvement in climate change really begin with the industrial revolution, as commonly believed? Plows, Plagues, and Petroleum has sparked lively scientific debate since it was first published--arguing that humans have actually been changing the climate for some 8,000 years--as a result of the earlier discovery of agriculture. The ""Ruddiman Hypothesis"" will spark intense debate. We learn that the impact of farming on greenhouse-gas levels, thousands of years before the i
    Type of Medium: Monograph available for loan
    Pages: xiv, 226 Seiten , Illustrationen
    Edition: New Princeton Science Library edition
    ISBN: 9780691173214
    Series Statement: Princeton Science Library
    Classification:
    Meteorology and Climatology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    facet.materialart.12
    Berlin, New York : De Gruyter Saur
    Call number: 9783110232103 (e-book)
    Description / Table of Contents: With the term "Library 2.0" the editors mean an institution which applies the principles of the Web 2.0 such as openness, re-use, collaboration and interaction in the entire organization. Libraries are extending their service offerings and work processes to include the potential of Web 2.0 technologies. This changes the job description and self-image of librarians. The collective volume offers a complete overview of the topic Library 2.0 and the current state of developments from a technological, sociological, information theoretical and practice-oriented perspective
    Type of Medium: 12
    Pages: 1 Online-Ressource (1 electronic resource (xii, 392 p.))
    Edition: Online-Ausg.
    ISBN: 9783110232103 , 9783110232097
    Series Statement: Bibliotheks- und Informationspraxis 41
    Language: Undetermined
    Note: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
    facet.materialart.12
    facet.materialart.12
    Bremerhaven : Alfred-Wegener-Inst. für Polar- und Meeresforschung
    Associated volumes
    Call number: ZSP-168-631
    In: Berichte zur Polar- und Meeresforschung
    Description / Table of Contents: ANT-XXVI/4: 7 April -17 May 2010 Punta Arenas -Mindelo - Las Palmas - Bremerhaven
    Type of Medium: 12
    Pages: Online-Ressource
    Series Statement: Berichte zur Polar- und Meeresforschung 631
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 18
    facet.materialart.12
    Chichester, [England] : Wiley
    Call number: 9781444328479 (e-book)
    Type of Medium: 12
    Pages: 1 Online-Ressource (XIII, 768 Seiten) , Illustrationen
    Edition: Second edition
    ISBN: 9781444328479 (e-book) , 978-1-4443-2847-9
    Language: English
    Note: Contents Contents Preface Acknowledgements Part 1: Making Sediment Introduction Clastic sediment as a chemical and physical breakdown product 1.1 Introduction: clastic sediments—'accidents' of weathering 1.2 Silicate minerals and chemical weathering 1.3 Solute flux: rates and mechanisms of silicate chemical weathering 1.4 Physical weathering 1.5 Soils as valves and filters for the natural landscape 1.6 Links between soil age, chemical weathering and weathered-rock removal 1.7 Provenance: siliciclastic sediment-sourcing Further reading 2 Carbonate, siliceous, iron-rich and evaporite sediments 2.1 Marine vs. freshwater chemical composition and fluxes 2.2 The calcium carbonate system in the oceans 2.3 Ooid carbonate grains 2.4 Carbonate grains from marine plants and animals 2.5 Carbonate muds, oozes and chalks 2.6 Other carbonate grains of biological origins 2.7 Organic productivity, sea-level and atmospheric controls of biogenic CaCO3 deposition rates 2.8 CaCO3 dissolution in the deep ocean and the oceanic CaCO3 compensation mechanism 2.9 The carbonate system on land 2.10 Evaporite salts and their inorganic precipitation as sediment 2.11 Silica and pelagic plankton 2.12 Iron minerals and biomineralizers 2.13 Desert varnish 2.14 Phosphates 2.15 Primary microbial-induced sediments: algal mats and stromatolites Further reading 3 Sediment grain properties 3.1 General 3.2 Grain size 3.3 Grain-size distributions 3.4 Grain shape and form 3.5 Bulk properties of grain aggregates Further reading Part 2: Moving Fluid Introduction 4 Fluid basics 4.1 Material properties of fluids 4.2 Fluid kinematics 4.3 Fluid continuity with constant density 4.4 Fluid dynamics 4.5 Energy, mechanical work and power Further reading 5 Types of fluid motion 5.1 Osborne Reynolds and flow types 5.2 The distribution of velocity in viscous flows: the boundary layer 5.3 Turbulent flows 5.4 The structure of turbulent shear flows 5.5 Shear flow instabilities, flow separation and secondary currents 5.6 Subcritical and supercritical flows: the Froude number and hydraulic jumps 5.7 Stratified flow generally 5.8 Water waves 5.9 Tidal flow—long-period waves Further reading Part 3: Transporting Sediment Introduction 6 Sediment in fluid and fluid flow—general 6.1 Fall of grains through stationary fluids 6.2 Natural flows carrying particulate material are complex 6.3 Fluids as transporting machines 6.4 Initiation of grain motion 6.5 Paths of grain motion 6.6 Categories of transported sediment 6.7 Some contrasts between wind and water flows 6.8 Cohesive sediment transport and erosion 6.9 A warning: nonequilibrium effects dominate natural sediment transport systems 6.10 Steady state, deposition or erosion: the sediment continuity equation and competence vs. capacity Further reading 7 Bedforms and sedimentary structures in flows and under waves 7.1 Trinity of interaction: turbulent flow, sediment transport and bedform development 7.2 Water-flow bedforms 7.3 Bedform phase diagrams for water flows 7.4 Water flow erosional bedforms on cohesive beds 7.5 Water wave bedforms 7.6 Combined flows: wave-current ripples and hummocky cross-stratification 7.7 Bedforms and structures formed by atmospheric flows Further reading 8 Sediment gravity flows and their deposits 8.1 Introduction 8.2 Granular flows 8.3 Debris flows 8.4 Turbidity flows 8.5 Turbidite evidence for downslope transformation from turbidity to debris flows Further reading 9 Liquefaction, fluidization and sliding sediment deformation 9.1 Liquefaction 9.2 Sedimentary structures formed by and during liquefaction 9.3 Submarine landslides, growth faults and slumps 9.4 Desiccation and synaeresis shrinkage structures Further reading Part 4: Major External Controls on Sedimentation and Sedimentary Environments Introduction 10 Major external controls on sedimentation 10.1 Climate 10.2 Global climates: a summary 10.3 Sea-level changes 10.4 Tectonics 10.5 Sediment yield, denudation rate and the sedimentary record Further reading Part 5: Continental Sedimentary Environments Introduction 11 Rivers 11.1 Introduction 11.2 River networks, hydrographs,patterns and long profiles 11.3 Channel form 11.4 Channel sediment transport processes, bedforms and internal structures 11.5 The floodplain 11.6 Channel belts, alluvial ridges and avulsion 11.7 River channel changes, adjustable variables and equilibrium 11.8 Alluvial architecture: product of complex responses 11.9 Alluvial architecture: scale, controls and time Further reading 12 Subaerial Fans: Alluvial and Colluvial 12.1 Introduction 12.2 Controls on the size (area) and gradient of fans 12.3 Physical processes on alluvial fans 12.4 Debris-flow-dominated alluvial fans 12.5 Stream-flow-dominated alluvial fans 12.6 Recognition of ancient alluvial fans and talus cones Further reading 13 Aeolian Sediments in Low-Latitude Deserts 13.1 Introduction 13.2 Aeolian system state 13.3 Physical processes and erg formation 13.4 Erg margins and interbedform areas 13.5 Erg and draa evolution and sedimentary architecture 13.6 Erg construction, stasis and destruction: climate and sea-level controls 13.7 Ancient desert facies Further reading 14 Lakes 14.1 Introduction 14.2 Lake stratification 14.3 Clastic input by rivers and the effect of turbidity currents 14.4 Wind-forced physical processes 14.5 Temperate lake chemical processes and cycles 14.6 Saline lake chemical processes and cycles 14.7 Biological processes and cycles 14.8 Modern temperate lakes and their sedimentary facies 14.9 Lakes in the East African rifts 14.10 Lake Baikal 14.11 The succession of facies as lakes evolve 14.12 Ancient lake facies Further reading 15 Ice 15.1 Introduction 15.2 Physical processes of ice flow 15.3 Glacier flow, basal lubrication and surges 15.4 Sediment transport, erosion and deposition by flowing ice 15.5 Glacigenic sediment: nomenclature and classification 15.6 Quaternary and modern glacial environments and facies 15.7 Ice-produced glacigenic erosion and depositional facies on land and in the periglacial realm 15.8 Glaciofluvial processes on land at and within the ice-front 15.9 Glacimarine environments 15.10 Glacilacustrine environments 15.11 Glacial facies in the pre-Quaternary geological record: case of Cenozoic Antarctica Further reading Part 6: Marine Sedimentary Environments Introduction 16. Estuaries 16.1 Introduction 16.2 Estuarine dynamics 16.3 Modern estuarine morphology and sedimentary environments 16.4 Estuaries and sequence stratigraphy Further reading 17. River and Fan Deltas 17.1 Introduction to river deltas 17.2 Basic physical processes and sedimentation at the river delta front 17.3 Mass movements and slope failure on the subaqueous delta 17.4 Organic deposition in river deltas 17.5 River delta case histories 17.6 River deltas and sea-level change 17.7 Ancient river delta deposits 17.8 Fan deltas Further reading 18. Linear Siliciclastic Shorelines 18.1 Introduction 18.2 Beach processes and sedimentation 18.3 Barrier-inlet-spit systems and their deposits 18.4 Tidal flats, salt marsh and chenier ridges 18.5 Ancient clastic shoreline facies Further reading 19 Siliciclastic Shelves 19.1 Introduction: shelf sinks and lowstand bypass 19.2 Shelf water dynamics 19.3 Holocene highstand shelf sediments: general 19.4 Tide-dominated, low river input, highstand shelves 19.5 Tide-dominated, high river input, highstand shelves 19.6 Weather-dominated highstand shelves Further reading 20 Calcium-carbonate-evaporite Shorelines, Shelves and Basins 20.1 Introduction: calcium carbonate 'nurseries' and their consequences 20.2 Arid carbonate tidal flats, lagoons and evaporite sabkhas 20.3 Humid carbonate tidal flats and marshes 20.4 Lagoons and bays 20.5 Tidal delta and margin-spillover carbonate tidal sands 20.6 Open-shelf carbonate ramps 20.7 Platform margin reefs and carbonate build-ups 20.8 Platform margin slopes and basins 20.9 Carbonate sediments, cycles and sea-level change 20.10 Displacement and destruction of carbonate environments: silicicl
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 19
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 20
  • 21
    Keywords: nuclear explosion monitoring ; nuclear test ban ; seismology ; acoustics
    Description / Table of Contents: This topical volume focuses on the most recent advances that have been achieved in relevant fields of research of nuclear test ban monitoring, including seismology, infrasound- and hydro-acoustics, as well as nuclear physics and atmospheric backtracking. This research has been presented during the special sessions on "Research and Development in Nuclear Explosion Monitoring" convened during the 2007 and 2008 General Assemblies of the European Geosciences Union (EGU). The special sessions were introduced after the Preparatory Commission for the Comprehensive Nuclear Test-Ban Treaty Organization (CTBTO Prepcom) had convened a scientific symposium in 2006 on "CTBT: Synergies with Science 1996-2006 and beyond" marking the tenth anniversary of the United Nations General Assembly’s adoption of the CTBT Treaty. With regard to the seismo-acoustic fields several papers provide important updates on advances made in these fields since publication of ‘Monitoring the Comprehensive Nuclear-Test-Ban Treaty’ (see PAGEOPH topical volumes 158-159, 2001-2002). Moreover, this topical volume expands on these publications by including radionuclide and noble gas monitoring, as well as atmospheric transport modeling. In these two areas, significant progress has been made in recent years. Two papers studying the 2006 North Korean nuclear test elucidate how progress made in the relevant fields has allowed for a good understanding on the characteristics of this underground nuclear test.
    Pages: Online-Ressource (246 Seiten)
    ISBN: 9783034603706
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    Keywords: poverty reduction ; governance ; social justice ; energy efficiency ; social protection ; vulnerability ; climate ; climate change ; global warming ; emissions ; carbon ; equity ; renewable energy ; forest
    Description / Table of Contents: Climate change is arguably the most profound challenge facing the international community in the 21st century. It is as much a challenge for poverty reduction, growth, and development as it is a global environmental issue. Climate change could undermine or reverse progress in reducing poverty and attaining the Millennium Development Goals, thereby unraveling many of the development gains of recent decades. It already threatens the livelihoods, health, and well-being of millions of people worldwide, particularly the poorest, most vulnerable groups. This book focuses attention on these previously neglected and poorly understood social dimensions of climate change. It highlights equity and vulnerability as central organizing themes and illustrates the multiple ways that pro-poor climate policy and action should be integrated into existing approaches to poverty reduction and development—from the local to the global levels. This integration is needed both in terms of pro-poor approaches to climate change adaptation and in terms of better managing the social risks and potential benefits associated with measures to reduce greenhouse gas emissions.
    Pages: Online-Ressource (XXIII, 319 Seiten)
    ISBN: 9780821381427
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
    Keywords: greenhouse gas emission reduction ; energy consumption ; bus ; greenhouse gas emission ; rapid transit ; pedestrian ; pedestrian pathway ; climate change ; transportation network ; road pricing ; emission ; urban transportation ; travel demand ; rebates ; greenhouse gas ; road ; transport ; transport sector ; transit ; travel demand management
    Description / Table of Contents: The Eco2 Cities approach is a point of departure for cities that would like to reap the many benefits of ecological and economic sustainability. It provides an analytical and operational framework that offers strategic guidance to cities on sustainable and integrated urban development. At the same time case studies are used throughout the book to provide a matter-of-fact and ground-level perspective. The Eco2 framework is flexible and easily customized to the context of each country or city. Based on the particular circumstances and the development priorities of a city - the application of the framework can contribute to the development of a unique action plan or roadmap in each case. This action plan can be triggered through catalyst projects.To support this framework, the book also begins to introduce some powerful and practical methods and tools that can further enable sustainable and integrated city planning and decision making. These include 1) operational and process methods that can strengthen collaborative decision making and cross-sector synergies in a city; 2) analytical methods ranging from diagnostics, simulation, design and scenario-generation; and 3) accounting and benchmarking methods which can help clarify, define and measure what it means to truly invest in sustainability and resilience.As additional reference reading, the book also features a series of case studies from best practice cities around the world, each demonstrating a very different dimension of the Eco2 approach. It also features a series of infrastructure sector notes (on spatial development, transport, energy, water and waste management), each of which explore sector specific issues as they pertain to urban development, and the many opportunities for coordination and integration across sectors.
    Pages: Online-Ressource (XXVIII, 358 Seiten)
    ISBN: 9780821381441
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 24
    Description / Table of Contents: This volume combines original data in various fields from the offshore Levant Basin and adjacent continental slopes and platforms. The first group of papers document the tectonic structures and sedimentological patterns associated with the development of the Levant Basin. They identify the successive rifting events from the Late Palaeozoic to the Early Cretaceous, followed by a moderate tectonic activity. The contribution of external factors like global sea-level and climate changes to the sedimentation processes during the Mid-Cretaceous is discussed in the second set of papers. The final group presents new kinematics and age constraints on the Late Cretaceous to Neogene tectonic phases and discusses the relationship of the structures with the closure of the Neo-Tethys and separation of the Arabia plate. This collection of research papers demonstrates new concepts on the opening and crustal thinning of the Levant Basin and gives updated interpretations of the latter tectonic structures of the Levant.
    Pages: Online-Ressource (VII, 338 Seiten)
    ISBN: 9781862393066
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Description / Table of Contents: The discovery of dinosaurs and other large extinct ‘saurians’ - a term under which the Victorians commonly lumped ichthyosaurs, plesiosaurs, pterosaurs and their kin - makes exciting reading and has caught the attention of palaeontologists, historians of science and the general public alike. The papers in this collection go beyond the familiar tales about famous ‘fossil hunters’ and focus on relatively little-known episodes in the discovery and interpretation (from both a scientific and an artistic point of view) of dinosaurs and other inhabitants of the Mesozoic world. They cover a long time span, from the beginnings of ‘modern’ scientific palaeontology in the 1700s to the present, and deal with many parts of the world, from the Yorkshire coast to Central India, from Bavaria to the Sahara. The characters in these stories include professional palaeontologists and geologists (some of them well-known, others quite obscure), explorers, amateur fossil collectors, and artists, linked together by their interest in Mesozoic creatures.
    Pages: Online-Ressource (394 Seiten)
    ISBN: 9781862393110
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    Description / Table of Contents: The invasion of the land by plants (‘terrestrialization’) was one of the most significant evolutionary events in the history of life on Earth, and correlates in time with periods of major palaeoenvironmental perturbations. The development of a vegetation cover on the previously barren land surfaces impacted on the global biogeochemical cycles and the geological processes of erosion and sediment transport. The terrestrialization of plants preceded the rise of major new groups of animals, such as insects and tetrapods, the latter numbering some 24 000 living species, including ourselves. Early land-plant evolution also correlates with the most spectacular decline of atmospheric CO2 concentration of Phanerozoic times and with the onset of a protracted period of glacial conditions on Earth. This book includes a selection of papers covering different aspects of the terrestrialization, from palaeobotany to vertebrate palaeontology and geochemistry, promoting a multidisciplinary approach to the understanding of the co-evolution of life and its environments during Early to Mid-Palaeozoic times.
    Pages: Online-Ressource (187 Seiten)
    ISBN: 9781862393097
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Description / Table of Contents: Several different databases and models have been developed over many years of petrological study carried out by several European and non-European groups on mantle xenoliths, peridotite massifs, ophiolites and mafic magmas spanning in age from Archaean to Recent times. This volume aims to bring together these different approaches and to integrate the geochemical perceptions of the European upper mantle. The papers include regional petrological studies of the European lithospheric mantle, from Spain to the Pannonian Basin, from Corsica and Serbia as far north as Svalbard. Six contributions are based on studies of mantle xenoliths, while the remaining three deal with ophiolitic and peridotitic complexes. A further article provides an update on the textural classification of mantle rocks using a computer-aided approach and there is an introductory overview.
    Pages: Online-Ressource (246 Seiten)
    ISBN: 9781862393042
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    Description / Table of Contents: The world's mountain ranges are the clearest manifestations of long-term deformation of the continental crust. As such they have attracted geological investigations for centuries. Throughout this long history of research a few keynote publications stand out. One of the most important is the Geological Survey's 1907 Memoir on The Geological Structure of the North-West Highlands of Scotland. The Memoir summarized some of the Geological Survey's finest work, and outlined many of the principles of field-based structural and tectonic analysis that have subsequently guided generations of geologists working in other mountain belts, both ancient and modern. The thematic set of 32 papers in this Special Publication celebrate the 100th anniversary of the 1907 Memoir by placing the original findings in both historical and modern contexts, and juxtaposing them against present-day studies of deformation processes operating not only in the NW Highlands, but also in other mountain belts.
    Pages: Online-Ressource (VII, 872 Seiten)
    ISBN: 9781862393004
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
    Keywords: licensing of petroleum exploration, development and production rights ; petroleum licensing rounds ; petroleum exploration ; allocation of petroleum exploration, development and production rights ; maximization of petroleum rent ; fiscal systems for hydrocarbons ; design of petroleum allocation systems ; petroleum policy ; petroleum depletion policy ; auctions of petroleum rights
    Description / Table of Contents: Governments often pursue a variety of economic, social and political objectives through their allocation policies that go beyond the maximization of the net present value of the economic rent. The optimal allocation policy depends on a range of country specific and exogenous factors. Despite the variety of factors influencing optimal design, most countries use similar solutions. In particular, when auctions or administrative procedures are used, most governments opt for simple simultaneous multi-object sealed-bid rounds. While this may appear to be paradoxical, there is a practical explanation. It is true that more complex bidding forms might increase rent capture at bidding. However, the potential marginal gain is often limited, owing to most E&P projects’ high level of uncertainty and risk. In addition market mechanisms, such as joint bidding and secondary markets, and the fiscal regime are widely used in the petroleum sector to correct inefficiency at the time of allocation.
    Pages: Online-Ressource (XIV, 106 Seiten)
    ISBN: 9780821381687
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 30
    Unknown
    Berlin, New York : De Gruyter Saur
    Description / Table of Contents: Unter Bibliothek 2.0 verstehen die Herausgeber eine Einrichtung, die die Prinzipien des Web 2.0 wie Offenheit, Wiederverwendung (ReUse), Kollaboration und Interaktion in der Gesamtorganisation anwendet. Bibliotheken erweitern Serviceangebote und Arbeitsabläufe um die Möglichkeiten der Web 2.0-Technologien. Dies verändert Berufsbild und Selbstverständnis der Bibliothekare. Der Sammelband bietet einen kompletten Überblick zum Thema Bibliothek 2.0 und den aktuellen Stand der Entwicklungen aus technologischer, soziologischer, informationstheoretischer sowie praxisorientierter Sicht.
    Pages: Online-Ressource (XII, 393 Seiten)
    ISBN: 9783110232103
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 31
    Unknown
    London : The Geological Society
    Description / Table of Contents: The Mesozoic Era begins with the approximately 50-million-year-long Triassic Period, a major juncture in Earth history when the vast Pangaean supercontinent completed its assembly and began its fragmentation, and the global biota diversified and modernized after the end-Permian mass extinction, the most extensive biotic decimation of the Phanerozoic. The temporal ordering of geological and biotic events during Triassic time thus is critical to the interpretation of some unique and pivotal events in Earth history. This temporal ordering is mostly based on the Triassic timescale, which has been developed and refined for nearly two centuries. This book reviews the state of the art of the Triassic timescale and includes comprehensive analyses of Triassic radio-isotopic ages, magnetostratigraphy, isotope-based and cyclostratigraphic correlations and timescale -relevant marine and non-marine biostratigraphy.
    Pages: Online-Ressource (514 Seiten) , Illustrationen, Diagramme, Karten
    ISBN: 9781862392960
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Description / Table of Contents: Limestone is a highly successful and widely used building material, found in many important historic buildings and new monuments around the world. Whilst its success reflects its durability under a wide range of environmental conditions, there are still important questions surrounding the selection, use and conservation of building limestones. In order to make best use of new limestone today, and to conserve old limestone most effectively, we need to bring modern research methods to bear on understanding the characteristics of different limestones, what mortars to use, and how key limestones have responded to polluted atmospheres. This volume brings together recent inter-disciplinary research on these issues, illustrating the diversity of innovative techniques that are now being applied to furthering our understanding of building limestones.
    Pages: Online-Ressource (VII, 257 Seiten)
    ISBN: 9781862392946
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Description / Table of Contents: This volume contains a collection of stratigraphic and diagenetic case studies of Mesozoic and Cenozoic carbonate sequences from the Tethyan realm. High levels of industry and academic interest in the region have generated numerous multi-disciplinary studies of these sequences, a selection of which are presented in this volume. The studies presented are based on both comprehensive subsurface datasets from important hydrocarbon-bearing strata of the Middle East and the excellent surface exposures in the region of interest. The studies presented in this volume may serve as suitable starting points in the development of age and architecture specific carbonate reference models. Such models can form the basis of internally consistent models for carbonate deposition, sequence development and reservoir performance. Ideally such models, suitably scaled, will be equally applicable to academic studies, the exploration and development phases of the field life cycle and in the prediction of future reservoir performance.
    Pages: Online-Ressource (422 Seiten)
    ISBN: 9781862392922
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Description / Table of Contents: Reservoir compartmentalization - the segregation of a petroleum accumulation into a number of individual fluid/pressure compartments - controls the volume of moveable oil or gas that might be connected to any given well drilled in a field, and consequently impacts ‘booking’ of reserves and operational profitability. This is a general feature of modern exploration and production portfolios, and has driven major developments in geoscience, engineering and related technology. Given that compartmentalization is a consequence of many factors, an integrated subsurface approach is required to better understand and predict compartmentalization behaviour, and to minimize the risk of it occurring unexpectedly. This volume reviews our current understanding and ability to model compartmentalization. It highlights the necessity for effective specialist discipline integration, and the value of learning from operational experience in: detection and monitoring of compartmentalization; stratigraphic and mixed-mode compartmentalization; and fault-dominated compartmentalization.
    Pages: Online-Ressource (VI, 362 Seiten)
    ISBN: 9781863293165
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Description / Table of Contents: Onshore fold–thrust belts are commonly perceived as ‘difficult’ places to explore for hydrocarbons and are therefore often avoided. However, these belts host large oil and gas fields and so these barriers to effective exploration mean that substantial unexploited resources may remain. Over time, evaluation techniques have improved. It is possible in certain circumstances to achieve good 3D seismic data. Structural restoration techniques have moved into the 3D domain and increasingly sophisticated palaeo-thermal indicators allow better modelling of burial and uplift evolution of source and reservoirs. Awareness of the influence of pre-thrust structure and stratigraphy and of hybrid thick and thin-skinned deformation styles is augmenting the simplistic geometric models employed in earlier exploration. But progress is a slow, expensive and iterative process. Industry and academia need to collaborate in order to develop and continually improve the necessary understanding of subsurface geometries, reservoir and charge evolution and timing; this publication offers papers on specific techniques, outcrop and field case studies.
    Pages: Online-Ressource (190 Seiten)
    ISBN: 9781862393172
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Keywords: carbon ; energy ; climate change ; coal emissions ; energy efficiency
    Description / Table of Contents: This study from the Independent Evaluation Group draws lessons for development and climate change mitigation from the World Bank Group’s far-reaching portfolio of projects in energy, forestry, transport, coal power, and technology transfer. Reviewing what has worked, what hasn’t, and why, the evaluation’s key findings include: Energy efficiency can offer countries direct economic returns that dwarf those of most other development projects, while also reducing greenhouse gas emissions. Tropical forest protected areas, on average, significantly reduce tropical deforestation, preserving carbon and biodiversity. Deforestation rates are lower in areas that allowed sustainable use by local populations than in strictly protected areas. Deforestation rates were lowest of all in indigenous forest areas. For renewable energy projects, long-duration loans have been important in making projects financially viable.. But at prevailing carbon prices, carbon offset sales had little impact on most renewable energy projects’ rate of returns, and did not address investors’ need for up-front capital. Technology transfer – broadly understood to include diffusion of technical and financial innovations related to low-carbon development – has worked well when the logic of piloting and demonstration is well thought out, and when grants are used to mitigate the risk of pioneering efforts.
    Pages: Online-Ressource (XXXIX, 128 Seiten)
    ISBN: 9780821386545
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    Description / Table of Contents: Für alle Regionen, die auf den Tourismus als ökonomisches Standbein setzen, ist ein marktfähiges Alleinstellungsmerkmal wichtig. Die Kulturlandschaft in ihrer jeweils besonderen Eigenart bietet hierfür ein endogenes Potenzial, das es zu erschließen, aber gleichermaßen auch zu schützen gilt. Doch viele kulturlandschaftliche Charakteristika und Besonderheiten eröffnen sich nicht unmittelbar, sondern müssen erst herausgearbeitet und „interpretiert“ werden. Darin liegt die grundlegende Herausforderung. Der vorliegende Band beinhaltet zum einen theoretische Auseinandersetzungen mit dem Thema Kulturlandschaftsforschung aus der Perspektive verschiedener wissenschaftlicher Fachrichtungen, zum anderen praxisbezogene Fallbeispiele, die aufzeigen, wie die Forschungsergebnisse einem Freizeitpublikum auf interessante Art und Weise vermittelt werden können. Denn die Kulturlandschaft ist beides – wissenschaftliches Forschungsobjekt und Vermittlungsraum im Kontext touristischer Freizeitgestaltung.
    Pages: Online-Ressource (179 Seiten)
    ISBN: 9783941875333
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
    Unknown
    Amsterdam ; New York : North-Holland Pub. Co
    Keywords: DDC 510 s ; DDC 515.7 ; LC QA1 ; LC QA320eb ; Division rings ; Functional analysis
    Pages: Online-Ressource (xv, 302 pages)
    ISBN: 9780444865359
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 39
    Keywords: DDC 515.3/55 ; LC QC20.7.E88 ; Evolution equations, Nonlinear ; Solitons ; Spectral theory (Mathematics) ; Transformations (Mathematics)
    Pages: Online-Ressource (xv, 516 pages)
    ISBN: 9780444863683
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
    Unknown
    Amsterdam ; New York : North-Holland Pub. Co
    Keywords: DDC 510 s ; DDC 515.7/24 ; LC QA1 ; Functions, Special ; Inverse problems (Differential equations) ; Scattering (Mathematics) ; Transmutation operators
    Pages: Online-Ressource (x, 457 pages)
    ISBN: 9780444864260
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 41
    Unknown
    Amsterdam ; New York : North-Holland Pub. Co
    Keywords: DDC 629.8/312 ; LC QA402.3 ; Differential equations, Partial ; Stochastic control theory ; Variational inequalities (Mathematics)
    Pages: Online-Ressource (xi, 564 pages)
    ISBN: 9780444863584
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    Unknown
    Amsterdam ; New York : North-Holland Pub. Co
    Keywords: DDC 512/.4 ; LC QA251.4 ; Graded rings ; Noncommutative rings
    Pages: Online-Ressource (ix, 340 pages)
    ISBN: 9780444864895
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
    Unknown
    Amsterdam ; New York : North-Holland Pub. Co
    Keywords: DDC 515.7/3 ; LC QA1 ; LC QA322eb ; Differential calculus ; Holomorphic functions ; Locally convex spaces
    Pages: Online-Ressource (xii, 455 pages)
    ISBN: 9780444863973
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 44
    Keywords: DDC 511/.6 ; LC QA166.25 ; Combinatorial designs and configurations ; Combinatorial geometry
    Description / Table of Contents: Symposium on 'Combinatorial Structures and their Applications' was held at Villa Madruzzo (Cognola di Trento), on October 20-25, 1980 ... and sponsored by the Centro interuniversitario per la ricerca matematica (C.I.R.C.M.) of the 'Università di Trento'
    Pages: Online-Ressource (viii, 292 pages)
    ISBN: 9780444863843
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
    Unknown
    Amsterdam ; New York : North-Holland Pub. Co
    Keywords: DDC 516.3/6 ; LC QA3 ; Geometry, Differential ; Mathematics
    Pages: Online-Ressource (liii, 363 pages)
    ISBN: 9780444864956
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 46
    Keywords: DDC 510 s ; DDC 515.7 ; LC QA1 ; LC QA320eb ; Approximation theory - Congresses ; Domains of holomorphy - Congresses ; Functional analysis - Congresses ; Holomorphic functions - Congresses
    Pages: Online-Ressource (viii, 485 pages)
    ISBN: 9780444865274
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 47
    Keywords: climate change ; emissions ; poverty
    Description / Table of Contents: This book provides the latest knowledge and practice in responding to the challenge of climate change in cities. Case studies focus on topics such as New Orleans in the context of a fragile environment, a framework to include poverty in the cities and climate change discussion, and measuring the impact of GHG emissions.
    Pages: Online-Ressource (XIV, 306 Seiten)
    ISBN: 9780821386675
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    Keywords: environmental chemistry
    Description / Table of Contents: The book offers a professional look on the recent achievements and emerging trends in pesticides analysis, including pesticides identification and characterization. The 20 chapters are organized in three sections. The first book section addresses issues associated with pesticides classification, pesticides properties and environmental risks, and pesticides safe management, and provides a general overview on the advanced chromatographic and sensors- and biosensors-based methods for pesticides determination. The second book section is specially devoted to the chromatographic pesticides quantification, including sample preparation. The basic principles of the modern extraction techniques, such as: accelerated solvent extraction, supercritical fluid extraction, microwave assisted extraction, solid phase extraction, solid phase microextraction, matrix solid phase dispersion extraction, cloud point extraction, and QuEChERS are comprehensively described and critically evaluated. The third book section describes some alternative analytical approaches to the conventional methods of pesticides determination. These include voltammetric techniques making use of electrochemical sensors and biosensors, and solid-phase spectrometry combined with flow-injection analysis applying flow-based optosensors.
    Pages: Online-Ressource (514 Seiten)
    ISBN: 9789533074375
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    Unknown
    Rijeka : InTech
    Keywords: oceanography ; atmospheric sciences ; air pollution ; air quality ; environmental engineering
    Description / Table of Contents: Air pollution is about five decades or so old field and continues to be a global concern. Therefore, the governments around the world are involved in managing air quality in their countries for the welfare of their citizens. The management of air pollution involves understanding air pollution sources, monitoring of contaminants, modeling air quality, performing laboratory experiments, the use of satellite images for quantifying air quality levels, indoor air pollution, and elimination of contaminants through control. Research activities are being performed on every aspect of air pollution throughout the world, in order to respond to public concerns. The book is grouped in five different sections. Some topics are more detailed than others. The readers should be aware that multi-authored books have difficulty maintaining consistency. A reader will find, however, that each chapter is intellectually stimulating. Our goal was to provide current information and present a reasonable analysis of air quality data compiled by knowledgeable professionals in the field of air pollution.
    Pages: Online-Ressource (382 Seiten)
    ISBN: 9789533071312
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    Unknown
    Rijeka : InTech
    Keywords: climate change
    Description / Table of Contents: Climate change is emerging as one of the most important issues of our time, with the potential to cause profound cascading effects on ecosystems and society. However, these effects are poorly understood and our projections for climate change trends and effects have thus far proven to be inaccurate. In this collection of 24 chapters, we present a cross-section of some of the most challenging issues related to oceans, lakes, forests, and agricultural systems under a changing climate. The authors present evidence for changes and variability in climatic and atmospheric conditions, investigate some the impacts that climate change is having on the Earth's ecological and social systems, and provide novel ideas, advances and applications for mitigation and adaptation of our socio-ecological systems to climate change. Difficult questions are asked. What have been some of the impacts of climate change on our natural and managed ecosystems? How do we manage for resilient socio-ecological systems? How do we predict the future? What are relevant climatic change and management scenarios? How can we shape management regimes to increase our adaptive capacity to climate change? These themes are visited across broad spatial and temporal scales, touch on important and relevant ecological patterns and processes, and represent broad geographic regions, from the tropics, to temperate and boreal regions, to the Arctic.
    Pages: Online-Ressource (486 Seiten)
    ISBN: 9789533071442
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
    Unknown
    Open Humanities Press
    Keywords: astrobiology ; Mars ; life
    Description / Table of Contents: INTRODUCTION: WHAT IS LIFE? I’m not going to answer this question. In fact, I doubt if it will ever be possible to give a full answer. (Haldane, 1949: 58) What Is Life? J. B. S. Haldane (1949) and Erwin Schrödinger (1944), two of the twentieth century’s most influential scientists, posed the direct question, ‘what is life?’ and declared that it was a question unlikely to find an answer. Life, they suggested, might exceed the ability of science to represent it and even though the sciences of biology, physics and chemistry might usefully describe life’s structures, systems and processes, those sciences should not seek to reduce it to the sum of its parts. While Schrödinger drew attention to the physical structure of living matter, including especially the cell, Haldane asserted that ‘what is common to life is the chemical events’ (1949: 59) and so therefore life might be defined, though not reduced, to ‘a pattern of chemical processes’ (62) involving the use of oxygen, enzymes and so on. Following Schrödinger and Haldane, Chris McKay’s article, published in 2004 and included in this collection, asks again ‘What is Life – and How Do We Search For It in Other Worlds?’. For him, the still open and unresolved question of life is intrinsically linked to the problem of how to find it (here, or elsewhere) since, he queries, how can we search for something that we cannot adequately define? It should be noted that this dilemma did not deter the founders of Artificial Life, a project that succeeded Artificial Intelligence and that sought to both simulate ‘life-as-we-know-it’ and synthesise ‘life-as-it-could-be’ by reducing life to the informational and therefore computational criteria of self-organisation, self-replication, evolution, autonomy and emergence (Langton, 1996: 40; Kember, 2003). McKay concedes that certain characteristics of life, such as metabolism and motion, can occur without biology, but rather than pursuing contestable (re)definitions of life that could not, for him, constitute the basis for a search, he prefers to ask a more pragmatic question: ‘what does life need?’. The elements that support life – energy, carbon, liquid water, nitrogen, sulphur and phosphorus – are not contested and, barring only liquid water, they are abundant in the Solar System. It seems logical then, McKay argues, to search for life indirectly, by looking at where the water is. The case for liquid water on Mars has, as we will see, a long and argumentative history. In as far as the current case is, as McKay maintains, ‘tight’, then there is justification for his upbeat assessment that, with the correct instruments, it should be possible to find life-as-we-know-it – and even life-as-it-could-be. He writes: ‘while it could be similar at the top (ecological) and bottom (chemical) levels, life on Mars could be quite alien in the middle, in the realm of biochemistry’ (2004: 1261).
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 52
    Unknown
    Rijeka : InTech
    Keywords: soil science
    Description / Table of Contents: Soil erosion affects a large part of the Earth surface, and accelerated soil erosion is recognized as one of the main soil threats, compromising soil productive and protective functions. The land management in areas affected by soil erosion is a relevant issue for landscape and ecosystems preservation. In this book we collected a series of papers on erosion, not focusing on agronomic implications, but on a variety of other relevant aspects of the erosion phenomena. The book is divided into three sections: i) various implications of land management in arid and semiarid ecosystems, ii) erosion modeling and experimental studies; iii) other applications (e.g. geoscience, engineering). The book covers a wide range of erosion-related themes from a variety of points of view (assessment, modeling, mitigation, best practices etc.).
    Pages: Online-Ressource (320 Seiten)
    ISBN: 9789533077109
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 53
    Unknown
    Rijeka : InTech
    Keywords: environmental engineering ; water management
    Description / Table of Contents: There is an estimated 1.4 billion km3 of water in the world but only approximately three percent (39 million km3) of it is available as fresh water. Moreover, most of this fresh water is found as ice in the arctic regions, deep groundwater or atmospheric water. Since water is the source of life and essential for all life on the planet, the use of this resource is a highly important issue. "Water management" is the general term used to describe all the activities that manage the optimum use of the world's water resources. However, only a few percent of the fresh water available can be subjected to water management. It is still an enormous amount, but what's unique about water is that unlike other resources, it is irreplaceable. This book provides a general overview of various topics within water management from all over the world. The topics range from politics, current models for water resource management of rivers and reservoirs to issues related to agriculture. Water quality problems, the development of water demand and water pricing are also addressed. The collection of contributions from outstanding scientists and experts provides detailed information about different topics and gives a general overview of the current issues in water management. The book covers a wide range of current issues, reflecting on current problems and demonstrating the complexity of water management.
    Pages: Online-Ressource (340 Seiten)
    ISBN: 9789533074139
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
    Unknown
    Washington, D. C. : The World Bank
    Description / Table of Contents: The Berlin Workshop Series 2010 presents selected papers from meetings held September 28-30, 2008, at the eleventh annual forum co-hosted by InWEnt and the World Bank in preparation for the Bank's annual World Development Report. At the 2008 meetings, key researchers and policy makers from Europe, the United States, and developing countries met to explore the problems that climate governance poses for development, which are later examined in depth in the World Development Report 2010. This volume presents papers from the Berlin workshop sessions on climate governance and development, covering climate change as a development priority; policies and technologies for energy and development; natural resource governance for adaptation, mitigation, and development; non-state actors and climate governance; financing adaptation and mitigation in an unequal world; and changing institutions of governance for climate change.
    Pages: Online-Ressource (VII, 157 Seiten)
    ISBN: 9780821383070
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 55
    Unknown
    Rijeka : InTech
    Keywords: soil science
    Description / Table of Contents: Soil contamination has severely increased over the last decades, mainly due to petroleum hydrocarbons, solvents, pesticides, lead and other heavy metals from industrial wastes and human activities. The critical point regarding contaminated soil monitoring is the intrinsic difficulty in defining fixed monitoring variables and indicators as the establishment of any a priori criterion and threshold for soil quality can be still considered subjective. This book is organized into eight chapters and presents the state-of-the art and new research highlights in the context of contaminated soil monitoring and remediation strategies, including examples from South America, Europe and Asia. The chapters deal with the following topics: - monitoring of dioxin, furan, hydrocarbons and heavy metals level in soils - bioindicators and biomarkers for the assessment of soil toxicity - use of reflectance spectroscopy for soil contaminants and waste material detection - remediation technologies and strategies.
    Pages: Online-Ressource (168 Seiten)
    ISBN: 9789533076478
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 56
    Description / Table of Contents: Reisen als kulturelle Praxis ist Spiegelbild gesellschaftlicher Verhältnisse. Wandelt sich eine Gesellschaft, so wandelt sich auch ihr Reiseverhalten. Vor diesem Hintergrund war das erste Jahrzehnt des 21. Jahrhunderts durch zahlreiche Entwicklungen gekennzeichnet, die Touristik und Tourismusforschung gleichermaßen vor große Herausforderungen stellen. Im vorliegenden Band werden ausgewählte touristische Trends und ihre räumlichen Implikationen nachgezeichnet, mit angebots- und nachfrageseitigen Analysen die Motive, Erfahrungen und Handlungsoptionen beleuchtet sowie künftige Perspektiven ausgelotet. Die Beiträge verdeutlichen, dass sich „etablierte“ Destinationen und Freizeitangebote aufgrund von Veränderungen in der touristischen Nachfrage einem enormen Innovationsdruck ausgesetzt sehen, für aufstrebende Zielgebiete bieten sie hingegen die Chance, sich am Markt zu positionieren.
    Pages: Online-Ressource (203 Seiten)
    ISBN: 9783941875982
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
    Keywords: Geothermie ; Geologie ; Göttingen ; Niedersachsen
    Description / Table of Contents: Der vorliegende Band enthält eine Sammlung von Arbeiten, die sich mit unterschiedlichen Aspekten der geologischen Entwicklung des Leinetalgrabens und seines strukturellen Rahmens befassen. Grundlage stellen neue und ältere, bislang nicht veröffentlichte Ergebnisse dar, die teilweise im Rahmen von geowissenschaftlichen Examensarbeiten erbracht wurden. Diese häufig in Archiven „versteckten“ Daten sollen hiermit interessierten Fachleuten aber auch geologisch interessierten Laien zugänglich gemacht werden. Herausgeber ist die GeothermieGruppeGöttingen (GGG), in der GeowissenschaftlerInnen aus verschiedenen Abteilungen des Geowissenschaftlichen Zentrums der Georg-August-Universität Göttingen (GZG) tätig sind. Aktuelles Forschungsziel der GGG ist, ein dreidimensionales Strukturmodell für die Region Göttingen mit dem Leinetalgraben als zentrale Struktur zu erstellen, das als Grundlage für eine anwendungsbezogene Bewertung geothermischer Potentiale dienen soll.
    Pages: Online-Ressource (170 Seiten)
    ISBN: 9783863950194
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 58
    Keywords: oceanography ; atmospheric sciences ; environmental engineering ; geodesy ; remote sensing
    Pages: Online-Ressource (170 Seiten)
    ISBN: 9789537619602
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 59
    Keywords: agriculture
    Description / Table of Contents: When Foucault introduced the concept of biopolitics, he referred to a historically specific power agenda involving a particular approach to life. This approach was at the root of the modern sciences of biology and political economy, both of which set out to describe, explain and manage their objects of study as abstract processes of production and reproduction. Agricultural science must be situated in relation to the biopolitical agenda of 'applying' the modern scientific approach to the management of social life. The scientification of agriculture took place in the United States towards the end of the 19th century, through a process that entailed both a delegitimation of farmer-generated knowledges and the production of new, modern subjectivities. While farmers were being reconceptualized as entrepreneurs in need of scientific education and advice, newly trained agronomists devoted themselves to designing fertilizers, pesticides and hybrid seeds with the goal of maximizing yields. Public institutions were created which coordinated agricultural production with both science and trade policy. Agricultural science was thus inseparable from the process which transformed much of US agriculture into transnational agribusiness, and local farming networks all over the world into consumer endpoints of a globalized food industry.
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
    Keywords: materiality ; waste ; materials ; energetics ; ecosophy
    Description / Table of Contents: Medianatures picks up from Donna Haraway’s idea of naturecultures – the topological continuum between nature and culture, the material entwining and enfolding of various agencies, meanings and interactions. Medianatures gives the concept of naturecultures a specific emphasis, and that emphasis is at the core of this living book. It is a useful concept and framework for investigating some of the ways in which our electronic and high-tech media culture is entwined with a variety of material agencies. The notion of ‘materiality’ is taken here in a literal sense to refer, for instance, to ‘plasma reactions and ion implantation’ (Yoshida, 1994: 105) – as in processes of semiconductor fabrication, or to an alternative list of media studies objects and components which are studied from an e-waste management perspective: ‘metal, motor/compressor, cooling, plastic, insulation, glass, LCD, rubber, wiring/electrical, concrete, transformer, magnetron, textile, circuit board, fluorescent lamp, incandescent lamp, heating element, thermostat, brominated flamed retardant (BFR)-containing plastic, batteries, CFC/HCFC/HFC/HC, external electric cables, refractory ceramic fibers, radioactive substances and electrolyte capacitors (over L/D 25 mm)’, and which themselves are constituted from a range of materials – plastics, wood, plywood, copper, aluminum, silver, gold, palladium, lead, mercury, arsenic, cadmium, selenium, hexavalent chromium and flame retardants (Pinto, 2008). In short, media are of nature, and return to nature – where the production process for our media devices, from screens to circuits, networks to interfaces, involves the standardization and mass-mobilization of minerals and other materialities. Discarded media technologies are themselves part of such a regime of natural ‘things’ – whether picked apart in an Asian recycling village, or then left to decay in urban or rural places. The natural affords our cultural agencies and assemblages – including media practices and concrete devices – and all of that comes back to nature. The articles selected express this materiality at the core of media technological culture, and the various ecological ties these themes share with the current political economy. They range from perspectives in environmental sciences concerning e-waste and the management of electronic media remains to computer science and ideas in green computing – as well as showcasing articles and reports about the production and dismantling of things such as Cathode Ray Tubes and LCD-displays. Hence, this living book is not only about life, but also about death and dead media – but dead media in a very concrete sense of media as the death of nature, biological processes and organisms (including humans).
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 61
    Keywords: energy engineering
    Description / Table of Contents: In the early 21st century, research and development of sustainable energy harvesting (EH) technologies have started. Since then, many EH technologies have evolved, advanced and even been successfully developed into hardware prototypes for sustaining the operational lifetime of low?power electronic devices like mobile gadgets, smart wireless sensor networks, etc. Energy harvesting is a technology that harvests freely available renewable energy from the ambient environment to recharge or put used energy back into the energy storage devices without the hassle of disrupting or even discontinuing the normal operation of the specific application. With the prior knowledge and experience developed over a decade ago, progress of sustainable EH technologies research is still intact and ongoing. EH technologies are starting to mature and strong synergies are formulating with dedicate application areas. To move forward, now would be a good time to setup a review and brainstorm session to evaluate the past, investigate and think through the present and understand and plan for the future sustainable energy harvesting technologies.
    Pages: Online-Ressource (256 Seiten)
    ISBN: 9789533074382
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 62
    Keywords: oceanography ; atmospheric sciences ; air pollution ; emission
    Description / Table of Contents: The atmosphere may be our most precious resource. Accordingly, the balance between its use and protection is a high priority for our civilization. While many of us would consider air pollution to be an issue that the modern world has resolved to a greater extent, it still appears to have considerable influence on the global environment. In many countries with ambitious economic growth targets the acceptable levels of air pollution have been transgressed. Serious respiratory disease related problems have been identified with both indoor and outdoor pollution throughout the world. The 25 chapters of this book deal with several air pollution issues grouped into the following sections: a) air pollution chemistry; b) air pollutant emission control; c) radioactive pollution and d) indoor air quality.
    Pages: Online-Ressource (680 Seiten)
    ISBN: 9789533073163
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Keywords: geology ; geophysics
    Description / Table of Contents: Ocean closure involves a variety of converging tectonic processes that reshape shrinking basins, their adjacent margins and the entire earth underneath. Following continental breakup, margin formation and sediment accumulation, tectonics normally relaxes and the margins become passive for millions of years. However, when final convergence is at the gate, the passive days of any ocean and its margins are over or soon will be. The fate of the Mediterranean and Persian Gulf is seemingly known beforehand, as they are nestled in the midst of Africa-Arabia plate convergence with Eurasia. Over millions of years through the Cenozoic era they progressively shriveled, leaving only a glimpse of the Tethys Ocean. Eventually, the basins will adhere to the Alpine-Himalaya orogen and dissipate. This book focuses on a unique stage in the ocean closure process, when significant convergence already induced major deformations, yet the inter-plate basins and margins still record the geological history.
    Pages: Online-Ressource (352 Seiten)
    ISBN: 9789533075945
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
    Unknown
    Rijeka : InTech
    Keywords: energy engineering ; renewable resources
    Description / Table of Contents: The first book of this four-volume edition is dedicated to one of the most promising areas of photovoltaics, which has already reached a large-scale production of the second-generation thin-film solar modules and has resulted in building the powerful solar plants in several countries around the world. Thin-film technologies using direct-gap semiconductors such as CIGS and CdTe offer the lowest manufacturing costs and are becoming more prevalent in the industry allowing to improve manufacturability of the production at significantly larger scales than for wafer or ribbon Si modules. It is only a matter of time before thin films like CIGS and CdTe will replace wafer-based silicon solar cells as the dominant photovoltaic technology. Photoelectric efficiency of thin-film solar modules is still far from the theoretical limit. The scientific and technological problems of increasing this key parameter of the solar cell are discussed in several chapters of this volume.
    Pages: Online-Ressource (456 Seiten)
    ISBN: 9789533075709
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 65
    Keywords: environmental engineering ; climate change ; global warming
    Description / Table of Contents: The failure of the UN climate change summit in Copenhagen in December 2009 to effectively reach a global agreement on emission reduction targets, led many within the developing world to view this as a reversal of the Kyoto Protocol and an attempt by the developed nations to shirk out of their responsibility for climate change. The issue of global warming has been at the top of the political agenda for a number of years and has become even more pressing with the rapid industrialization taking place in China and India. This book looks at the effects of climate change throughout different regions of the world and discusses to what extent cleantech and environmental initiatives such as the destruction of fluorinated greenhouse gases, biofuels, and the role of plant breeding and biotechnology. The book concludes with an insight into the socio-religious impact that global warming has, citing Christianity and Islam.
    Pages: Online-Ressource (646 Seiten)
    ISBN: 9789533077338
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Keywords: open science ; open knowledge ; open data ; digitization ; visualization ; searching
    Description / Table of Contents: One of the aims of the Living Books About Life series is to provide a 'bridge' or point of connection, translation, even interrogation and contestation, between the humanities and the sciences. Accordingly, this introduction to Digitize Me, Visualize Me, Search Me takes as its starting point the so-called ‘computational turn’ to data-intensive scholarship in the humanities. The phrase ‘the computational turn’ has been adopted to refer to the process whereby techniques and methodologies drawn from (in this case) computer science and related fields – including science visualization, interactive information visualization, image processing, network analysis, statistical data analysis, and the management, manipulation and mining of data – are being used to produce new ways of approaching and understanding texts in the humanities; what is sometimes thought of as ‘the digital humanities’. The concern in the main has been with either digitizing ‘born analog’ humanities texts and artifacts (e.g. making annotated editions of the art and writing of William Blake available to scholars and researchers online), or gathering together ‘born digital’ humanities texts and artifacts (videos, websites, games, photography, sound recordings, 3D data), and then taking complex and often extremely large-scale data analysis techniques from computing science and related fields and applying them to these humanities texts and artifacts - to this ‘big data’, as it has been called. Witness Lev Manovich and the Software Studies Initiative’s use of ‘digital image analysis and new visualization techniques’ to study ‘20,000 pages of Science and Popular Science magazines… published between 1872-1922, 780 paintings by van Gogh, 4535 covers of Time magazine (1923-2009) and one million manga pages’ (Manovich, 2011), or Dan Cohen and Fred Gibbs’s text mining of ‘the 1,681,161 books that were published in English in the UK in the long nineteenth century’ (Cohen, 2010). What Digitize Me, Visualize Me, Search Me endeavours to show is that such data-focused transformations in research can be seen as part of a major alteration in the status and nature of knowledge. It is an alteration that, according to the philosopher Jean-François Lyotard, has been taking place since at least the 1950s, and involves nothing less than a shift away from a concern with questions of what is right and just, and toward a concern with legitimating power by optimizing the social system’s performance in instrumental, functional terms. This shift has significant consequences for our idea of knowledge.
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    Keywords: energy engineering
    Description / Table of Contents: Nowadays, the increasing use of power electronics equipment origins important distortions. The perfect AC power systems are a pure sinusoidal wave, both voltage and current, but the ever-increasing existence of non-linear loads modify the characteristics of voltage and current from the ideal sinusoidal wave. This deviation from the ideal wave is reflected by the harmonics and, although its effects vary depending on the type of load, it affects the efficiency of an electrical system and can cause considerable damage to the systems and infrastructures. Ensuring optimal power quality after a good design and devices means productivity, efficiency, competitiveness and profitability. Nevertheless, nobody can assure the optimal power quality when there is a good design if the correct testing and working process from the obtained data is not properly assured at every instant; this entails processing the real data correctly. In this book the reader will be introduced to the harmonics analysis from the real measurement data and to the study of different industrial environments and electronic devices.
    Pages: Online-Ressource (278 Seiten)
    ISBN: 9789533073354
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Keywords: biodiversity ; environmental sciences
    Description / Table of Contents: Biological Diversity and Sustainable Resources Use is a very interesting volume, including attractive overviews and original case studies mainly focused on socio-economical effects of the right management of the ecosystems biodiversity, as well as on the useful integration between human activities and environmental responses. Ecological, medical and historical aspects of the sustainable development are also discussed in this book which consists of articles written by international experts, offering the reader a clear and extensive view of the present condition in which our planet is.
    Pages: Online-Ressource (158 Seiten)
    ISBN: 9789533077062
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    Keywords: hydrodynamics ; hydrology ; mechanical engineering
    Description / Table of Contents: The phenomena related to the flow of fluids are generally complex, and difficult to quantify. New approaches - considering points of view still not explored - may introduce useful tools in the study of Hydrodynamics and the related transport phenomena. The details of the flows and the properties of the fluids must be considered on a very small scale perspective. Consequently, new concepts and tools are generated to better describe the fluids and their properties. This volume presents conclusions about advanced topics of calculated and observed flows. It contains eighteen chapters, organized in five sections: 1) Mathematical Models in Fluid Mechanics, 2) Biological Applications and Biohydrodynamics, 3) Detailed Experimental Analyses of Fluids and Flows, 4) Radiation-, Electro-, Magnetohydrodynamics, and Magnetorheology, 5) Special Topics on Simulations and Experimental Data. These chapters present new points of view about methods and tools used in Hydrodynamics.
    Pages: Online-Ressource (442 Seiten)
    ISBN: 9789533075969
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Keywords: CO2-Speicherung ; Endlagerung ; Geothermie ; DESERTEC
    Description / Table of Contents: 1. Die Energiewende 2011 in Deutschland: Ein Vademecum für die Diskussion? / Robert Schlögl --- 2. Smarte Ideen für zukünftige Stromnetze / Christian Rehtanz --- 3. Energie aus der Tiefe: Geothermie / Rüdiger Schulz --- 4. Forschung zur sicheren Endlagerung radioaktiver Abfälle / Tilmann Rothfuchs, Thomas Brasser, Horst-Jürgen Herbert, Jörg Mönig, Ingo Müller-Lyda --- 5. Chancen und Risiken der CO2-Speicherung / Michael Kühn --- 6. Perspektiven für eine effiziente und nachhaltige Mobilität / Rolf Scharwächter --- 7. Strom aus der Wüste: Grundlagen des DESERTEC Konzepts / Franz Trieb, Hans Müller-Steinhagen --- 8. Energie ist Chemie – Katalyse als Schlüsseltechnik. Energie von Morgen: Eine Momentaufnahme / Malte Behrens, Robert Schlögl --- 9. Einleitung / Mittagssymposium: Dolmetscher der Kulturen Energie zwischen Natur- und Geisteswissenschaften Ein Streitgespräch / Gerhard Schaefer --- 10. Verschiedene Sprachkulturen rund um Energie / Gerhard Schaefer --- 11. Zitate zur Anregung der Diskussion / Gerhard Schaefer --- 12. Reaktionen der zwei Kontrahenten im Streitgespräch / Dietrich v. Engelhardt, Gunnar Berg --- 13. Fazit / Gerhard Schaefer
    Pages: Online-Ressource (IX, 207 Seiten)
    ISBN: 9783844242829
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Pages: Online-Ressource (IX, 286 Seiten)
    ISBN: 9783869319636
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    Unknown
    Rijeka : InTech
    Keywords: digital library
    Description / Table of Contents: Digital library is commonly seen as a type of information retrieval system which stores and accesses digital content remotely via computer networks. However, the vision of digital libraries is not limited to technology or management, but user experience. This book is an attempt to share the practical experiences of solutions to the operation of digital libraries. To indicate interdisciplinary routes towards successful applications, the chapters in this book explore the implication of digital libraries from the perspectives of design, operation, and promotion. Without common agreement on a broadly accepted model of digital libraries, authors from diverse fields seek to develop theories and empirical investigations that to advance our understanding of digital libraries.
    Pages: Online-Ressource (220 Seiten)
    ISBN: 9789533072036
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
    Description / Table of Contents: This special issue of Pure and Applied Geophysics is the second of two volumes containing an augmented collection of papers originating from the Evison Symposium on Seismogenesis and Earthquake Forecasting held in Wellington, New Zealand, in February 2008. The volumes honor Frank Evison's interest in earthquake generation and forecasting. This volume includes descriptions of earthquake forecasting test centers through the Collaboratory for the Study of Earthquake Predictability (CSEP) program and the first results from the Regional Earthquake Likelihood Model (RELM) experiment in California. Other papers discuss methods of testing predictions, in particular by the use of error diagrams. There is discussion of prediction methodologies using seismicity, including an application of the statistical technique of Hidden Markov Models to identify changes in seismicity and a new technique for identifying precursory quiescence. Several papers employ other data besides seismicity, such as geologically determined faults, calculations of stress changes via Coulomb stress modeling, tomographically determined velocity structure, groundwater, crustal deformation, and comparisons of real earthquakes to synthetic seismicity determined from hypothesized earthquake physics. One paper focuses on the prediction of human casualties in the event that a large earthquake occurs anywhere on the globe. The volume will be useful to students and professional researchers who are interested in the earthquake preparation process and in converting that understanding into forecasts of earthquake occurrence.
    Pages: Online-Ressource (274 Seiten)
    ISBN: 9783034604994
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 74
    Keywords: MATLAB ; communications
    Description / Table of Contents: The book presents several approaches in the key areas of practice for which the MATLAB software package was used. Topics covered include applications for: -Motors -Power systems -Robots -Vehicles The rapid development of technology impacts all areas. Authors of the book chapters, who are experts in their field, present interesting solutions of their work. The book will familiarize the readers with the solutions and enable the readers to enlarge them by their own research. It will be of great interest to control and electrical engineers and students in the fields of research the book covers.
    Pages: Online-Ressource (512 Seiten)
    ISBN: 9789533079141
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Unknown
    Hamburg : Maribus
    Description / Table of Contents: Der „World Ocean Review“ erscheint 2010 das erste Mal und soll in Zukunft in regelmäßigen Abständen herausgegeben werden. Entstanden ist ein umfassender und profunder Bericht, der den Zustand der Weltmeere und die Wirkungszusammenhänge zwischen dem Ozean und ökologischen, ökonomischen und gesellschaftspolitischen Bedingungen aufzeigt. Die wissenschaftlich gesicherten Erkenntnisse sollen all denen dienen, die sich aktiv und fundiert an den aktuellen Diskussionen im Umfeld der Meeresforschung beteiligen möchten.
    Pages: Online-Ressource (240 Seiten)
    ISBN: 9783866480001
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    Keywords: geofluids
    Description / Table of Contents: Frontiers in Geofluids is a collection of invited papers chosen to highlight recent developments in our understanding of geological fluids in different parts of the Earth, and published to mark the first ten years of publication of the journal Geofluids. The scope of the volume ranges from the fundamental properties of fluids and the phase relationships of fluids encountered in nature, to case studies of the role of fluids in natural processes. New developments in analytical and theoretical approaches to understanding fluid compositions, fluid properties, and geological fluid dynamics across a wide range of environments are included. A recurrent theme of research published in Geofluids is the way in which similar approaches can be applied to geological fluids in very different settings and this is reflected in the diverse range of applications of fluid studies that are included here. They include deep groundwater flow, hydrocarbons in faulted sedimentary basins, hydrothermal ores, and multiphase flow in mid-ocean ridge systems. Other topics covered are geothermal waters, crustal metamorphism, and fluids in magmatic systems. The book will be of great interest to researchers and students interested in crustal and mantle fluids of all sorts.
    Pages: Online-Ressource (XIII, 318 Seiten)
    ISBN: 9781444333305
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Keywords: DDC 510 ; LC QA1 ; Mathematics - Congresses
    Description / Table of Contents: Jointly organized by the Singapore Mathematical Society and the Department of Mathematics of the National University of Singapore
    Pages: Online-Ressource (xviii, 202 pages)
    ISBN: 9780444865106
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    Keywords: demography ; climate ; world alimentation
    Description / Table of Contents: Demography, climate, world alimentation. L’humanité trouvera-t-elle de quoi nourrir 9 milliards d’hommes en 2050, dans un contexte climatique probablement plus difficile ? L’inquiétude n’est pas nouvelle, mais la croissance démographique s’est emballée dans la seconde moitié du XXe siècle, et la crainte d’une crise alimentaire mondiale est réapparue. Certes, les progrès des technologies agricoles ont permis, au plan global, de maintenir le niveau nutritionnel moyen pendant les années de la "Révolution verte", mais la situation restait loin d’être satisfaisante, puisque environ 850 millions de personnes étaient sousalimentées au début du XXIe siècle. Or de nouvelles inquiétudes se font jour : les surfaces cultivables ne sont plus guère extensibles, la productivité des sols atteint des niveaux qui risquent de les endommager de façon irréversible, les prix de l’énergie et des intrants indispensables à l’agriculture moderne sont à la hausse... Et les perspectives de changements climatiques ne sont pas rassurantes. De nouveaux progrès technologiques permettront-ils de dépasser, une fois encore, les contraintes naturelles et démographiques ? Cet ouvrage rappelle d’abord ces contraintes démographiques, climatiques et environnementales qui pèseront sur la disponibilité de ressources à l’horizon 2050, et traite ensuite des facteurs d’évolution de la demande alimentaire, des moyens techniques et économiques d’y faire face, et enfin des conditions d’un équilibre possible. Une synthèse est proposée en début de volume. Des recommandations y sont faites, destinées aux pouvoirs publics français pour les éclairer sur leur politique nationale et internationale, mais aussi à la société civile, qui est concernée car les problèmes ne sont pas seulement scientifiques ou technologiques : ils mettent aussi en jeu les comportements individuels des producteurs et des consommateurs. Trois domaines où il faut agir sans tarder sont mis en valeur : la nutrition et les habitudes alimentaires, puis la démographie, et enfin l’économie mondiale et le commerce international. Les recommandations portent ensuite sur la production agricole et les questions d’environnement, puis sur la prévention, l’anticipation et la gestion des situations de crise, hélas quasi inévitables.
    Pages: Online-Ressource (LXXXIV, 313 Seiten)
    ISBN: 9782759805815
    Language: French
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
    Description / Table of Contents: The latest Mars missions are returning data of unprecedented fidelity in their representation of the martian surface. New data include images with spatial resolution better than 30 cm per pixel, stereo imaging-derived terrain models with one meter postings, high-resolution imaging spectroscopy, and RADAR data that reveal subsurface structure. This book reveals how this information is being used to understand the evolution of martian landscapes, and includes topics such as fluvial flooding, permafrost and periglacial landforms, debris flows, deposition and erosion of sedimentary material, and the origin of lineaments on Phobos, the larger martian moon. Contemporary remote sensing data of Mars, on a par with those of Earth, reveal landscapes strikingly similar to regions of our own planet, so this book will be of interest to Earth scientists and planetary scientists alike. An overview chapter summarising Mars’ climate, geology and exploration is included for the benefit of those new to Mars.
    Pages: Online-Ressource (VIII, 307 Seiten)
    ISBN: 9781862393301
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 80
    Unknown
    Rijeka : InTech
    Keywords: energy engineering ; renewable resources
    Description / Table of Contents: The third book of four-volume edition of 'Solar Cells' is devoted to solar cells based on silicon wafers, i.e., the main material used in today's photovoltaics. The volume includes the chapters that present new results of research aimed to improve efficiency, to reduce consumption of materials and to lower cost of wafer-based silicon solar cells as well as new methods of research and testing of the devices. Light trapping design in c-Si and mc-Si solar cells, solar-energy conversion as a function of the geometric-concentration factor, design criteria for spacecraft solar arrays are considered in several chapters. A system for the micrometric characterization of solar cells, for identifying the electrical parameters of PV solar generators, a new model for extracting the physical parameters of solar cells, LBIC method for characterization of solar cells, non-idealities in the I-V characteristic of the PV generators are discussed in other chapters of the volume.
    Pages: Online-Ressource (364 Seiten)
    ISBN: 9789533077475
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Keywords: mathematics
    Description / Table of Contents: New analytical strategies and techniques are necessary to meet requirements of modern technologies and new materials. In this sense, this book provides a thorough review of current analytical approaches, industrial practices, and strategies in Fourier transform application.
    Pages: Online-Ressource (520 Seiten)
    ISBN: 9789533072326
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Description / Table of Contents: The chapters in this volume represent a compilation of the material presented by the invited speakers at a short course on August 21-23, 2011 called “Sulfur in Magmas and Melts and its Importance for Natural and Technical Processes.” This Mineralogical Society of America and the Geochemical Society sponsored short course was held at the Hotel der Achtermann, in Goslar, Germany following the 2011 Goldschmidt Conference in Prague, Czech Republic. Following a nice overview in chapter 1 by the organizers Harald Behrens and James Webster, this volume is divided into 4 parts. 1. Analytical and Spectroscopic Methods -- chapters 2 and 3 2. Physical and Chemical Properties of S-Bearing Silicate Melts -- chapters 4-7 3. Constraints from Natural and Experimental Systems -- chapters 8-11 4. Natural and Technical Applications -- chapters 12-16
    Pages: Online-Ressource (xiv , 578 Seiten)
    ISBN: 9780939950874
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Description / Table of Contents: The chapters in this volume represent an extensive review of the material presented by the invited speakers at a short course on Theoretical and Computational Methods in Mineral Physics held prior (December 10-12, 2009) to the Annual fall meeting of the American Geophysical Union in San Francisco, California. The meeting was held at the Doubletree Hotel & Executive Meeting Center in Berkeley, California. Mineral physics is one of the three pillars of geophysics, the other two being geodynamics and seismology. Geophysics advances by close cooperation between these fields. As such, mineral physicists investigate properties of minerals that are needed to interpret seismic data or that are essential for geodynamic simulations. To be useful, mineral properties must be investigated in a wide range of pressures, temperatures, and chemical compositions. The materials and conditions in the interior of Earth and other terrestrial planets present several challenges. The chemical composition of their mantles is complex with at least five major oxide components and tens of solid phases. Today, these challenges are being addressed by a combination of experimental and computational methods, with experiments offering precise information at lower pressures and temperatures, and computations offering more complete and detailed information at conditions more challenging to experiments. While bulk properties of materials are fundamental to understanding a planet’s state, atomistic inspection of these complex materials are fundamental to understanding their properties. A connection is then established between atomic and planetary scale phenomena, which mineral physicists are in a unique position to appreciate. This book presents a set of review articles offering an overview of contemporary research in computational mineral physics. Fundamental methods are discussed and important applications are illustrated. The opening chapter by John Perdew and Adrienn Ruzhinszky discusses the motivation, history, and expressions of Kohn-Sham Density Functional Theory (DFT) and approximations for exchange and correlation. This is the established framework for investigation of a condensed matter system’s ground state electronic density and energy. It also discusses the recent trend to design higher-level semi-local functionals, with solid state applications in mind. It presents arguments in favor of semi-local approximations for condensed matter and discusses problematic cases where fully non-local approximations are needed. The following article by Yan Zhao and Donald Truhlar, demonstrates current research in search of appropriate exchange and correlation energy functionals. It reviews the performance of families of local, semi-local, and fully non-local exchange and correlation functionals: the so-called “Minnesota” functionals. These new functionals have been designed to give broad accuracy in chemistry and perform very well in difficult cases where popular functionals fail badly. The prospects for their successful applications are encouraging. Stefano Baroni, Paolo Gianozzi, and Eyvaz Isaev, introduce Density Functional Perturbation Theory, a suitable technique to calculate vibrational properties of extended materials using a combination of density functional theory and linear response techniques. This method gives very accurate phonon frequencies which, in combination with the quasi-harmonic approximation, allow one to study thermal properties of materials. The next chapter by Renata Wentzcovitch, Yonggang Yu, and Zhongqing Wu review the applications of density functional perturbation theory to the investigation thermodynamic properties and phase relations in mantle minerals. The series of studies summarized in this review have explored the accuracy of DFT within its most popular approximations for exchange and correlation energy in combination with the quasiharmonic approximation to offer results with useful accuracy for geophysical studies. The following article by Renata Wentzcovitch, Zhongqing Wu, and Pierre Carrier, summarizes the combination of the quasiharmonic approximation with elasticity theory to investigate thermoelastic properties of minerals at conditions of the Earth interior. Some unfamiliar but essential aspects of the quasiharmonic approximation are discussed. Thermoelastic properties of minerals are essential to interpret seismic observations. Therefore, some examples of interpretation of seismic structures are reviewed. The article by David Ceperley, returns to the fundamental theme of calculations of ground state energy in condensed matter and introduces Quantum Monte Carlo methods. These methods treat exactly the quantum many-body problem presented by a system of electrons and ions. They treat electrons as particles rather than a scalar charge-density field, as done by DFT. These are computationally intensive methods but the only exact ones. The following article by Lubos Mitas and Jindrich Kolorenc, reviews applications of these methods to transition metals oxides, materials that have some aspects in common with mantle minerals. One of the examined systems, FeO, is a most important component of mineral solid solutions. Matteo Cococcioni continues exploring the same theme. He discusses a modified density functional useful for addressing cases like FeO, which are untreatable by standard DFT. The DFT + Hubbard U method (DFT+U) is a practical approximate method that enables investigations of electronically and structurally complex systems, like minerals. The application of this method to a contemporary and central problem in mineral physics, pressure and temperature induced spin-crossovers in mantle minerals, is reviewed in the next chapter by Han Shu, Koichiro Umemoto, and Renata Wentzcovitch. The geophysical implications of the spin-crossover phenomenon, an electronic transition, are still unclear but some possibilities are suggested. Michael Ammann, John Brodholt, and David Dobson discuss simulations of bulk ionic diffusion. This property plays an important role in chemical exchange between and within crystalline and melt phases. It plays an important role in the kinetics of phase transitions, compositional zoning, mineral growth, and other important geochemical processes. It can also control rheological properties, especially in the diffusion creep regime, and thus the time scale of mantle convection. This is a very difficult property to investigate at combined pressures and temperature conditions of the mantle, therefore, calculations play a very important role in this area. Phillip Carrez and Patrick Cordier discuss modeling of dislocations and plasticity in deep Earth materials. This article focuses on recent developments in dislocation modeling and applications to our understanding of how the direction of mantle flow is recorded in polycrystalline texture. Next, the article by Stephen Stackhouse and Lars Stixrude, discusses theoretical methods for calculating lattice thermal conductivity in minerals, which controls the cooling of Earth’s core. Measurements of thermal conductivity at lower mantle conditions are very challenging to experiments and calculations are a valuable alternative to learning about this property. This article describes the most common methods to calculate this property and presents a review of studies of the lattice thermal conductivity of periclase. Artem Oganov discusses the prediction of high pressure crystal structures. A genetic algorithm for structural prediction is described and numerous applications predicting new phases with novel properties and phases that can explain experimental data so far not understood is presented. This is a most recent development on the subject of structural predictions, a subject that has been pursued by simulations for several decades now. The possibility of predicting structure and composition by this method is also pointed out. Koichiro Umemoto and Renata Wentzcovitch continue on the same theme of structural prediction by a different approach: combination of phonon calculations and variable cell shape molecular dynamics. The former indicates unstable displacement modes in compressed structures; the latter searches for structures resulting from the superposition of these unstable modes to the compressed lattice. This approach is illustrated with the search of mineral structures at multi-Mbar pressures that are still challenging to static or dynamic compression experiments, but have great interest in view of the discovery of terrestrial exoplanets with several Earth masses. The following chapter by Koichiro Umemoto is on simulations of phase transitions on a different class of planet forming material: H2O-ice. Ice has a rich phase diagram but many of its phase relations are unknown: large hysteresis precludes their direct measurements in manageable time scales. Therefore, calculations acquire special significance but they are also challenging, the main reasons being the description of hydrogen bond by DFT and hydrogen disorder. Dario Alfè presents a review of first principles calculations of properties of iron at Earth’s core conditions. This chapter includes examples of applications of multiple techniques used in studies of high temperature properties, structure, and melting lines. Results from Quantum Monte Carlo are compared with those from DFT, and results from molecular dynamics simulations are contrasted with predictions of quasiharmonic theory. These comparisons are instructive and illustrate the breadth of research in computational mineral physics. The following chapter by Bijaya Karki turns to DFT based simulations of another type of melt: ionic silicates and oxides. The article discusses the methodology used in these simulations and specially developed methods to analyze the results. The properties of interest are high temperature equations of state, thermodynamics properties, atomic and electronic structure, and self-diffusion and viscosity. Visualization of atomic motion is one of the valuable approaches discussed to gain insight into changes in melt structure with pressure and temperature. These studies are illustrated for 3 melts along the MgO-SiO2 join. The following three articles are devoted primarily to the introduction of inter-atomic potentials of broad applicability and relatively high accuracy, and applications to large scale simulations. The first article by Julian Gale and Kate Wright describes the current status of the derivation of force-fields and their applications to static and lattice dynamic calculations in mineral physics. This is done in the context of the General Utility Lattice Program (GULP), which has become quite popular. A selection of applications illustrating the possibilities of this code is then presented. Victor Vinograd and Bjoern Winkler illustrate another important type of application of force-field models: an efficient cluster expansion method to investigate binary mineral solid solutions. The article focuses on a rock-salt system but the technique is general. This type of problem is central to mineral physics and ingenious combinations of first principles methods, force-field models, and purely parameterized free energy expressions, combined with molecular dynamics and Monte Carlo techniques are necessary to address this problem. The predictive treatment of properties of ionic solid solutions is a major challenge in mineral physics. Mark Ghiorso and Frank Spera discuss long duration large scale molecular dynamics simulations using empirical pair-potentials. This article illustrates the concrete requirements on the number of atoms and time scales necessary to obtain information on transport properties such as shear viscosity and lattice thermal conductivity using Green-Kubo theory. These more than 1000-atom and pico-second simulations also improve the statistics in the estimation of equilibrium properties. Finally, the article by Lars Stixrude and Carolina Lithgow-Bertelloni on the thermodynamics of Earth’s mantle, gives an overview of how the elucidation of materials behavior governs planetary processes. It explains how the complexity of the Earth’s mantle demands methods that are complementary to first principles calculations and experiments. These methods must allow one to interpolate among and extrapolate from results on minerals with limited compositions to the full chemical richness of the silicate mantle. It then illustrates how the derived properties of multi-phase multi-component systems are used to address mantle heterogeneity on multiple length scales, ranging from that of the subducting slab to the possibility of mantle-wide radial variations in bulk composition.
    Pages: Online-Ressource (xviii , 484 Seiten)
    ISBN: 9780939950850
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Unknown
    Paris : IEA Publications
    Description / Table of Contents: The global energy system faces urgent challenges. Concerns about energy security are growing, as highlighted by the recent political turmoil in Northern Africa and the nuclear incident in Fukushima. At the same time, the need to respond to climate change is more critical than ever. Against this background, many governments have increased efforts to promote deployment of renewable energy – low-carbon sources that can strengthen energy security. This has stimulated unprecedented rise in deployment, and renewables are now the fastest growing sector of the energy mix. This “coming of age” of renewable energy also brings challenges. Growth is focused on a few of the available technologies, and rapid deployment is confined to a relatively small number of countries. In more advanced markets, managing support costs and system integration of large shares of renewable energy in a time of economic weakness and budget austerity has sparked vigorous political debate. The IEA’s new report, Deploying Renewables 2011: Best and Future Policy Practice: - Provides a comprehensive review and analysis of renewable energy policy and market trends; - Analyses in detail the dynamics of deployment and provides best-practice policy principles for different stages of market maturity; - Assesses the impact and cost-effectiveness of support policies using new methodological tools and indicators; - Investigates the strategic reasons underpinning the pursuit of RE deployment by different countries and the prospects for globalisation of RE. This new book builds on and extends a 2008 IEA publication, drawing on recent policy and deployment experience world-wide. It provides guidance for policy makers and other stakeholders to avoid past mistakes, overcome new challenges and reap the benefits of deploying renewables – today and tomorrow.
    Pages: Online-Ressource (186 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Keywords: energy ; energy economics
    Description / Table of Contents: This paper reviews key design features of mandatory emissions trading systems that had been established or were under consideration in 2010, with a particular focus on implications for the energy sector. Putting a price on greenhouse gas emissions is a cornerstone policy in climate change mitigation. To this end, many countries have implemented or are developing domestic emissions trading systems.
    Pages: Online-Ressource (110 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    Keywords: energy ; energy economics
    Description / Table of Contents: The main message of this paper is that while carbon pricing is a prerequisite for least-cost carbon mitigation strategies, carbon pricing is not enough to overcome all the barriers to cost-effective energy efficiency actions. Energy efficiency policy should be designed carefully for each sector to ensure optimal outcomes for a combination of economic, social and climate change goals. The main message of this paper is that while carbon pricing is a prerequisite for least-cost carbon mitigation strategies, carbon pricing is not enough to overcome all the barriers to cost-effective energy efficiency actions. Energy efficiency policy should be designed carefully for each sector to ensure optimal outcomes for a combination of economic, social and climate change goals. This paper aims to examine the justification for specific energy efficiency policies in economies with carbon pricing in place. The paper begins with an inventory of existing market failures that attempt to explain the limited uptake of energy efficiency. These market failures are investigated to see which can be overcome by carbon pricing in two subsectors – electricity use in residential appliances and heating energy use in buildings. This analysis finds that carbon pricing addresses energy efficiency market failures such as externalities and imperfect energy markets. However, several market and behavioural failures in the two subsectors are identified that appear not to be addressed by carbon pricing. These include: imperfect information; principal-agent problems; and behavioural failures. In this analysis, the policies that address these market failures are identified as complementary to carbon pricing and their level of interaction with carbon pricing policies is relatively positive. These policies should be implemented when they can improve energy efficiency effectively and efficiently (and achieve other national goals such as improving socio-economic efficiency).
    Pages: Online-Ressource (44 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Description / Table of Contents: Unlike many other low-carbon energy sources, nuclear energy is a mature technology that has been in use for more than 50 years. The latest designs for nuclear power plants build on this experience to offer enhanced safety and performance, and are ready for wider deployment. Nuclear power will be an important contributor to a low carbon power mix and can play a significant role in achieving both enhanced energy security and combating climate change. The IEA/NEA Nuclear Energy Technology Roadmap (2010) identified major barriers, opportunities, and policy measures for policy makers and industry and financial partners to accelerate RDD&D efforts for various nuclear technologies on both a national and international level.
    Pages: Online-Ressource (52 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Keywords: energy ; energy economics
    Description / Table of Contents: Special early excerpt of the World Energy Outlook 2010 for the United Nations General Assembly on the Millenium Development Goals.
    Pages: Online-Ressource (52 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Keywords: energy ; energy economics
    Description / Table of Contents: Increased focus has been placed on the issues of energy access and energy poverty over the last number of years, most notably indicated by the United Nations (UN) declaring 2012 as the “International Year of Sustainable Energy for All”. Although attention in these topics has increased, incorrect assumptions and misunderstandings still arise in both the literature and dialogues. Access to energy does not only include electricity, does not only include cook stoves, but must include access to all types of energy that form the overall energy system. This paper chooses to examine this energy system using a typology that breaks it into 3 primary energy subsystems: heat energy, electricity and transportation. Describing the global energy system using these three subsystems provides a way to articulate the differences and similarities for each system’s required investments needs by the private and public sectors.
    Pages: Online-Ressource (64 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Keywords: energy ; energy economics
    Description / Table of Contents: The International Energy Agency’s Energy Efficiency Unit (EEU) has begun a new programme of work on innovative energy-efficiency policies for mitigating fuel poverty. The IEAs current research focuses on the potential for low-income weatherisation programmes to address poor housing quality – the main driver of fuel poverty - as well as innovative methods for financing and evaluating such programmes. A common problem is that the energy-saving benefits accruing to fuel-poor households barely offset the investment required, suggesting a weak return on government spending. However, these investments have additional co-benefits for participants as well as for energy providers, property owners, local communities and society as a whole. This first IEA workshop focused on methods for incorporating the range of co-benefits into evaluation of low-income weatherisation programmes. The presentations given by top experts in the fuel poverty field are summarised in this report, along with conclusions and proposals for further research.
    Pages: Online-Ressource (40 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Keywords: energy ; energy economics
    Description / Table of Contents: Ensuring energy security has been at the centre of the IEA mission since its inception, following the oil crises of the early 1970s. While the security of oil supplies remains important, contemporary energy security policies must address all energy sources and cover a a comprehensive range of natural, economic and political risks that affect energy sources, infrastructures and services. In response to this challenge, the IEA is currently developing a Model Of Short-term Energy Security (MOSES) to evaluate the energy security risks and resilience capacities of its member countries. The current version of MOSES covers short-term security of supply for primary energy sources and secondary fuels among IEA countries. It also lays the foundation for analysis of vulnerabilities of electricity and end-use energy sectors. MOSES contains a novel approach to analysing energy security, which can be used to identify energy security priorities, as a starting point for national energy security assessments and to track the evolution of a country’s energy security profile. By grouping together countries with similar “energy security profiles”, MOSES depicts the energy security landscape of IEA countries. By extending the MOSES methodology to electricity security and energy services in the future, the IEA aims to develop a comprehensive policy-relevant perspective on global energy security. Ensuring energy security has been at the centre of the IEA mission since its inception, following the oil crises of the early 1970s. While the security of oil supplies remains important, contemporary energy security policies must address all energy sources and cover a a comprehensive range of natural, economic and political risks that affect energy sources, infrastructures and services. In response to this challenge, the IEA is currently developing a Model Of Short-term Energy Security (MOSES) to evaluate the energy security risks and resilience capacities of its member countries. The current version of MOSES covers short-term security of supply for primary energy sources and secondary fuels among IEA countries. It also lays the foundation for analysis of vulnerabilities of electricity and end-use energy sectors. MOSES contains a novel approach to analysing energy security, which can be used to identify energy security priorities, as a starting point for national energy security assessments and to track the evolution of a country’s energy security profile. By grouping together countries with similar “energy security profiles”, MOSES depicts the energy security landscape of IEA countries. By extending the MOSES methodology to electricity security and energy services in the future, the IEA aims to develop a comprehensive policy-relevant perspective on global energy security. This Working Paper is intended for readers who wish to explore the MOSES methodology in depth; there is also a brochure which provides an overview of the analysis and results.
    Pages: Online-Ressource (48 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    Keywords: energy ; energy economics
    Description / Table of Contents: MOSES contains a novel approach to analysing energy security, which can be used to identify energy security priorities, as a starting point for national energy security assessments and to track the evolution of a country’s energy security profile. By grouping together countries with similar “energy security profiles”, MOSES depicts the energy security landscape of IEA countries. By extending the MOSES methodology to electricity security and energy services in the future, the IEA aims to develop a comprehensive policy-relevant perspective on global energy security. Ensuring energy security has been at the centre of the IEA mission since its inception, following the oil crises of the early 1970s. While the security of oil supplies remains important, contemporary energy security policies must address all energy sources and cover a a comprehensive range of natural, economic and political risks that affect energy sources, infrastructures and services. In response to this challenge, the IEA is currently developing a Model Of Short-term Energy Security (MOSES) to evaluate the energy security risks and resilience capacities of its member countries. The current version of MOSES covers short-term security of supply for primary energy sources and secondary fuels among IEA countries. It also lays the foundation for analysis of vulnerabilities of electricity and end-use energy sectors. MOSES contains a novel approach to analysing energy security, which can be used to identify energy security priorities, as a starting point for national energy security assessments and to track the evolution of a country’s energy security profile. By grouping together countries with similar “energy security profiles”, MOSES depicts the energy security landscape of IEA countries. By extending the MOSES methodology to electricity security and energy services in the future, the IEA aims to develop a comprehensive policy-relevant perspective on global energy security. This Brochure provides and overview of the analysis and results. Readers interested in an in-depth discussion of methodology are referred to the MOSES Working Paper.
    Pages: Online-Ressource (16 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Unknown
    Paris : IEA Publications
    Description / Table of Contents: This book explores how efficiency is measured and reported at coal-fired power plants. Armed with this information, policy makers would be in a better position to monitor and, if necessary, regulate how coal is used for power generation. The tools and techniques described will be of value to anyone with an interest in the more sustainable use of coal. Coal is the biggest single source of energy for electricity production and its share is growing. The efficiency of converting coal into electricity matters: more efficient power plants use less fuel and emit less climate-damaging carbon dioxide. This book explores how efficiency is measured and reported at coal-fired power plants. With many different methods used to express efficiency performance, it is often difficult to compare plants, even before accounting for any fixed constraints such as coal quality and cooling-water temperature. Practical guidelines are presented that allow the efficiency and emissions of any plant to be reported on a common basis and compared against best practice. A global database of plant performance is proposed that would allow under-performing plants to be identified for improvement. Armed with this information, policy makers would be in a better position to monitor and, if necessary, regulate how coal is used for power generation. The tools and techniques described will be of value to anyone with an interest in the more sustainable use of coal.
    Pages: Online-Ressource (114 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Keywords: energy ; energy economics
    Description / Table of Contents: This joint report by the International Energy Agency (IEA) and the OECD Nuclear Energy Agency (NEA) is the seventh in a series of studies on electricity generating costs. It presents the latest data available for a wide variety of fuels and technologies, including coal and gas (with and without carbon capture), nuclear, hydro, onshore and offshore wind, biomass, solar, wave and tidal as well as combined heat and power (CHP). It provides levelised costs of electricity (LCOE) per MWh for almost 200 plants, based on data covering 21 countries (including four major non-OECD countries), and several industrial companies and organisations. For the first time, the report contains an extensive sensitivity analysis of the impact of variations in key parameters such as discount rates, fuel prices and carbon costs on LCOE. Additional issues affecting power generation choices are also examined. The study shows that the cost competitiveness of electricity generating technologies depends on a number of factors which may vary nationally and regionally. Readers will find full details and analyses, supported by over 130 figures and tables, in this report which is expected to constitute a valuable tool for decision makers and researchers concerned with energy policies and climate change.
    Pages: Online-Ressource (218 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    Keywords: energy ; energy economics
    Description / Table of Contents: Energy-related carbon dioxide (CO2) emissions are set to double by 2050 unless decisive action is taken. International Energy Agency (IEA) analysis demonstrates, however, that it is possible – in the same timeframe to 2050 – to reduce projected greenhouse-gas emissions to half 2005 levels, but this will require an energy technology revolution, involving the aggressive deployment of a portfolio of low-carbon energy technologies.
    Pages: Online-Ressource (130 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Keywords: energy ; energy economics
    Description / Table of Contents: This working paper evaluates cost and performance trends related to carbon dioxide (CO2) capture from power generation, based on extensive analysis of data from major engineering studies published between 2006 and 2010. Since individual studies use different methodologies and boundary conditions, study estimates for over 50 CO2 capture installations are re-evaluated on a consistent basis and updated to current cost levels. The paper discusses the need for further standardisation of evaluation methodologies and additional data for specific CO2 capture routes. Further analysis for non-OECD countries is considered crucial for global energy scenario models, and for improving the skills and knowledge developing countries need to evaluate the role of CCS in their national energy contexts.
    Pages: Online-Ressource (51 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    Keywords: energy ; energy economics
    Description / Table of Contents: The International Energy Agency (IEA) estimates that 100 Carbon Capture and Storage (CCS) projects will be required by 2020 and over 3 000 by 2050 if CCS is to contribute fully to the least-cost technology portfolio for CO2 mitigation. For CCS to reach its emissions reduction potential, the 2009 IEA publication Technology Roadmap: Carbon Capture and Storage recommends that international legal obstacles associated with global CCS deployment be removed by 2012 – including the prohibition on transboundary CO2 transfer under the London Protocol. The London Protocol was amended by contracting parties in 2009 to allow for cross-border transportation of CO2 for sub-seabed storage, but the amendment must be ratified by two-thirds of contracting parties to enter into force. It is unlikely that this will occur in the near term; this working paper therefore outlines options that may be available to contracting parties under international law to address the barrier to deployment presented by Article 6, pending formal entry into force of the 2009 amendment.
    Pages: Online-Ressource (40 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Description / Table of Contents: Nearly one-third of global energy and one-quarter of worldwide carbon dioxide (CO2) emissions are attributable to industrial activities that are not in the power generation sector. If climate change is to be successfully tackled, these sectors will need to transform the way they use energy and significantly reduce their CO2 emissions. In sectors such as iron and steel, oil refining, cement and chemicals and petrochemicals, emission can be reduced through efficiency improvements and integration of low carbon energy sources. Crucially, however, carbon capture and storage (CCS) has been identified as the only large-scale mitigation option available that can deliver the additional CO2 emissions reductions that would be necessary to meet the climate goals in 2050. This roadmap shows that CCS is a key cost-effective option for reducing CO2 emissions in large energy-intensive industries. In fact, much of the promising short-term potential for CCS globally lies not in the power sector but in industrial activities that currently vent highly pure streams of CO2. These activities include hydrogen production for fertilisers or fuel, bioethanol production and natural gas sweetening. Most studies on the potential application of CCS have focused on the power sector, however, even though all existing operational large-scale demonstrations of CCS are in industrial applications. In the longer-term, half of the global economic deployment for CCS by 2050 is shown to be in industrial applications. In certain sectors CCS is shown to be of particular relevance in developing countries, where it could be a highly cost-competitive emissions abatement option, even in the near term. This technology roadmap builds on the initial IEA roadmap on CCS and also the technology roadmap for the cement sector developed by the IEA and the Cement Sustainability Initiative of the World Business Council for Sustainable Development. It paves the way for low-carbon industrial growth in developed and developing countries by providing a vision of CCS in industrial applications up to 2050.
    Pages: Online-Ressource (52 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Description / Table of Contents: In the April 2010 Oil Market Report (OMR), the IEA included a supplementary report on the prospects to 2015 for the supply of natural gas liquids (NGLs), especially in light of new developments in natural gas production. At a time when economic, regulatory and geopolitical uncertainties are stretching lead times for expanding global crude oil supply, rising NGL and condensate availability can act as a pressure valve for the global oil market. Frequently overlooked as a component of production growth, nonetheless IEA estimates see up to 60% of expected oil supply increases through mid-decade deriving from NGLs. This timely report tries to present a clear view of the component parts of the NGL value chain, highlights optimal gas and NGL development strategies and presents detailed country and region specific forecasts for NGL supply through 2015.
    Pages: Online-Ressource (97 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Keywords: energy ; energy economics
    Description / Table of Contents: What impact will the return of high energy prices have on the fragile economic recovery? Will geopolitical unrest, price volatility and policy inaction defer investment in the oil sector and amplify risks to our energy security? What will renewed uncertainty surrounding the role of nuclear power mean for future energy and environmental trends? Is the gap between our climate actions and our climate goals becoming insurmountable? World Energy Outlook 2011 tackles these and other pressing questions. The latest data, policy developments, and the experience of another turbulent year are brought together to provide robust analysis and insight into global energy markets. WEO-2011 once again gives detailed energy demand and supply projections out to 2035, broken down by region, fuel, sector and scenario.
    Pages: Online-Ressource (130 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...