ALBERT

Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.

Note: Cover; Title Page; Copyright Page; Dedication Page; Table of Contents; Acknowledgments; Part One: Prehistory; 1. Introduction; 2. Sex and Salesmanship; 3. Seduction and the Emotions; 4. Social Primates; Part Two: Today; 5. Testing for Talent; 6. What Do Women Want?; 7. Coalitions of the Willing; 8. The Scarcity of Charm; 9. The Tender War; Notes; References; Index.

Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; PART I. THE COMPLEXITY FRAME FOR POLICY; Chapter 1. Twin Peaks; Chapter 2. Government With, Not Versus, the Market; Chapter 3. I Pencil Revisited: Beyond Market Fundamentalism; Chapter 4. The Complexity Policy Frame; PART II. EXPLORING THE FOUNDATIONS; Chapter 5. How Economics Lost the Complexity Vision; Chapter 6. How Macroeconomics Lost the Complexity Vision; Chapter 7. Complexity: A New Kind of Science?; Chapter 8: A New Kind of Complexity Economics?; Chapter 9. Nudging toward a Complexity Policy Frame. , PART III. LAISSEZ-FAIRE ACTIVISM IN PRACTICEChapter 10. The Economics of Influence; Chapter 11. Implementing Influence Policy; Chapter 12. Laissez-Faire Activism; Chapter 13. Getting the Ecostructure of Government Right; PART IV. THE LOST AGENDA; Chapter 14. Getting the Ecostructure of Social Science Education Right; Chapter 15. The Lost Agenda; Notes; Bibliography; Index.

Note: Classical theory of comparative advantageComparative advantage with two factors of production -- Comparative advantage and factor endowments : the Heckscher-Ohlin theorem -- Imperfect competition and economies of scale in trade -- The partial equilibrium analysis of international trade -- Trade restrictions : tariffs -- Non-tariff trade barriers -- Domestic support policies and trade -- Multilateral trade negotiations and U.S. trade policy -- Economic integration -- Foreign exchange markets and the exchange rate -- Agricultural trade and the exchange rate -- International capital movements and multinational corporations -- Agricultural trade and economic development -- Trade and the environment..

Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.

Note: Univ. of Western Australia, Diss. von D. Müller--Nedlands , Pages 1-2, Introduction --- Pages 3-10, Definitions and Nomenclature --- Pages 11-39, Tectonic settings of potassic igneous rocks --- Pages 41-64, Selected type-localities of potassic igneous rocks from the five tectonic settings --- Pages 65-84, Primary enrichment of precious metals in potassic igneous rocks --- Pages 85-134, Direct associations between potassic igneous rocks and gold-copper deposits --- Pages 135-158, Indirect associations between lamprophyres and gold-copper deposits --- Pages 159-171, Halogen contents of mineralized versus unmineralized potassic igneous rocks --- Pages 173-176, Implications for mineral exploration --- Pages 177-200, Characteristics of some gold-copper deposits associated with potassic igneous rocks

Note: IntroductionMain Assumptions of the Assignment Process -- Definition of Collapse -- Proposing a Range for Fatality Rates in a Collapsed Building -- Assignments of judgment-based fatality rates -- Conclusions. ..

Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System

Note: 1. Eine kurze Geschichte der Wissenschaftskommunikation 3 Schlüsselideen -- 2. Wissenschaft und Gesellschaft: Vom Elfenbeinturm auf den Marktplatz -- 3. Technik und Gesellschaft -- 4. Öffentlichkeit: Wen erreicht Wissenschaftskommunikation? -- 5. Dimensionen der Verständlichkeit -- 6. Erklärungen: Gute Bekannte oder falsche Freunde? -- 7. Bildung: Wer sollte was über Wissenschaft wissen? -- 8. Kontroversen: Ein Schlüssel zur Wissenschaftskommunikation -- 9. isiko: Zwischen Wahrnehmung und Konstrukt -- 10. Vertrauen: Eine Art der Komplexitätsreduktion -- 11 Einstellungen und Rezeption -- 12. Akzeptanz: Ziel oder Unwort? -- Akteure und Ansätze -- 13. Wissenschaftler als Kommunikatoren -- 14. Schule und andere Lernorte -- 15. Experimente: Jeder ist ein Forscher -- 16. Gläserne Wissenschaft -- 17. Journalisten und Medien -- 18. Wissenschaftskommunikation in sozialen Netzwerken -- 19. Wissenschaftskommunikation als Marketing -- 20. Wissenschaft berät Politik und Gesellschaft -- 21. Dialog: Austausch auf Augenhöhe und in beide Richtungen -- Fallbeispiele -- 22. Evolutionstheorie: Wissen, Glauben, Kontroverse -- 23. Chemie: Vom Umweltproblem zum Problemlöser? -- 24. Nanotechnologie: Visionen, Definitionen, Kontroversen -- 25. Kernenergie: Von der Hochglanzbroschüre zum Vertrauensverlust -- 26. Gentechnik: Verhärtete Fronten oder kommunikativer Neubeginn?- Epilog -- 27. Aktuelle Herausforderungen und Ziele..

Note: CONTENTS; List of Figures; List of Tables; List of Contributors; Introduction; PART I: ECONOMISTS ON TRIAL; 1. Who predicted the crisis and what can we learn from them? ; 2 A brief note on economic recessions, banking reform and the future of capitalism; 3 Understanding crisis: on the meaning of uncertainty and probability; 4 Financial crisis and risk measurement: the historical perspective and a new methodology; 5 Did economic analysis fail in the current financial crisis?; PART II: WHAT DOES HISTORY TELL US? ; 6 Does the current global crisis remind us of the Great Depression?. , 7 Innovation, growth, cycles and finance: three (or four or more) stories from the 1930s and their lessons8 Epic Recession and economic theory; 9 Did asset prices cause the current crisis?; 10 The role of the history of economic thought in the development of economic theory and policy; PART III: COUNTRY CASES IN A GLOBAL CRISIS; 11. Testimony to the Financial Crisis Inquiry Commission by Alan Greenspan; 12 Long-term depression and new markets: economists and the 2008 recession; 13 Manifestations of the global crisis in a small open economy. , 14 The aftermath of a long decade of real nil interest rates (Spain 1996-2008)Index.

Note: Foreword; Prologue; Acknowledgements; Contents; Chapter 1: Early Earth Systems; 1.1 Archaean and Proterozoic Atmospheres; 1.2 Early Biospheres; 1.3 Greenhouse States and Glaciations; Chapter 2: Phanerozoic Life and Mass Extinctions of Species; 2.1 Acraman Impact and Acritarchs Radiation; 2.2 Cambrian and Late Ordovician Mass Extinction; 2.3 Late and End-Devonian Mass Extinctions; 2.4 Late Permian and Permian-Triassic Mass Extinctions; 2.5 End-Triassic Mass Extinction; 2.6 Jurassic-Cretaceous Extinction; 2.7 K-T (Cretaceous-Tertiary Boundary) Mass Extinction; 2.8 Paleocene-Eocene Extinction. , 2.9 The End-Eocene FreezeChapter 3: Cenozoic Biological Evolution (by Colin Groves); 3.1 The Evolution of Mammals; 3.2 From Primates to Humans; 3.3 From Genetic Evolution to Cultural Evolution; Chapter 4: Fire and the Biosphere; 4.1 An Incendiary Biosphere; 4.2 The Deep-Time History of Fire; 4.3 Fire and Pre-historic Human Evolution; 4.4 Neolithic Burning and Early Civilizations; Chapter 5: The Anthropocene; 5.1 The Modern Atmosphere; 5.2 Neolithic Burning and Early Global Warming; 5.3 The Great Carbon Oxidation Event; 5.4 The Sixth Mass Extinction of Species; 5.5 The Faustian Bargain. , 5.6 The Post-anthropocene WorldChapter 6: Rare Earth; Chapter 7: Prometheus: An Epilogue; References; About the Book and the Authors; Index.

Note: Stuttgart, Univ., Diss., 2015

Note: Preface; Contributors; Content; Introduction; Cosmology - The Largest Possible Model?; The Standard Model of Cosmology as a Tool for Interpretation and Discovery; Patterns in Physical and Biological Systems; Symmetry and the Explanation of Organismal Form; Pluralistic Modeling of Complex Systems; The Methodological Challenges of Complex Systems; Contested Modeling: The Case of Economics; A Unifying Approach to High- and Low-Level Cognition; High-vs Low-Level Cognition and the Neuro- Emulative Theory of Mental Representation. , Evaluating a Computational Model of Eye-Movement Control in ReadingConsidering Criteria for Model Modification and Theory Change in Psychology; Identification of Kinetic Models by Incremental Refinement; Kinetics, Models, and Mechanism; Modeling Complexity: The Case of Climate Science; Chaos, Plurality, and Model Metrics in Climate Science; Subject Index; Author Index.

Note: Enth. u.a.: Zur Bestimmung der Ausdehnung von Materialien am Abbe-Fizeauschen Dilatometer / von W. Bein

Note: Contents: Einleitung: Kulturräumliche Unterschiede im Umgang mit Klimawandel? ; Klimakulturen und Raum: Theoretische Grundlagen ; Klimawandel-Konstruktionen in den Naturwissenschaften: Grundbegriffe und Wissensgenese ; Resilienzkonstruktionen als Klimaschutz- und Klimaanpassungspraktiken: Eine Einführung in diskutierte Kernstrategien der Raumentwicklung ; Erklärungen für klimakulturelle Differenzen: Sozialwissenschaftliche Diskurse und Ableitung von Hypothesen ; Zur (Re-) Konstruktion klimapolitisch-administrativer Rahmungen im Untersuchungsraum ; Empirisches Vorgehen ; Kommunikation zu Klimawandel an europäischen Küsten ; Vulnerabilitätskonstruktionen an europäischen Küsten ; Resilienzkonstruktionen an europäischen Küsten ; Fazit

Note: The democratic promiseThe deliberative turn in democratic theory -- The elusive concept of empathy -- Empathy in deliberative theory -- Empathy's importance : the empirical evidence -- Deliberative democracy and its critics -- Empathy and democracy..

Note: Book Cover; Title; Copyright; Contents; Figures; Tables; Contributors; Preface; Acknowledgements; 1 Introduction; Part I The Arctic: Context, framework and methodology; 2 Framing oil and gas in the Arctic from a sustainable development perspective; 3 Climate change and consequences for the Arctic; 4 Corporate social responsibility: The economic and institutional responsibility of business in society; 5 Framework and methodology: Regulation and discourse analysis as a research strategy; Part II Legal and institutional framework: Case studies. , 6 Legal and institutional framework: A comparative analysis7 Expanding oil and gas activities on the North Slope of Alaska; 8 Oil and gas activities at the Mackenzie Delta, in Canada's Northwest Territories; 9 Going North: The new petroleum province of Norway; 10 The Russian model: Merging profit and sustainability; Part III Comparisons and managerial implications; 11 Human rights and indigenous peoples in the Arctic: What are the implications for the oil and gas industry?; 12 Perceptions of Arctic challenges: Alaska, Canada, Norway and Russia compared; 13 Managerial implications; Index.

Note: IntroductionSingle-particle motions -- Plasmas as fluids -- Waves in plasmas -- Diffusion and resistivity -- Equilibrium and stability -- Kinetic theory -- Nonlinear effects -- Special plasmas -- Plasma applications..

Note: Introduction; Space weather forecasting historically viewed through the lens of meteorology; The Sun as the prime source of space weather; The coupling of the solar wind to the Earth's magnetosphere; Major radiation environments in the heliosphere and their implications for interplanetary travel; Radiation belts and ring current; Ionospheric response; Solar effects in the middle and lower stratosphere and probable associations with the troposphere; Space weather effects on communications; Space weather effects on power grids; Space weather impacts on space radiation protection. , Effects on spacecraft hardware and operationsEffects on satellite navigation; Forecasting space weather.

Note: Einleitung --- I Angewandte Mathematik und Grundlagen für das Machine Learning --- Lineare Algebra --- Wahrscheinlichkeits- und Informationstheorie --- Numerische Berechnung --- Grundlagen für das Machine Learning --- II Tiefe Netze: Zeitgemäße Verfahren --- Tiefe Feedforward-Netze --- Regularisierung --- Optimierung beim Trainieren von tiefen Modellen --- CNNs --- Sequenzmodellierung: RNNs und rekursive Netze --- Praxisorientierte Methodologie --- Anwendungen --- III Deep-Learning-Forschung --- Lineare Faktorenmodelle --- Autoencoder --- Representation Learning --- Strukturierte probabilistische Modelle für Deep Learning --- Monte-Carlo-Verfahren --- Die Partitionsfunktion --- Approximative Inferenz --- Tiefe generative Modelle --- Literaturverzeichnis --- Abkürzungsverzeichnis --- Index

Note: 1.1. The Early History of Glass; 1.2. Glass and Science; 1.3. The Discovery of Natural Melts; 1.4. The Physical Chemistry of Melts; 1.5. Summary Remarks; References; Chapter 2. Glass Versus Melt; 2.1. Relaxation; 2.2. Glass Transition; 2.3. Configurational Properties; 2.4. Summary Remarks; References; Chapter 3. Glasses and Melts vs. Crystals; 3.1. Basics of Silicate Structure 3.2. Thermodynamic Properties3.3. Liquid-Like Character of Crystals; 3.4. Summary Remarks; References; Chapter 4. Melt and Glass Structure -- Basic Concepts; 4.1. Bond Length, Bond Angle, and Bond Strength in Silicates; 4.2. Network-Formers; 4.3. Network-Modifying Cations and Linkage between Structural Units; 4.4. Bonding, Composition and Effects on Melt Properties; 4.5 Mixing, Order, and Disorder; 4.6. Summary Remarks; References; Chapter 5. Silica -- A Deceitful Simplicity; 5.1. An Outstanding Oxide; 5.2. Physical Properties; 5.3. Structure of SiO2 Glass and Melt 5.4. Effects of Pressure and Temperature5.5. Summary Remarks; References; Chapter 6. Binary Metal Oxide-Silica Systems -- I. Physical Properties; 6.1. Phase Relationships; 6.2. Thermodynamics of Mixing; 6.3. Volume and Transport Properties; 6.4. Summary Remarks; References; Chapter 7. Binary Metal Oxide-Silica Systems -- II. Structure; 7.1. Pseudocrystalline Models of Melt Structure; 7.2. Thermodynamic Modeling and Melt Structure; 7.3. Numerical Simulation of Melt Structure; 7.4. Structure from Direct Measurements; 7.5. Structure and Melt Properties; 7.6. Summary Remarks; References Chapter 8. Aluminosilicate Systems -- I. Physical Properties8.1. Phase Relationships; 8.2. Thermodynamics of Mixing; 8.3. Volume and Viscosity; 8.4. Summary Remarks; References; Chapter 9. Aluminosilicate Systems -- II. Structure; 9.1. Binary Al2O3-Bearing Glasses and Melts; 9.2. Meta-Aluminosilicate Glasses and Melts (SiO2-M1/xAlO2); 9.3. Peralkaline Aluminosilicate Glasses and Melts; 9.4. Pressure and the Structure of Aluminosilicate Melts; 9.5. Structure and Properties of Aluminosilicate Melts; 9.6. Summary Remarks; References; Chapter 10. Iron-bearing Melts -- I. Physical Properties 10.1 Ferrous and Ferric Iron10.2. Phase Equilibria; 10.3. Iron Redox Reactions; 10.4. Physical Properties; 10.5. Summary Remarks; References; Chapter 11. Iron-bearing Melts -- II. Structure; 11.1. Ferric Iron; 11.2. Ferrous Iron; 11.3. Ferric and Ferrous Iron in Silicate Melts at High Temperature; 11.4. Iron in Silicate Melts and Glasses at High Pressure; 11.5. Summary Remarks; References; Chapter 12. The Titanium Anomalies; 12.1. Phase Relations and Glass Formation; 12.2. Physical Properties; 12.3. Structure of Titanosilicate Glasses and Melts; 12.4. High-Temperature Studies

Note: The present and future of rock testing: highlighting the ISRM suggested methods Laboratory testing Suggested method for determination of the Schmidt Hammer rebound hardness: revised version Suggested methods for determining the dynamic strength parameters and mode-I fracture toughness of rock materials Suggested method for the determination of mode II fracture toughness Suggested method for reporting rock laboratory test data in electronic format Upgraded suggested method for determining sound velocity by ultrasonic pulse transmission technique Suggested method for determining the abrasivity of rock by the Cerchar Abrasivity test Suggested method for determining the mode I static fracture toughness using semi-circular bend specimen Suggested methods for determining the creep characteristics of rock Suggested method for laboratory determination of the shear strength of rock joints: revised version Suggested method for the needle penetration test Field testing Suggested method for rock fractures observations using a borehole digital optical televiewer Suggested method for measuring rock mass displacement using a sliding micrometer Suggested method for step-rate injection method for fracture in-situ properties (SIMFIP): Using a 3-Components Borehole Deformation Sensor Suggested Methods for rock stress estimation—Establishing a model for the in situ stress at a given site Monitoring Suggested method for monitoring rock displacements using the global positioning system (GPS) Suggested methods for rock failure criteria: general introduction Introduction to suggested methods for failure criteria Mohr–Coulomb failure criterion The Hoek–Brown failure criterion Three-dimensional failure criteria based on the Hoek–Brown criterion Drucker-Prager criterion Lade and modified Lade 3D rock strength criteria A failure criterion for rocks based on true triaxial testing A survey of 3D laser scanning techniques for application to rock mechanics and rock engineering

Note: Contents Summary 1. Introduction 1.1 Background 1.1.1 Precipitation changes 1.1.2 Large-scale atmospheric patterns 1.2 Objectives and research questions 1.3 Thesis outline and author contribution High spatial and temporal organization of changes inprecipitation over Germany for 1951–2006 2.1 Introduction 2.2 Data 2.3 Methods 2.3.1 Threshold between wet and dry days 2.3.2 Derivation of time series of precipitation characteristics 2.3.3 Trend analyses under consideration of temporal and spatial correlation 2.3.4 Visualization of results 2.4 Results and discussion 2.4.1 Changes in total precipitation 2.4.2 Changes in mean, variability, and heavy precipitation indicators 2.4.3 Transition probabilities 2.4.4 Seven-day precipitation amount with return period 100 years 2.5 Conclusions Can local climate variability be explained by weatherpatterns? A multi-station evaluation for the Rhine basin 3.1 Introduction 3.2 Data 3.3 Methods 3.3.1 Weather pattern classification 3.3.2 Finding optimal classification parameters 3.3.3 Evaluation of classifications 3.4 Results 3.4.1 Stratification of local climate variables 3.4.2 Performance of GCMs 3.5 Discussion 3.5.1 On the optimal classification 3.5.2 On the skill of GCMs 3.6 Conclusions 3.7 Data availability 3.A Appendix Do changing weather types explain observed climatictrends in the Rhine basin? An analysis of within andbetween-type changes 4.1 Introduction 4.2 Data and weather pattern classification 4.3 Methods 4.3.1 Relationship of WPs and large-scale circulation modes 4.3.2 Trend detection methods 4.3.3 Relative share of between- and within-type changes 4.4 Results 4.4.1 Attribution of WPs to large-scale circulation modes 4.4. 2Between-Type Changes 4.4.3 Within-Type Changes 4.4.4 Relative share of between- and within-type changes 4.5 Discussion and conclusions 4.A Appendix 4.S Supplementary Discussion and conclusions 5.1 Main results 5.2 Discussion and directions for further research 5.2.1 Weather pattern classification for downscaling 5.2.2 Limitations for downscaling 5.3 Concluding remarks Bibliography

Note: Contents 1 Dynamical Processes in the Arctic Atmosphere / Marius O. Jonassen, Dmitry Chechin, Alexey Karpechko,Christof Lüpkes, Thomas Spengler, Annick Tepstra, Timo Vihma,and Xiangdong Zhang 2 Thermodynamics of the Arctic Atmosphere / Claudio Tomasi, Boyan H. Petkov, Oxana Drofa, and Mauro Mazzola 3 Trace Gases in the Arctic Atmosphere / Kimberly Strong, William R. Simpson, Kristof Bognar,Rodica Lindenmaier, and Sébastien Roche 4 Arctic Aerosols / Roberto Udisti, Rita Traversi, Silvia Becagli, Claudio Tomasi,Mauro Mazzola, Angelo Lupi, and Patricia K. Quinn 5 A Climatological Overview of Arctic Clouds / Abhay Devasthale, Joseph Sedlar, Michael Tjernström,and Alexander Kokhanovsky 6 Arctic Ice Fog: Its Microphysics and Prediction / Ismail Gultepe, Andrew J. Heymsfield, and Martin Gallagher 7 Polar Stratospheric Clouds in the Arctic / Francesco Cairo and Tiziana Colavitto 8 Noctilucent Clouds: General Properties and Remote Sensing / Christian von Savigny, Gerd Baumgarten, and Franz-Josef Lübkenix 9 Remote Sensing of Arctic Atmospheric Aerosols / Alexander Kokhanovsky, Claudio Tomasi, Alexander Smirnov,Andreas Herber, Roland Neuber, André Ehrlich, Angelo Lupi, Boyan H. Petkov, Mauro Mazzola, Christoph Ritter, Carlos Toledano,Thomas Carlund, Vito Vitale, Brent Holben, Tymon Zielinski,Simon Bélanger, Pierre Larouche, Stefan Kinne, Vladimir Radionov,Manfred Wendisch, Jason L. Tackett, and David M. Winker 10 Radiation in the Arctic Atmosphere and Atmosphere –Cryosphere Feedbacks / Claudio Tomasi, Boyan H. Petkov, Angelo Lupi, Mauro Mazzola,Christian Lanconelli, and Ismail Gultepe 11 Climate Change in the Arctic / Torben Koenigk, Jeff Key, and Timo Vihma Index

Note: Integrated Fault Seal Analysis: An Introduction / Steven R. Ogilvie, Steve J. Dee, Robert W. Wilson and Wayne R. Bailey / Geological Society, London, Special Publications, 496, 1-8, 7 May 2020, https://doi.org/10.1144/SP496-2020-51 --- Fault seal behaviour in Permian Rotliegend reservoir sequences: case studies from the Dutch Southern North Sea / K. van Ojik, A. Silvius, Y. Kremer and Z. K. Shipton / Geological Society, London, Special Publications, 496, 9-38, 13 November 2019, https://doi.org/10.1144/SP496-2018-189 --- An experimental and numerical investigation on the hydromechanical behaviour of carbonate fault zones upon reactivation: the impact of carbonate mud sealing layers and overall research outcomes / M. Nogueira Kiewiet, C. Lima, A. Giwelli, C. Delle Piane, V. Lemiale, L. Esteban, F. Falcao, M. B. Clennell, J. Dautriat, L. Kiewiet, J. Raimon, S. Kager and D. Dewhurst / Geological Society, London, Special Publications, 496, 39-73, 8 November 2019, https://doi.org/10.1144/SP496-2018-153 --- Fault failure modes, deformation mechanisms, dilation tendency, slip tendency, and conduits v. seals / David A. Ferrill, Kevin J. Smart and Alan P. Morris / Geological Society, London, Special Publications, 496, 75-98, 16 December 2019, https://doi.org/10.1144/SP496-2019-7 --- Fault zone architecture and its scaling laws: where does the damage zone start and stop? / A. Torabi, T. S. S. Ellingsen, M. U. Johannessen, B. Alaei, A. Rotevatn and D. Chiarella / Geological Society, London, Special Publications, 496, 99-124, 11 October 2019, https://doi.org/10.1144/SP496-2018-151 --- Fault fictions: systematic biases in the conceptualization of fault-zone architecture / Z. K. Shipton, J. J. Roberts, E. L. Comrie, Y. Kremer, R. J. Lunn and J. S. Caine / Geological Society, London, Special Publications, 496, 125-143, 16 December 2019, https://doi.org/10.1144/SP496-2018-161 --- Validation and analysis procedures for juxtaposition and membrane fault seals in oil and gas exploration / Titus A. Murray, William L. Power, Anthony J. Johnson, Greg J. Christie and David R. Richards / Geological Society, London, Special Publications, 496, 145-161, 11 November 2019, https://doi.org/10.1144/SP496-2018-171 --- Stochastic modelling of fault gouge zones: implications for fault seal analysis / Neil T. Grant / Geological Society, London, Special Publications, 496, 163-197, 24 October 2019, https://doi.org/10.1144/SP496-2018-135 --- Efficient handling of fault properties using the Juxtaposition Table Method / Tor Anders Knai and Guillaume Lescoffit / Geological Society, London, Special Publications, 496, 199-207, 23 March 2020, https://doi.org/10.1144/SP496-2018-192 --- A knowledge database of hanging-wall traps that are dependent on fault-rock seal / Peter G. Bretan, Graham Yielding and Einar Sverdrup / Geological Society, London, Special Publications, 496, 209-222, 27 September 2019, https://doi.org/10.1144/SP496-2018-157 --- Subsurface observations of deformation bands and their impact on hydrocarbon production within the Holstein Field, Gulf of Mexico, USA / Scott J. Wilkins, Russell K. Davies and Steve J. Naruk / Geological Society, London, Special Publications, 496, 223-252, 11 October 2019, https://doi.org/10.1144/SP496-2018-139 --- Enhancing trap and fault seal analyses by integrating observations from HR3D seismic data with well logs and conventional 3D seismic data, Texas inner shelf / Johnathon L. Osmond and Timothy A. Meckel / Geological Society, London, Special Publications, 496, 253-279, 19 December 2019, https://doi.org/10.1144/SP496-201

Note: Inhaltsverzeichnis Vorwort zur dritten Auflage Einleitung Exzellenzfaktor Personalführung Prämissen effizienter Führung Optimierungspotenziale Motivationsfaktor Personalführung Strategische Planung Elemente der Strategie Strategie als Qualitätsmerkmal Strategie- und Leitbildentwicklung Führungsmodelle Situative Führung Transformationale Führung Führungsinstrumente Mitarbeiterinnengespräche Leistungsfeedback Zielvereinbarungen Personalentwicklung Führungsfeedback Effizientes Delegieren Effekte und Nutzen „Smart" delegieren Berichtswesen und Dokumentation Problemfaktor Rückdelegation Delegationspotenziale Laterale und agile Führung Führung ohne Weisungsbefugnis Agile Führung Führungskultur und -Struktur Funktionale Strukturen Förderung der Verantwortung Verhaltensorientierte Führung Zielführende Kommunikation Kulturmerkmal Verbindlichkeit Team-Management Teamentwicklung Abstimmung im und mit dem Team Interkulturelle Führung und Diversität Interkulturelles Management Kulturübergreifende Kommunikation Abstimmung in interkulturellen Teams Personalauswahl und -gewinnung Auswahlkriterien Auswahlinterviews Praktisches Vorgehen Changemanagement Grundlagen Partizipatives Vorgehen Erste und neue Führungspositionen Gestern Kollegin - Heute Chefin Führung als Nachfolge Erneuern und Bewahren Führen mit Konzept Mitarbeiterinnenbeteiligen Strategisches Selbstmanagement Grundlagen Zeitdiebe und -fallen Life Balance Anhang Quellennachweis Arbeitsmittel - Tools - Checklisten Meine strategische Planung Reflexion des eigenen Führungsverhaltens Gesprächsleitfaden Mitarbeiterinnengespräche Leistungsbeurteilung/-feedback Vorbereitung Mitarbeiterinnengespräch Dokumentation Zielvereinbarung Personalentwicklung Führungsfeedback einholen Teamanalyse Vorgehen bei Team-Klausuren/-workshops/Retreats Matrix zur Auswahl von Mitarbeiterinnen bei Personalentscheidungen Denkzettel (zur Vermeidung von Rückdelegationen) Delegationspotenziale erkennen: Protokoll Delegationspotenziale erkennen: Auswertung Der 100-Tage-Plan bei Antritt einer neuen Führungsfunktion Register Informationen zum Autor

Note: Table of Contents Preface Chapter 1. North-East Eurasia (Siberia) in the Context of World History: New Concepts / Vladislav Kokoulin and Igor Likhomanov Chapter 2. The Past, Present, and Future of the use of the Agricultural Soils of Siberia / W. Halicki and K. Kita Chapter 3. Agroecological Monitoring of the Carbon Transformation in Agroecosystems on Gray Forest Soils of the Baikal Region under Current Climatic Changes and Conditions of Fluoride Pollution / L. V. Pomazkina and Yu. V. Semenova Chapter 4. Ecology of Avian Influenza Viruses in Siberia / Maria Alessandra De Marco, Kirill Sharshov, Marina Gulyaeva, Mauro Delogu, Lorenzo Ciccarese, Maria Rita Castrucci, Alexander Shestopalov Chapter 5. Assessment of Biogenic Substances of Selected Terrestrial Waters in the Northern Part of Western Siberia: Significance for Ecology and Climate Change / W. Halicki, M. W. Kochanska and S. N. Kirpotin Chapter 6. Quality Assessment of Selected Surface Waters of the Arctic Tundra of Western Siberia in the Context of Climate Change / W. Halicki, M.W. Kochanska and S.N. Kirpotin Index

Note: Table of Contents Part 1: Introduction Arthur Holmes Frederick Henry Stewart Geological Society, London, Special Publications, 1, 1-11, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.03 The history of attempts to establish a quantitative time-scale L. R. Wager Geological Society, London, Special Publications, 1, 13-28, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.04 A review of recent Phanerozoic time-scales N. J. Snelling Geological Society, London, Special Publications, 1, 29-36, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.05 Sedimentation rates in relation to the Phanerozoic time-scale J. D. Hudson Geological Society, London, Special Publications, 1, 37-42, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.06 The relationship between radiometric ages obtained from plutonic complexes and stratigraphical time R. St J. Lambert Geological Society, London, Special Publications, 1, 43-54, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.07 The geological significance of radiometric age studies on volcanic and hypabyssal rocks F. J. Fitch and J. A. Miller Geological Society, London, Special Publications, 1, 55-69, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.08 Part 2: Radiometric Methods with Respect to the Time-Scale Uranium–thorium–lead age-determinations with respect to the phanerozoic time-scale A. G. Darnley Geological Society, London, Special Publications, 1, 73-86, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.09 The rubidium–strontium method Stephen Moorbath Geological Society, London, Special Publications, 1, 87-99, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.10 Potassium—argon methods with special reference to basic igneous rocks John Alfred Miller and Frank John Fitch Geological Society, London, Special Publications, 1, 101-117, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.11 Potassium—argon ages of sedimentary and pyroclastic rocks Halfdan Baadsgaard and Martin Henry Dodson Geological Society, London, Special Publications, 1, 119-127, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.12 Potassium—argon decay constants and age tables Alan Gilbert Smith Geological Society, London, Special Publications, 1, 129-141, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.13 Part 3: Original Data Glauconite dates from the Upper Jurassic and Lower Cretaceous Martin Henry Dodson, David Charles Rex, Raymond Casey and Percival Allen Geological Society, London, Special Publications, 1, 145-158, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.14 The age of the paroxysmal Variscan orogeny in England Frank Joseph Fitch and John Alfred Miller Geological Society, London, Special Publications, 1, 159-175, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.15 Part 4: Stratigraphical Review The Tertiary period Brian Michael Funnell Geological Society, London, Special Publications, 1, 179-191, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.16 The Cretaceous period Raymond Casey Geological Society, London, Special Publications, 1, 193-202, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.17 The Jurassic period Michael Kingsley Howarth Geological Society, London, Special Publications, 1, 203-205, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.18 The Triassic period Edward Timothy Tozer Geological Society, London, Special Publications, 1, 207-209, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.19 The Permian period Denys Barker Smith Geological Society, London, Special Publications, 1, 211-220, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.20 The Carboniferous period Edward Howel Francis and Austin William Woodland Geological Society, London, Special Publications, 1, 221-232, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.21 The Devonian period Peter Furneaux Friend and Michael Robert House Geological Society, London, Special Publications, 1, 233-236, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.22 The Silurian period I. Strachan Geological Society, London, Special Publications, 1, 237-240, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.23 The Ordovician period H. B. Whittington and A. Williams Geological Society, London, Special Publications, 1, 241-254, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.24 The Cambrian period J. W. Cowie Geological Society, London, Special Publications, 1, 255-258, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.25 GENERAL DISCUSSION OF PAPAERS IN PART 4S Geological Society, London, Special Publications, 1, 259, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.26 Summary of the Phanerozoic time-scale: the Geological Society Phanerozoic time-scale 1964 Geological Society, London, Special Publications, 1, 260-262, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.27 Part 5: Abstracts of Published Radiometric and Stratigraphical Data with Comments Introduction Geological Society, London, Special Publications, 1, 265-268, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.28 Items Geological Society, London, Special Publications, 1, 269-442, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.29 Erratum Errata Geological Society, London, Special Publications, 1, 443, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.01 Corrigenda Geological Society, London, Special Publications, 1, 444, 1 January 1964, https://doi.org/10.1144/GSL.SP.1964.001.01.30

Note: Table of contents Acknowledgements Chapter 1 - The restless ocean Chapter 2 - Frameworks, data, and methods Chapter 3 - Surface drift, gyres, and the fate of plastic Chapter 4 - Western boundary currents and drifting organisms Chapter 5 - Eastern boundary currents, upwelling, and high biological productivity Chapter 6 - The tropical oceans, interannual climate variability, and ecosystem adaptation Chapter 7 - From the northern subpolar oceans to the Arctic and its retreating sea ice Chapter 8 - From the Southern Ocean to Antarctica and its changing ice shelves Chapter 9 - Processes and flows in marginal seas Chapter 10 - Ocean boundaries, connectivity, and inter-ocean exchanges Chapter 11 - The global circulation and transformation of water masses Chapter 12 - Ocean currents, heat transport, and climate Epilogue: Looking ahead Index

Note: Contents List of contributors Preface 1 Antarctic Climate Evolution - second edition 1.1 Introduction 1.2 Structure and content of the book Acknowledgements References 2 Sixty years of coordination and support for Antarctic science - the role of SCAR 2.1 Introduction 2.2 Scientific value of research in Antarctica and the Southern Ocean 2.3 The international framework in which SCAR operates 2.4 The organisation of SCAR 2.5 Sixty years of significant Antarctic science discoveries 2.6 Scientific Horizon Scan 2.7 Summary References Appendix 3 Cenozoic history of Antarctic glaciation and climate from onshore and offshore studies 3.1 Introduction 3.2 Long-term tectonic drivers and ice sheet evolution 3.3 Global climate variability and direct evidence for Antarctic ice sheet variability in the Cenozoic 3.3.1 Late Cretaceous to early Oligocene evidence of Antarctic ice sheets and climate variability 3.3.2 The Eocene-Oligocene transition and continental-scale glaciation of Antarctica 3.3.3 Transient glaciations of the Oligocene and Miocene 3.3.4 Pliocene to Pleistocene 3.4 Regional seismic stratigraphies and drill core correlations, and future priorities to reconstruct Antarctica's Cenozoic 3.4.1 Ross Sea 3.4.2 Amundsen Sea 3.4.3 Bellingshausen Sea and Pacific coastline of Antarctic Peninsula 3.4.4 The Northern Antarctic Peninsula and South Shetland Islands 3.4.5 The Eastern Margin of the Antarctic Peninsula 3.4.6 The South Orkney Microcontinent and adjacent deep-water basins 3.4.7 East Antarctic Margin 3.4.7.1 Weddell Sea 3.4.7.1.1 Gondwana break-up, Weddell Sea opening and pre-ice-sheet depositional environment 3.4.7.1.2 The Eocene-Oligocene transition and paleoenvironment during increasing glacial conditions 3.4.7.1.3 Recent geophysical survey beneath the Ekström Ice Shelf and future directions for drilling 3.4.7.2 Prydz Bay 3.4.7.2.1 Early Cenozoic greenhouse and earliest glacial phase in late Eocene 3.4.7.2.2 Oligocene-Miocene ice-sheet development 3.4.7.2.3 The Polar Ice Sheet (late Miocene(?)-Pleistocene) 3.4.7.3 East Antarctic Margin - Sabrina Coast 3.4.7.4 Wilkes Land margin and Georges V Land 3.5 Summary, future directions and challenges Acknowledgements References 4 Water masses, circulation and change in the modern Southern Ocean 4.1 Introduction 4.1.1 Defining the Southern Ocean 4.2 Water masses - characteristics and distribution 4.2.1 Upper ocean 4.2.2 Intermediate depth waters 4.2.3 Deep water 4.2.4 Bottom water 4.3 Southern Ocean circulation 4.3.1 Antarctic Circumpolar Current (ACC) 4.3.2 Southern Ocean meridional overturning circulation (SOMOC) 4.3.3 Deep western boundary currents 4.3.3.1 Pacific deep western boundary current 4.3.3.2 Indian deep western boundary currents 4.3.3.3 Atlantic deep western boundary current 4.3.4 Subpolar circulation - gyres, slope and coastal currents 4.3.4.1 Gyres 4.3.4.2 Antarctic slope and coastal currents 4.4 Modern Southern Ocean change 4.4.1 Climate change 4.4.2 Ocean change 4.4.3 Change in dynamics and circulation 4.5 Concluding remarks References 5 Advances in numerical modelling of the Antarctic ice sheet 5.1 Introduction and aims 5.2 Advances in ice sheet modelling 5.2.1 Grounding line physics 5.2.2 Adaptive grids 5.2.3 Parallel ice sheet model - PISM 5.2.4 Coupled models 5.3 Model input - bed data 5.4 Advances in knowledge of bed processes 5.5 Model intercomparison 5.6 Brief case studies 5.7 Future work References 6 The Antarctic Continent in Gondwana: a perspective from the Ross Embayment and Potential Research Targets for Future Investigations 6.1 Introduction 6.2 The Antarctic plate and the present-day geological setting of the Ross Embayment 6.3 East Antarctica 6.3.1 The Main Geological Units during the Paleoproterozoic-Early Neoproterozoic Rodinia Assemblage 6.3.2 From Rodinia breakup to Gondwana (c. 800-650 Ma) 6.3.3 The 'Ross Orogen' in the Transantarctic Mountains during the late Precambrian-early Paleozoic evolution of the paleo-Pacific margin of Gondwana (c. 600-450 Ma) 6.4 West Antarctic Accretionary System 6.4.1 West Antarctica in the Precambrian to Mesozoic (c. 180 Ma) evolution of Gondwana until the middle Jurassic breakup 6.4.1.1 Precambrian to Cambrian metamorphic basement 6.4.1.2 Devono-Carboniferous arc magmatism ('Borchgrevink Event') (c. 370-350 Ma) 6.4.1.3 Beacon Supergroup (Devonian-Permo-Triassic-earliest Jurassic) 6.4.1.4 The Ellsworth-Whitmore Mountains Terrane and the Permo-Triassic arc magmatism 6.4.1.5 Ferrar Supergroup and the Gondwana breakup (c. 180Ma) 6.4.1.6 The Antarctic Andean Orogen 6.5 Mesozoic to Cenozoic Tectonic Evolution of the Transantarctic Mountains 6.6 Tectonic evolution in the Ross Sea Sector during the Cenozoic 6.7 Concluding remarks, open problems and potential research themes for future geoscience investigations in Antarctica 6.7.1 Persistent challenges for onshore geoscience investigations 6.7.2 Antarctica and the Ross Orogen in the Transantarctic Mountains 6.7.3 Antarctica after Gondwana fragmentation Acknowledgements References 7 The Eocene-Oligocene boundary climate transition: an Antarctic perspective 7.1 Introduction 7.2 Background 7.2.1 Plate tectonic setting 7.2.2 Antarctic paleotopography 7.2.3 Paleoceanographic setting 7.2.4 Global average and regional sea level response 7.2.5 Proxies to reconstruct past Antarctic climatic and environmental evolution 7.2.6 Far-field proxies 7.3 Antarctic Sedimentary Archives 7.3.1 Land-based outcrops 7.3.1.1 Antarctic Peninsula Region 7.3.1.2 King George (25 de Mayo) Island, South Shetland Islands 7.3.1.3 The Ross Sea Region 7.3.2 Sedimentary archives from drilling on the Antarctic Margin 7.3.2.1 Drill cores in the western Ross Sea 7.3.2.2 The Prydz Bay Region 7.3.2.3 Weddell Sea 7.3.2.4 Wilkes Land 7.4 Summary of climate signals from Antarctic sedimentary archives 7.4.1 Longer-term changes 7.4.2 The climate of the Eocene-Oligocene transition 7.5 The global context of Earth and climate system changes across the EOT 7.5.1 Climate modelling 7.5.2 Relative sea-level change around Antarctica 7.6 Summary 7.6.1 Early-middle Eocene polar warmth 7.6.2 Late Eocene cooling 7.6.3 Eocene-Oligocene transition Acknowledgements References 8 Antarctic Ice Sheet dynamics during the Late Oligocene and Early Miocene: climatic conundrums revisited 8.1 Introduction 8.2 Oligocene-Miocene Transition in Antarctic geological records and its climatic significance 8.3 Conundrums revisited 8.3.1 What caused major transient glaciation of Antarctica across the OMT? 8.3.2 Apparent decoupling of Late Oligocene climate and ice volume? 8.4 Concluding remarks Acknowledgements References 9 Antarctic environmental change and ice sheet evolution through the Miocene to Pliocene - a perspective from the Ross Sea and George V to Wilkes Land Coasts 9.1 Introduction 9.1.1 Overview and relevance 9.1.2 Far-field records of climate and ice sheet variability 9.1.2.1 The Early Miocene 9.1.2.2 The mid-Miocene 9.1.2.3 The Late Miocene 9.1.2.4 The Pliocene 9.1.3 Southern Ocean Paleogeography and Paleoceanography 9.1.4 Land elevation change and influences on Antarctic Ice Sheet evolution 9.2 Records of Miocene to Pliocene climate and ice sheet variability from the Antarctic margin 9.2.1 Introduction to stratigraphic records 9.2.2 George V Land to Wilkes Land Margin 9.2.2.1 Geological setting 9.2.2.2 Oceanography of the Adelie coast 9.2.2.3 Seismic stratigraphy off the George V Land to Wilkes Land Margin 9.2.2.4 Drill core records from the George V Land to Wilkes Land Margin 9.2.2.5 Neogene history of the George V Land to Wilkes Land margin 9.2.3 The Ross Sea Embayment and Southern Victoria Land 9.2.3.1 Geological setting 9.2.3.2 Oceanography and climate in the Ross Sea Region 9.2.3.3 Seismic stratigraphic records in the Ross Sea 9.2.3.4 Stratigraphic records from drill cores in the Ross Sea 9.2.3.5 Terrestrial records from Southern Victoria Land 9.2.3.6 Neogene history in the Ross Sea Region 9.3 Numerical modelling 9.3.1 Miocene

Note: INHALT Willkommen in der Arena der Möglichkeiten! Die Public Arena im digitalen Zeitalter Kommunikation in der Public Arena Dein Navigator: Das Public Arena Framework LEITBILD Vision & Mission Ziele SET-UP Analyse Struktur Kultur Daten TAKTIK Positionierung Zielgruppen Kanäle ACTION Storytelling Content Politisches Targeting Community Mobilisierung Krise Fake News Ausblick: Was die Public Arena der Zukunft braucht Public Arena Expert:innen Interviews Das Public-Arena-Team Deep-Dive-Bibliothek Literaturverzeichnis.

Note: Contents Figures and tables Acknowledgements Introduction Part 1 Constructing the Academic Teaching Librarian 1 Shaping the academic teaching librarian 1.1 Introduction: critical issues for academic teaching librarians 1.2 Conceptions of literacy: terminology and the academic teaching librarian 1.3 New frameworks: information literacy in context 1.4 Critical information literacy 1.5 Social media and filter bubbles: the rise of 'fake news' 1.6 Learning analytics 1.7 E-research and datafied scholarship 2 Defining the academic teaching librarian 2.1 Introduction: who is the academic teaching librarian? 2.2 Professional identity and 'teacher identity' 2.3 Roles and responsibilities of academic teaching librarians 2.4 The information-literate self 2.5 Reflective practice for academic teaching librarians 2.6 Developing a personal teaching philosophy 3 Becoming an academic teaching librarian 3.1 Introduction: choosing the academic teaching librarian pathway 3.2 Looking inwards: self-analysis and the teaching role 3.3 Does a 'teaching personality' exist? 3.4 Mapping your teaching profile 3.5 Planning and developing your teaching role 3.6 Keeping current with teaching trends 3.7 Documenting and showcasing your work: teaching portfolios for librarians Part 2 Excelling as an Academic Teaching Librarian 4 Technology and the academic teaching librarian 4.1 Introduction: the digital environment for academic teaching librarians 4.2 Teaching, learning and technology: key concepts 4.3 The digital imperative in higher education 4.4 Digital education in higher education (HE): state of the art 4.5 Digital learning and the academic teaching librarian.

Note: 1. Einleitung 2. Titanomagnetite - Ursachen ihrer Stabilität 3. Gesteinsporenfüllung und elektrische Leitfähigkeit der tieferen Erdkruste 4. Elastische Gesteinsparameter 5. Wärmeleitung 6. Channnels of lower velocity increase 7. Auswertung 8. Anhang Literatur

Note: Contents 1 Introduction 1.1 Why Numerical Ecology? 1.2 Why R? 1.3 Readership and Structure of the Book 1.4 How to Use This Book 1.5 The Data Sets 1.5.1 The Doubs Fish Data 1.5.2 The Oribatid Mite Data 1.6 A Quick Reminder About Help Sources 1.7 Now It Is Time 2 Exploratory Data Analysis 2.1 Objectives 2.2 Data Exploration 2.2.1 Data Extraction 2.2.2 Species Data: First Contact 2.2.3 Species Data: A Closer Look 2.2.4 Ecological Data Transformation 2.2.5 Environmental Data 2.3 Conclusion 3 Association Measures and Matrices 3.1 Objectives 3.2 The Main Categories of Association Measures (Short Overview) 3.2.1 Q Mode and R Mode 3.2.2 Symmetrical or Asymmetrical Coefficients in Q Mode: The Double-Zero Problem 3.2.3 Association Measures for Qualitative or Quantitative Data 3.2.4 To Summarize 3.3 Q Mode: Computing Dissimilarity Matrices Among Objects 3.3.1 Q Mode: Quantitative Species Data 3.3.2 Q Mode: Binary (Presence-Absence) Species Data 3.3.3 Q Mode: Quantitative Data (Excluding Species Abundances) 3.3.4 Q Mode: Binary Data (Excluding Species Presence-Absence Data) 3.3.5 Q Mode: Mixed Types Including Categorical (Qualitative Multiclass) Variables 3.4 R Mode: Computing Dependence Matrices Among Variables 3.4.1 R Mode: Species Abundance Data 3.4.2 R Mode: Species Presence-Absence Data 3.4.3 R Mode: Quantitative and Ordinal Data (Other than Species Abundances) 3.4.4 R Mode: Binary Data (Other than Species Abundance Data) 3.5 Pre-transformations for Species Data 3.6 Conclusion 4 Cluster Analysis 4.1 Objectives 4.2 Clustering Overview 4.3 Hierarchical Clustering Based on Links 4.3.1 Single Linkage Agglomerative Clustering 4.3.2 Complete Linkage Agglomerative Clustering 4.4 Average Agglomerative Clustering 4.5 Ward's Minimum Variance Clustering 4.6 Flexible Clustering 4.7 Interpreting and Comparing Hierarchical Clustering Results 4.7.1 Introduction 4.7.2 Cophenetic Correlation 4.7.3 Looking for Inteipretable Clusters 4.8 Non-hierarchical Clustering 4.8.1 k-means Partitioning 4.8.2 Partitioning Around Medoids (PAM) 4.9 Comparison with Environmental Data 4.9.1 Comparing a Typology with External Data (ANOVA Approach) 4.9.2 Comparing Two Typologies (Contingency Table Approach) 4.10 Species Assemblages 4.10.1 Simple Statistics on Group Contents 4.10.2 Kendall's W Coefficient of Concordance 4.10.3 Species Assemblages in Presence-Absence Data 4.10.4 Species Co-occurrence Network 4.11 Indicator Species 4.11.1 Introduction 4.11.2 IndVal: Species Indicator Values 4.11.3 Correlation-Type Indices 4.12 Multivariate Regression Trees (MRT): Constrained Clustering 4.12.1 Introduction 4.12.2 Computation (Principle) 4.12.3 Application Using Packages mvpart and MVPARTwrap 4.12.4 Combining MRT and IndVal 4.13 MRT as a Monothetic Clustering Method 4.14 Sequential Clustering 4.15 A Very Different Approach: Fuzzy Clustering 4.15.1 Fuzzy c-means Using Package cluster's Function fanny () 4.15.2 Noise Clustering Using the vegclust () Function 4.16 Conclusion 5 Unconstrained Ordination 5.1 Objectives 5.2 Ordination Overview 5.2.1 Multidimensional Space 5.2.2 Ordination in Reduced Space 5.3 Principal Component Analysis (PCA) 5.3.1 Overview 5.3.2 PCA of the Environmental Variables of the Doubs River Data Using rda () 5.3.3 PCA on Transformed Species Data 5.3.4 Domain of Application of PCA 5.3.5 PCA Using Function PCA. newr () 5.3.6 Imputation of Missing Values in PCA 5.4 Correspondence Analysis (CA) 5.4.1 Introduction 5.4.2 CA Using Function cca () of Package vegan 5.4.3 CA Using Function CA. newr () 5.4.4 Arch Effect and Detrended Correspondence Analysis (DCA) 5.4.5 Multiple Correspondence Analysis (MCA) 5.5 Principal Coordinate Analysis (PCoA) 5.5.1 Introduction 5.5.2 Application of PCoA to the Doubs Data Set Using cmdscaleO and vegan 5.5.3 Application of PCoA to the Doubs Data Set Using pcoa () 5.6 Nonmetric Multidimensional Scaling (NMDS) 5.6.1 Introduction 5.6.2 Application to the Doubs Fish Data 5.6.3 PCoA or NMDS? 5.7 Hand-Written PCA Ordination Function 6 Canonical Ordination 6.1 Objectives 6.2 Canonical Ordination Overview 6.3 Redundancy Analysis (RDA) 6.3.1 Introduction 6.3.2 RDA of the Doubs River Data 6.3.3 Distance-Based Redundancy Analysis (db-RDA) 6.3.4 A Hand-Written RDA Function 6.4 Canonical Correspondence Analysis (CCA) 6.4.1 Introduction 6.4.2 CCA of the Doubs River Data 6.5 Linear Discriminant Analysis (LDA) 6.5.1 Introduction 6.5.2 Discriminant Analysis Using Ida () 6.6 Other Asymmetric Analyses 6.6.1 Principal Response Curves (PRC) 6.6.2 Co-correspondence Analysis (CoCA) 6.7 Symmetric Analysis of Two (or More) Data Sets 6.8 Canonical Correlation Analysis (CCorA) 6.8.1 Introduction 6.8.2 Canonical Correlation Analysis Using CCorA () 6.9 Co-inertia Analysis (CoIA) 6.9.1 Introduction 6.9.2 Co-inertia Analysis Using Function coinertia () of ade4 6.10 Multiple Factor Analysis (MFA) 6.10.1 Introduction 6.10.2 Multiple Factor Analysis Using FactoMineR 6.11 Relating Species Traits and Environment 6.11.1 The Fourth-Corner Method 6.11.2 RLQ Analysis 6.11.3 Application in R 6.12 Conclusion 7 Spatial Analysis of Ecological Data 7.1 Objectives 7.2 Spatial Structures and Spatial Analysis: A Short Overview 7.2.1 Introduction 7.2.2 Induced Spatial Dependence and Spatial Autocorrelation 7.2.3 Spatial Scale 7.2.4 Spatial Heterogeneity 7.2.5 Spatial Correlation or Autocorrelation Functions and Spatial Correlograms 7.2.6 Testing for the Presence of Spatial Correlation: Conditions 7.2.7 Modelling Spatial Structures 7.3 Multivariate Trend-Surface Analysis 7.3.1 Introduction 7.3.2 Trend-Surface Analysis in Practice 7.4 Eigenvector-Based Spatial Variables and Spatial Modelling 7.4.1 Introduction 7.4.2 Distance-Based Moran's Eigenvector Maps (dbMEM) and Principal Coordinates of Neighbour Matrices (PCNM) 7.4.3 MEM in a Wider Context: Weights Other than Geographic Distances 7.4.4 MEM with Positive or Negative Spatial Correlation: Which Ones should Be Used? 7.4.5 Asymmetric Eigenvector Maps (AEM): When Directionality Matters 7.5 Another Way to Look at Spatial Structures: Multiscale Ordination (MSO) 7.5.1 Principle 7.5.2 Application to the Mite Data - Exploratory Approach 7.5.3 Application to the Detrended Mite and Environmental Data 7.6 Space-Time Interaction Test in Multivariate ANOVA, Without Replicates 7.6.1 Introduction 7.6.2 Testing the Space-Time Interaction with the sti Functions 7.7 Conclusion 8 Community Diversity 8.1 Objectives 8.2 The Multiple Facets of Diversity 8.2.1 Introduction 8.2.2 Species Diversity Measured by a Single Number 8.2.3 Taxonomic Diversity Indices in Practice 8.3 When Space Matters: Alpha, Beta and Gamma Diversities 8.4 Beta Diversity 8.4.1 Beta Diversity Measured by a Single Number 8.4.2 Beta Diversity as the Variance of the Community Composition Table: SCBD and LCBD Indices 8.4.3 Partitioning Beta Diversity into Replacement, Richness Difference and Nestedness Components 8.5 Functional Diversity, Functional Composition and Phylogenetic Diversity of Communities 8.5.1 Alpha Functional Diversity 8.5.2 Beta Taxonomic, Phylogenetic and Functional Diversities 8.6 Conclusion Bibliography Index

Note: Inhaltsverzeichnis Teil I Grundlagen und Rahmenbedingungen der Teilzeitführung 1 Führen in Teilzeit - Zum Stand der Dinge in Theorie und Praxis / Anja Karlshaus und Boris Kaehler 2 Führung in Teilzeit? - Eine empirische Analyse zur Verbreitung von Teilzeitarbeit unter Führungskräften in Deutschland und Europa / Stefan Stuth und Lena Hipp 3 Zur familienpolitischen Bedeutung von Führung in flexiblen Arbeitsmodellen / Dilek Kolat und Andrea Schirmacher 4 Arbeitsrechtliche Rahmenbedingungen der Teilzeitführung / Kara Preedy 5 Chancengleichheit zwischen Teilzeit- und Vollzeitführungskräften / Günther Vedder und Margit Vedder 6 Reduzierte Arbeitszeit in Führungspositionen: Empirische Befunde und Erfolgsfaktoren in der 360-Grad-Perspektiv / Nina Bessing, Marc Gärtner und Katharina Schiederig 7 Implementierung von Teilzeitführung / Angela Fauth-Herkner und Stefanie Wiebrock 8 Chancen und Risiken bei der Implementierung von Teilzeitführung / Desiree H. Ladwig und Michel E. Domsch 9 Persönliche Kompetenzen und unterstützende Rahmenbedingungen für eine gelungene Teilzeitführung / Gerda Köster 10 Teilzeitführung - Grenzen und kritische Aspekte / Oliver Stettes Teil II Organisationsbeispiele aus der Praxis 11 Praxisbeispiel Barmenia Versicherungen: Teilzeitführung als Prozess / Ulrike Rüß 12 Praxisbeispiel Commerzbank AG: Top-Sharing und das Vertretermodell / Angelika Bauernfeind, Sabine Prößl und Alexandra Warkus 13 Praxisbeispiel Daimler AG: Teilzeitführung als Bestandteil eines umfassenden Diversity-Management-Ansatzes / Angela Lechner 14 Praxisbeispiel EY: Flexibilität und individuelle Ausgestaltung als Erfolgsvoraussetzung / Isabell Galvagni und Eva Voß 15 Praxisbeispiel HUK-COBURG: Teilzeitführung im Rahmen einer familienbewussten Unternehmens- und Personalpolitik / Sarah Rössler und Grit Renning 16 Praxisbeispiel Polizei: Eine Frage der Balance / Andrea Jochmann- Döll 17 Praxisbeispiel der Stadt Köln: Teilzeitführung als Instrument zur Förderung der Gendergerechtigkeit / Christine Kronenberg 18 Praxisbeispiel TUI Deutschland GmbH: Der Weg von der Anwesenheits- zur Performancekultur / Christian Meyenberg und Christoph Schinner Sachverzeichnis

Note: Articles Introductory remarks on the transport problem W. S. Fyfe https://doi.org/10.1144/GSL.SP.1977.007.01.01 Model of hydrothermal ore genesis J. W. Elder https://doi.org/10.1144/GSL.SP.1977.007.01.02 Identification of ore-deposition environment from trace-element geochemistry of associated igneous host rocks J. A. Pearce and G. H. Gale https://doi.org/10.1144/GSL.SP.1977.007.01.03 Identification of the origin of oreforming solutions by the use of stable isotopes S. M. F. Sheppard https://doi.org/10.1144/GSL.SP.1977.007.01.04 Hydrogen and oxygen isotope evidence for sea-water-hydrothermal alteration and ore deposition, Troodos complex, Cyprus T. H. E. Heaton and S. M. F. Sheppard https://doi.org/10.1144/GSL.SP.1977.007.01.05 Hydrodynamic model for the origin of the ophiolitic cupriferous pyrite ore deposits of Cyprus E. T. C. Spooner https://doi.org/10.1144/GSL.SP.1977.007.01.06 Origin and emplacement of ophiolites I. G. Gass https://doi.org/10.1144/GSL.SP.1977.007.01.07 Hydrothermal alteration of the basaltic lavas of the Troodos Ophiolite Complex associated with the formation of the massive sulphide deposits G. Constantinou https://doi.org/10.1144/GSL.SP.1977.007.01.08 Rare-earth element evidence for the genesis of the metalliferous sediments of Troodos, Cyprus A. H. F. Robertson and A. J. Fleet https://doi.org/10.1144/GSL.SP.1977.007.01.09 Modern submarine hydrothermal mineralization: examples from Santorini and the Red Sea D. S. Cronan, P. A. Smith, and R. D. Bignell https://doi.org/10.1144/GSL.SP.1977.007.01.10 Mineralization at destructive plate boundaries: a brief review M. S. Garson and A. H. G. Mitchell https://doi.org/10.1144/GSL.SP.1977.007.01.11 Porphyry copper deposits J. P. Hunt https://doi.org/10.1144/GSL.SP.1977.007.01.12 Metallic mineralization affiliated to subaerial volcanism: a review R. H. Sillitoe https://doi.org/10.1144/GSL.SP.1977.007.01.13 Igneous geology and the evolution of hydrothermal systems in some sub-volcanic tin deposits of Bolivia J. N. Grant, C. Halls, W. Avila, and G. Avila https://doi.org/10.1144/GSL.SP.1977.007.01.14 Occurrence, origin and significance of mechanically transported sulphide ores at Buchans, Newfoundland J. G. Thurlow https://doi.org/10.1144/GSL.SP.1977.007.01.15 Geological setting of the Skorovas orebody within the allochthonous volcanic stratigraphy of the Gjersvik Nappe, central Norway C. Halls, A. Reinsbakken, I. Ferriday, A. Haugen, and A. Rankin https://doi.org/10.1144/GSL.SP.1977.007.01.16 The Planes-San Antonio pyritic deposit of Rio Tinto, Spain: its nature, environment and genesis D. Williams, R. L. Stanton, and F. Rambaud https://doi.org/10.1144/GSL.SP.1977.007.01.17 Kuroko deposits: their geology, geochemistry and origin Takeo Sato https://doi.org/10.1144/GSL.SP.1977.007.01.18 Stable isotope studies on Bougainville and in Matupi Harbour, New Britain, Papua New Guinea J. H. Ford, D. C. Green, J. R. Hulston, I. H. Crick, and S. M. F. Sheppard https://doi.org/10.1144/GSL.SP.1977.007.01.19 Volcanogenic mineralization at Avoca, Co. Wicklow, Ireland, and its regional implications J. W. Platt https://doi.org/10.1144/GSL.SP.1977.007.01.20 Discussion https://doi.org/10.1144/GSL.SP.1977.007.01.21

Note: 1. Einleitung 2. Unterkante der magnetisch wirksamen Kruste 2.1. Magnetfeld der Erde und Krustenstruktur 2.2. CURIE-Isotherme - eine Grenzfläche in der vertikalen Gliederung der Erdkruste 3. Geomagnetische Interpretation - der Weg vom Anomalienfeld zu Aussagen über die Parameter seiner Quellen, speziell deren Unterkante 3.1. Direkte Aufgabe - Schluß vom Modell auf geophysikalisch meßbare Größen 3.1.1. Modell 3.1.2. Energiedichtespektrum 3.1.3. Komplexes Spektrum eines Modellensembles 3.1.4. Energiedichtespektrum eines Doppelensembles 3.2. Inverse Aufgabe - Schluß von geomagnetischen Anomalien auf die Parameter ihrer Quellen; spektrale Betrachtungen und Tiefenbestimmungen 3.2.1. Tiefenbestimmungen für Einzelquellen 3.2.2. Tiefenbestimmungen für Quellenensembles 3.2.3. Tiefenbestimmungen für Doppelensembles von Quellen 4. Verfahrens- und rechentechnische Realisierung der Erzeugung von Modellfeldern, der Bearbeitung und Interpretation geophysikalischer Potentialfelder 4.1. Allgemeine Bemerkungen 4.2. Überblick über mögliche Bearbeitungsschritte und ihre Kopplung 4.2.1. Direkte Aufgabenstellung 4.2.2. Dateneingabe 4.2.3. Übergang Ortsraum - Frequenzraum und Umkehrung 4.2.4. Datenaufbereitung 4.2.5. Spektrenberechnung 4.2.6. Logarithmisches radiales Energiedichtespektrum 4.2.7. Ergebnisse, Ausgabe, Darstellung von Feldern 4.2.8. Interpretation 5. Tiefeninterpretationen an Modell- und Felddaten 5.1. Einzelprismen 5.2. Prismenensembles 5.3. Doppelensembles 5.4. Anwendung auf Felddaten 5.4.1. Datengewinnung 5.4.2. Bearbeitung und Interpretation 5.4.3. Ergebnisse und Einschätzung 6. Zusammenfassung 7. Literaturverzeichnis

Note: Zusammenfassungen Verzeichnis der Symbole 0. Einleitung 1. Überblick zur Transformation von Kovarianzfunktionen im Schwerefeld 1.1. Transformationsmöglichkeiten 1.2. Voraussetzungen und Modellfunktionen 2. Kovarianzfunktionen der 1. Ableitungen des Schwerepotentials (Tx, Ty, Tz) 2.1. Lotabweichungsvektor 2.2. Anomaler Schwerevektor 2.3. Modell-Beispiele 3. Kovarianzfunktionen der 2. Ableitungen des Schwerepotentials (Txx, Txy, Tyy, Txz, Tyz, Tzz) 3.1. Niveauflächenkrümmung und Torsion des astronomischen Meridians 3.2. Horizontaler Schweregradient 3.3. Vertikaler Schweregradient 3.4. Kreuzkovarianzfunktionen zwischen den 2. Ableitungen 4. Vollständiges Schema der Auto- und Kreuzkovarianzfunktionen der 1. und 2. Ableitungen des Schwerepotentials 4.1. Kreuzkovarianzfunktionen zwischen den 1. und 2. Ableitungen 4.2. Modell-Beispiele 4.3. Varianz-Kovarianz-Schemata 5. Ergänzende Betrachtungen 5.1. Höhere Ableitungen des Schwerepotentials 5.2. Räumliche Kovarianzfunktionen 5.3. Nicht-differenzierbare Modelle Anhang I Kovarianzfortpflanzung bei Faltungsoperationen II Ebenes STOKES-Problem III Differentationsformeln IV Fortsetzung ebener Prozesse in den Raum Literatur Abbildungen

Note: 1. Einleitung 2. Die Beobachtungen des Mondes 2.1. Entfernungsmessungen zum Mond 2.2. Der astronomische Anschluß des Mondes 3. Die Beobachtungen der Radiosterne 3.1. Interferometrische Beobachtungen eines Quasars 3.2. Der astronomische Anschluß eines Quasars 4. Koordinatensysteme 5. Die Fehlergleichungen für Entfernungsmessungen zum Mond an einer Station 5.1. Rechtwinklige kartesische Koordinaten für die Station und den Mond 5.2. Räumliche Polarkoordinaten für die Station und Rektaszension und Deklination als Koordinaten für den Mond 5.3. Räumliche Polarkoordinaten für die Station und ekliptikale Länge und Breite als Koordinaten für den Mond 5.4. Räumliche Polarkoordinaten für die Station und Bahnelemente in bezug auf die Ekliptik für den Mond 5.5. Räumliche Polarkoordinaten für die Station und Bahnelemente in bezug auf den Äquator für den Mond 6. Die Fehlergleichungen für simultane Entfernungsmessungen zum Mond an zwei Stationen 6.1. Rechtwinklige kartesische Koordinaten für die Station und den Mond 6.2. Rechtwinklige kartesische Koordinaten für die Station und Rektaszension und Deklination als Koordinaten für den Mond 6.3. Rechtwinklige kartesische Koordinaten für die Station und ekliptikale Länge und Breite als Koordinaten für den Mond 6.4. Rechtwinklige kartesische Koordinaten für die Station und Bahnelemente in bezug auf die Ekliptik für den Mond 7. Die Fehlergleichungen für simultane Entfernungsmessungen zum Mond an zwei Stationen bei astronomischem Anschluß des Mondes 7.1. Rechtwinklige kartesische Koordinaten für die Station und Rektaszension und Deklination als Koordinaten für den Mond 7.2. Rechtwinklige kartesische Koordinaten für die Station und ekliptikale Länge und Breite als Koordinaten für den Mond 7.3. Rechtwinklige kartesische Koordinaten für die Station und Bahnelemente in bezug auf die Ekliptik für den Mond 8. Die Fehlergleichungen für radiointerferometrisohe Beobachtungen der Laufzeitdifferenz 8.1 . Rechtwinklige kartesische Koordinaten für die Station und Rektaszension und Deklination als Koordinaten für den Quasar 9. Die Fehlergleichungen für radiointerferometrische Beobachtungen der Streifenfrequenz 9.1. Rechtwinklige kartesische Koordinaten für die Station und Rektaszension und Deklination als Koordinaten für den Quasar 10. Interferometrische Beobachtungen künstlicher Erdsatelliten und künstlicher Radioquellen auf dem Mond Literatur

Note: Contents Contributors Editorial foreword Preface CHAPTER 1 Snow and ice-related hazards, risks, and disasters: Facing challenges of rapid change and long-term commitments / Wilfried Haeberli and Colin Whiteman 1.1 Introduction 1.2 Costs and benefits: Living with snow and ice 1.3 Small and large, fast and slow, local to global: Dealing with constraints 1.4 Beyond historical experience: Monitoring, modeling, and managing rapid and irreversible changes Acknowledgments References CHAPTER 2 Physical, thermal, and mechanical properties of snow, ice, and permafrost / Lukas Arenson (U.), William Colgan, and Hans Peter Marshall 2.1 Introduction 2.2 Density and structure 2.2.1 Snow 2.2.2 Ice 2.2.3 Frozen ground/permafrost 2.3 Thermal properties 2.3.1 Snow 2.3.2 Ice 2.3.3 Frozen ground 2.4 Mechanical properties 2.4.1 Brittle behavior 2.4.2 Ductile behavior 2.5 Electromagnetic and wave properties 2.5.1 Snow 2.5.2 Ice 2.5.3 Frozen ground 2.6 Summary Acknowledgment References.. CHAPTER 3 Snow and ice in the climate system / Atsumu Ohmura 3.1 Introduction 3.2 Physical extent of the cryosphere 3.3 Climatic conditions of the cryosphere 3.3.1 Snow cover 3.3.2 Sea ice 3.3.3 Permafrost 3.3.4 Glaciers References CHAPTER 4 Snow and ice in the hydrosphere / Jan Seibert, Michal Jenicek, Matthias Huss, Tracy Ewen, and Daniel Viviroli 4.1 Introduction 4.2 Snow accumulation and melt 4.2.1 Snowpack description 4.2.2 Snow accumulation 4.2.3 Snow redistribution, metamorphism, and ripening process 4.2.4 Snowpack development 4.2.5 Snowmelt 4.3 Glaciers and glacial mass balance 4.3.1 Glacier mass balance 4.3.2 Glacial drainage system 4.3.3 Modeling glacier discharge 4.4 Hydrology of snow- and ice-covered catchments 4.4.1 Influence of snow on discharge 4.4.2 Snowmelt runoff and climate change 4.4.3 Influence of glaciers on discharge 4.4.4 River ice 4.4.5 Seasonally frozen soil and permafrost 4.5 Concluding remarks References CHAPTER 5 Snow, ice, and the biosphere / Terry V. Callaghan and Margareta Johansson 5.1 Introduction 5.2 Adaptations to snow, ice, and permafrost. 5.3 Snow and ice as habitats 5.4 Snow as a moderator of habitat 5.4.1 Modification of winter habitat 5.4.2 Modification of nonwinter habitat 5.4.3 Effects of changing snow on the biosphere 5.5 Ice as a moderator of habitat 5.5.1 Mechanical effects of ice 5.5.2 Effects of changing lake and river ice on the biosphere 5.5.3 Effects of changing sea ice on the biosphere 5.6 Permafrost as a moderator of habitat 5.6.1 Effects of changing permafrost on the biosphere 5.6.2 Snow-permafrost-vegetation interactions 5.7 Vegetation as a moderator of snow, ice, and permafrost habitats 5.8 Conclusions Acknowledgments References CHAPTER 6 Ice and snow as land-forming agents / Darrel A. Swift, Simon Cook, Tobias Heckmann, Isabelle Gärtner-Roer, Oliver Korup, and Jeffrey Moore 6.1 Glacial processes and landscapes 6.1.1 Erosion mechanisms and their controls 6.1.2 Landforms and associated hazards 6.1.3 Landscape evolution and rates of glacial incision 6.1.4 Recommended avenues for further research 6.2 Periglacial and permafrost processes and landforms 6.2.1 Landforms and processes related to seasonal frost and permafrost 6.3 The role of snow in forming landscapes 6.3.1 Influence of snow cover on geomorphic processes 6.3.2 Snow-related geomorphic processes and landforms 6.3.3 Potential impacts of global change on snow-related geomorphic processes 6.3.4 Quantifying rates 6.3.5 Modeling 6.4 Conclusions and outlook Acknowledgments References CHAPTER 7 Mountains, lowlands, and coasts: The physiography of cold landscapes / Tobias Bolch and Hanne H. Christiansen 7.1 Introduction 7.2 Physiography of the terrestrial cryosphere 7.2.1 High altitudes/mountains 7.2.2 Cold lowlands 7.2.3 Cold coasts 7.3 Glaciers and ice sheets: Extent and distribution 7.4 Permafrost types, extent, and distribution 7.5 Glacier-permafrost interactions References CHAPTER 8 A socio-cryospheric systems approach to glacier hazards, glacier runoff variability, and climate change / Mark Carey, Graham McDowell, Christian Huggel, Becca Marshall, Holly Moulton, Cesar Portocarrero, Zachary Provant, John M. Reynolds, and Luis Vicuña 8.1 Introduction 8.2 Integrated adaptation in dynamic socio-cryospheric systems 8.3 Glacier and glacial lake hazards 8.3.1 Cordillera Blanca, Peru 8.3.2 Santa Teresa, Peru 8.3.3 Nepal 8.4 Volcano-ice hazards 8.5 Glacier runoff, hydrologic variability, and water use hazards 8.5.1 Nepal 8.5.2 Peru 8.6 Coastal resources and hazards 8.7 Discussion and conclusions Acknowledgments References CHAPTER 9 Integrative risk management: The example of snow avalanches / Michael Bründl and Stefan Margreth 9.1 Introduction 9.2 Risk analysis 9.2.1 Hazard analysis 9.2.2 Exposure and vulnerability analysis 9.2.3 Consequence analysis and calculation of risk 9.3 Risk evaluation 9.3.1 Evaluation of individual risk 9.3.2 Evaluation of collective risk 9.4 Mitigation of risk 9.4.1 Meaning of mitigation of risk 9.4.2 Technical avalanche mitigation measures 9.4.3 Land-use planning 9.4.4 Biological measures and protection forests 9.4.5 Organizational measures 9.5 Methods and tools for risk assessment and evaluation of mitigation measures 9.6 Case study “Evaluation of avalanche mitigation measures for Juneau, Alaska” 9.6.1 Introduction 9.6.2 Avalanche situation 9.6.3 Hazard analysis 9.6.4 Consequence analysis and risk evaluation 9.6.5 Protection measures 9.6.6 Conclusions 9.7 Final remarks References CHAPTER 10 Permafrost degradation / Dmitry Streletskiy 10.1 Introduction 10.2 Drivers of permafrost and active-layer change across space and time 10.2.1 Role of climate: Air temperature and liquid precipitation 10.2.2 Role of topography 10.2.3 Role of vegetation and snow 10.2.4 Role of soil properties 10.3 Observed permafrost and active-layer changes 10.4 Permafrost modeling and forecasting 10.5 Permafrost degradation and infrastructure hazards 10.5.1 Buildings on permafrost 10.5.2 Pipelines on permafrost 10.5.3 Railroads, roads, and utility on permafrost 10.6 Coastal erosion and permafrost 10.7 Summary Acknowledgments References CHAPTER 11 Radioactive waste under conditions of future ice ages / Urs H. Fischer, Anke Bebiolka, Jenny Brandefelt, Denis Cohen, Joel Harper, Sarah Hirschorn, Mark Jensen, Laura Kennell, Johan Liakka, Jens-Ove Näslund, Stefano Normani, Heidrun Stück, and Axel Weitkamp 11.1 Introduction 11.2 Timing of future glacial inception 11.2.1 Introduction 11.2.2 Definition of glacial inception 11.2.3 Controlling factors of glacial inception 11.2.4 Future long-term variations of insolation and atmospheric greenhouse gas concentrations 11.2.5 Modeling of future glacial inception 11.2.6 Timing of future glacial inception and concluding remarks 11.3 The glacier ice-groundwater interface: Constraints from a transect of the modern Greenland Ice Sheet 11.3.1 Background 11.3.2 Basal thermal state 11.3.3 Framework of the ice-bed interface 11.3.4 Basal water 11.3.5 Summary 11.4 Deep glacial erosion in the Alpine Foreland of northern Switzerland 11.4.1 Background 11.4.2 Ice age conditions 11.4.3 Processes of glacial erosion and glacial overdeepening 11.4.4 Water flow in overdeepenings 11.4.5 Deep glacial erosion in the Swiss Plateau 11.4.6 Future research focus 11.5 Tunnel valleys in Germany and their relevance to the long-term safety of nuclear waste repositories 11.5.1 Background 11.5.2 Formation of tunnel valleys 11.5.3 Tunnel valleys in Northern Germany 11.5.4 Tunnel valleys in the German North Sea 11.5.5 Glacial overdeepening in Southern Germany 11.5.6 Impact of tunnel valley formation on host rocks 11.6 Assessment of glacial impacts on geosphere stability and barrier capacity—Canadian perspective 11.6.1 Background 11.6.2 Bruce Nuclear Site—Location and geologic setting Acknowledgments References CHAPTER 12 Snow avalanches / Jürg Schweizer, Perry Bartelt, and Alec van Herwijnen 12.1 Introduction 12.2 The avalanche phenomenon 12.3 Avalanche release 12.3.1 Dry-snow avalanches 1

Note: Contents Part I Atmosphere-Ocean Interaction and Physical Oceanography 1 Geostrophic and Wind-Driven Components of the Antarctic Circumpolar Current / Nikolay A. Diansky, Varvara V. Bagatinskaya, Anatoly V. Gusev, and Eugene G. Morozov 2 Multi-jet Structure of the Antarctic Circumpolar Current / Roman Yu Tarakanov 3 Frontal Zone Between Relatively Warm and Cold Waters in the Northern Weddell Sea / Eugene G. Morozov, Viktor A. Krechik, Dmitry I. Frey, Alexander A. Polukhin, Vladimir A. Artemiev, Valentina V. Kasyan, Philipp V. Sapozhnikov, and Rinat Z. Mukhametianov 4 Water Masses, Currents, and Phytoplankton in the Bransfield Strait in January 2020 / Eugene G. Morozov, Dmitry I. Frey, Viktor A. Krechik, Alexander A. Polukhin, and Philipp V. Sapozhnikov 5 Intra-annual Variability of Water Structure in the Atlantic Sector of the Southern Ocean Based on the ECMWF ORA-S3 and OI SST Reanalysis / Yuri V. Artamonov, Elena A. Skripaleva, Alexander V. Fedirko, and Nikolay V. Nikolsky 6 The Circulation and Mixing Zone in the Antarctic Sound in February 2020 / Alexander V. Krek, Elena V. Krek, and Viktor A. Krechik 7 Rogue Waves in the Drake Passage: Unpredictable Hazard / Ekaterina G. Didenkulova, Tatiana G. Talipova, and Efim N. Pelinovsky 8 Water Mass Transformation in the Powell Basin / Alina A. Fedotova and Svetlana V. Stepanova 9 Interannual Variations of Water Mass Properties in the Central Basin of the Bransfield Strait / Alina A. Fedotova and Sergey V. Kashin 10 Sea Surface Temperature and Ice Concentration Analysis Based on the NOAA Long-Term Satellite and Sea-Truth Data in the Atlantic Antarctic / Viktor V. Zamshin and Vladislav A. Shliupikov Part II Chemical Oceanography, Seawater Optical Properties, Productivity and Microbial Processes 11 Hydrochemical Structure of Waters in the Northern Weddell Sea in Austral Summer 2020 / Svetlana V. Stepanova, Alexander A. Polukhin, Gennadii V. Borisenko, Anna L. Chultsova, Evgeniia N. Marina, Oleg S. Popov, Anna M. Seliverstova, Anna V. Vidnichuk, and Petr P. Tishchenko 12 Features and Processes of the Oxygen and pCO2 Dynamics in the Surface Waters in the Western Parts of the Weddell and Scotia Seas (Southern Ocean) / Natalia A. Orekhova, Anna V. Vidnichuk, and Sergey K. Konovalov 13 Earth’s Insolation and Spatiotemporal Variability of Albedo in the Antarctic / Anton A. Bukatov and Margarita V. Babiy 14 Quantitative and Productional Characteristics of Microplankton in the Powell Basin and Bransfield Strait in Summer / Nadezda D. Romanova, Sergey A. Mosharov, Olga V. Vorobieva, and Elena V. Bardyukova 15 Detection of Thermophilic Methanotrophic Microbial Communities in the Water Column of the Bransfield Strait (Antarctica) / Anna L. Ponomareva, Nikita S. Polonik, Aleksandra V. Kim, and Renat B. Shakirov 16 Spectral Bio-optical Properties of Waters in the Bransfield Strait and Powell Basin / Tanya Ya Churilova, Nataliia A. Moiseeva, Tatiana V. Efimova, Vladimir A. Artemiev, Elena Y. Skorokhod, and Anatoly S. Buchelnikov 17 Variability of Seawater Optical Properties in the Adjacent Water Basins of the Antarctic Peninsula in January and February 2020 / Alexandr A. Latushkin, Vladimir A. Artemiev, Anton V. Garmashov, Pavel A. Salyuk, Inna V. Sahling, and Dmitry I. Glukhovets 18 Bio-Optical Models for Estimating Euphotic Zone Depth in the Western Atlantic Sector of the Southern Ocean in the Antarctic Summer / Pavel A. Salyuk, Vladimir A. Artemiev, Dmitry I. Glukhovets, Alexander N. Khrapko, Anatoly V. Grigoriev, Alexandr A. Latushkin, and Nadezda D. Romanova 19 Phycoerythrin Pigment Distribution in the Upper Water Layer Across the Weddell-Scotia Confluence Zone and Drake Passage / Pavel A. Salyuk, Dmitry I. Glukhovets, Alexander Yu. Mayor, Natalia A. Moiseeva, Vladimir A. Artemiev, and Alexander N. Khrapko 20 Nanophytoplankton in the Bransfield Strait: Contribution of Cryptophyta to the Community Abundance and Biomass During Austral Summer / Vladimir S. Mukhanov, Evgeny G. Sakhon, Aleksander A. Polukhin, and Vladimir A. Artemiev Part III Section Marine Ecosystems and Their Oceanographical Background 21 Phytopelagic Communities of the Powell Basin in the Summer of 2020 / Philipp V. Sapozhnikov, Olga Yu. Kalinina, and Tatiana V. Morozova 22 Bioluminescence in the Atlantic Sector of the Southern Ocean Based on the Field Observations and Sounding Data / Aleksandr V. Melnik, Viktor V. Melnikov, Lidiya A. Melnik, Olga V. Mashukova, and Sergei V. Kapranov 23 Parasites as an Inseparable Part of Antarctic and Subantarctic Marine Biodiversity / Tatyana A. Polyakova and Ilya I. Gordeev 24 Spatial Distribution, Species Composition, and Number of Seabirds in the Argentine Basin, Drake Passage, East of Antarctic Peninsula, and Powell Basin in January–March 2020 / Sergey P. Kharitonov, Alexander L. Mischenko, Nikolai B. Konyukhov, Alexander E. Dmitriyev, Andrey V. Tretyakov, Gleb Yu. Pilipenko, Svetlana M. Artemyeva, and Matvey S. Mamayev 25 Spatial Distribution, Species Composition, and Number of Marine Mammals in the Argentine Basin, Drake Passage, East of Antarctic Peninsula, and Powell Basin in January–March 2020 / Sergey P. Kharitonov, Andrey V. Tretyakov, Alexander L. Mischenko, Nikolai B. Konyukhov, Svetlana M. Artemyeva, Gleb Yu. Pilipenko, Matvey S. Mamayev, and Alexander E. Dmitriyev 26 Meat in the Ocean: How Much and Who Is to Blame? / Sergey P. Kharitonov, Andrey V. Tretyakov, and Alexander L. Mischenko 27 Macro- and Mesozooplankton in the Powell Basin (Antarctica): Species Composition and Distribution of Abundance and Biomass in February 2020 / Vladimir A. Yakovenko, Vassily A. Spiridonov, Konstantin M. Gorbatenko, Nickolai V. Shadrin, Ernest Z. Samyshev, and Natalia I. Minkina 28 Application of Autonomous Underwater Vehicles for Research of Ecosystems in the Southern Ocean / Alexander Yu. Konoplin, Alexey I. Borovik, Denis N. Mikhailov, Yuriy V. Vaulin, Alexander F. Scherbatyuk, Alexey A. Boreiko, Roman A. Babaev, Dmitriy A. Bolovin, and Dmitriy I. Tregubenko 29 Heavy Metals and Anthropogenic Radionuclides in the Region of the Antarctic Peninsula / Artem A. Paraskiv, Natalia Yu. Mirzoeva, Nataliya N. Tereshchenko, Vladislav Yu. Proskurnin, Ilya G. Sidorov, Svetlana I. Arkhipova, and Eugene G. Morozov

Note: Dittfeld, H.-J.: Results of an eight years' gravimetric earth tide registration series at Potsdam Elstner, C.; Harnisch, M.; Schwahn, W.: On the determination of the gravimetric Mf tide at Potsdam

Note: Dissertation, Universität Potsdam, 1980 , 1. Einleitung 2. Aspekte der Bildwahrnehmung und der naturwissenschaftlichen Thematik für die interpretationsgerechte Aufbereitung von farbigen Abbildungen aus Multispektralfotografien 2.1. Physikalische Aspekte der Bildwahrnehmung 2.1.1. Abbildung der Umwelt bei bilderzeugenden Fernerkundungsverfahren 2.1.2. Beschreibung der zweidimensionalen Bildfunktion von Schwarzweißbildern 2.1.3. Grundzüge der Bildfunktion von Farbbildern und Multispektralaufnahmen 2.2. Physiologisch-optische Aspekte der Bildwahrnehmung 2.2.1. Reizaufnahme und Reizverarbeitung im Auge 2.2.2. Physiologie der Farbwahrnehmung 2.2.2.1. Grundbegriffe der Farbvalenzmetrik 2.2.2.2. Die trichromatischen Farbmaßzahlen 2.2.2.3. Die geometrische Darstellung von Farben in der Farbvalenzmetrik 2.2.2.4. Grundbegriffe der empfindungsgemäßen Farbmetrik 2.2.3. Einfluß der Farbwahrnehmung auf die Bildinterpretation 2.3. Psychologische Aspekte der Bildwahrnehmung 2.4. Aspekte der naturwissenschaftlichen Thematik der Interpretation 2.5. Ableitung einer Aufgabenstellung zur interpretationsgerechten Aufbereitung der Multispektralinformation 3. Verfahren der digitalen und kombinierten digital-analogen Bildbearbeitung zur interpretationsgerechten Aufbereitung von MKF 6 - Multispektralfotografien 3.1. Grundlagen der Bildbearbeitung 3.1.1. Grundbegriffe der digitalen Bildbearbeitung 3.1.2. Analog-optische Bildbearbeitung mit Multispektralprojektoren 3.1.3. Kombinierte analog-optische Bildbearbeitung 3.2. Aufbereitung von MKF 6 - Multispektralfotografien zur Verarbeitung auf numerischen Rechenanlagen 3.3. Anwendung der Hauptachsentransformation zur Datenverdichtung bei MKF 6 - Multispektralaufnahmen 3.3.1. Mathematisch-physikalische Grundlagen der Hauptachsentransformation von multispektralen Abbildungen 3.3.2. Technische Realisierung der Hauptachsentransformation für Multispektraldaten 3.3.3. Beispiel zur Hauptachsentransformation von MKF 6 – Multispektralaufnahmen 3.4. Interpretationsgerechte Aufbereitung von farbigen Abbildungen aus Multispektralaufnahmen durch lineare Grauwerttransformation im zweidimensionalen Merkmalsraum 3.4.1. Mathematisch-physikalische Grundlagen des Verfahrens 3.4.2. Technische Realisierung 3.5. Interpretationsgerechte Aufbereitung von farbigen Abbildungen aus MKF 6 - Multispektralaufnahmen unter Berücksichtigung der empfindungsgemäßen Farbmetrik 3.5.1. Mathematisch-physikalische Grundlagen des Verfahrens 3.5.1.1. Unabhängige Optimierung der Grauwertdifferenzierung in drei Komponenten mit anschließender Farbmischung im Multispektralprojektor 3.5.1.2. Optimierung der Farbdifferenzierung durch Egalisierung das zweidimensionalen Histogramms der Farbwertanteile 3.5.2. Programmtechnische Realisierung des Verfahrens 3.5.3. Vergleich mit einem bekannten ähnlichen Verfahren 3.6. Interpretationsgerechte Aufbereitung von farbigen Abbildungen aus Multispektralaufnahmen durch unüberwachte Klassifizierung nach repräsentativen Objektklassen 3.6.1. Mathematisch- physikalische Grundlagen des Verfahrens 3.6.2. Programmtechnische Realisierung des Verfahrens 4. Untersuchungen zur Applikation der beschriebenen digitalanalogen Verfahren für die interpretationsgerechte Aufbereitung von Multispektralfotografien 4.1. Interpretationsgerechte Aufbereitung von Multispektralfotografien mit inhomogener Bildfunktion 4.1.1. Farbcodierung der Hauptkomponenten im Multispektralprojektor 4.1.2. Farbcodierung der linear transformierten Hauptkomponenten 4.1.3. Farboptimierung durch Egalisierung des Histogramms der Farbwertanteile 4.1.4. Aufbereitung von Teilaspekten der Bildfunktion durch unüberwachte Klassifizierung 4.2. Interpretationsgerechte Aufbereitung von Multispektralfotografien mit relativ homogener Bildfunktion 4.3. Prinzipielle Schlußfolgerungen zur Anwendung der beschriebenen Verfahren zur interpretationsgerechten Aufbereitung von Multispektralfotografien 5. Zusammenfassung und Schlußfolgerungen 6. Literaturverzeichnis 7. Verzeichnis der Beilagen

Note: Contents Artificial Intelligence for Sustainability An Intelligent Chatbot Using NLP and TF-IDF Algorithm for Text Understanding Applied to the Medical Field / Ayanouz Soufyane, Boudhir Anouar Abdelhakim, and Mohamed Ben Ahmed Artificial Intelligence in Predicting the Spread of Coronavirus to Ensure Healthy Living for All Age Groups / Stitini Oumaima, Kaloun Soulaimane, and Bencharef Omar Sustainability of Artificial Intelligence and Deep Learning Algorithms for Medical Image Classification: Case of Cancer Pathology / Dahdouh Yousra, Anouar Boudhir Abdelhakim, and Ben Ahmed Mohamed An Intelligent Strategy for Developing Scientific Learning Skills / Okacha Diyer, Naceur Achtaich, and Khalid Najib Interactivity for Artificial Intelligence Systems: NL2SQL / Karam Ahkouk, Mustapha Machkour, Rachid Mama, and Khadija Majhadi Toward an Intelligent Hybrid System Based on Data Analysis and Preprocessing Method / Sara Belattar, Otman Abdoun, and Haimoudi El khatir Proposed Precautions for Newborn Malware Family Inspired from the COVID19 Epidemic Outbreak / Ikram Ben Abdel Ouahab, Mohammed Bouhorma, Lotfi ElAachak,and Anouar Abdelhakim Boudhir Using Deep Features Extraction and Ensemble Classifiers to Detect Glaucoma from Fundus Images / Stephane Cedric Tekouabou Koumetio, El Arbi Abdellaoui Alaoui, Imane Chabbar, Walid Cherif, and Hassan Silkan The Role of Applications Deep Learning in Achieving Sustainable Development Goals / Redouane Lhiadi, Abdelali Kaaouachi, and Abdessamad Jaddar Self-Attention Mechanism for Diabetic Retinopathy Detection / Othmane Daanouni, Bouchaib Cherradi, and Amal Tmiri Comparative Study of Supervised Machine Learning Color-Based Segmentation for Object Detection in X-Ray Baggage Images for Intelligent Transportation Systems / Mohamed Chouai, Mostefa Merah, José-Luis Sancho-GÓmez, and Malika MIMI A Survey of Artificial Intelligence-Based E-Commerce Recommendation System / Mohamed Khoali, Abdelhak Tali, and Yassin Laaziz Green Networks and Intelligent Transportation Systems Customer-Oriented Dial-A-Ride Problems: A Survey on Relevant Variants, Solution Approaches and Applications / Sonia Nasri, Hend Bouziri, and Wassila Aggoune-Mtalaa Big Data Accident Prediction System in Green Networks and Intelligent Transportation Systems / Mouad Tantaoui, My Driss Laanaoui, and Mustapha Kabil A Survey of Optimization Techniques for Routing Protocols in Mobile Ad Hoc Networks / Younes Ben Chigra, Abderrahim Ghadi, and Mohamed Bouhorma Modeling and Performance Analysis for Transportation Systems of ULA and UCA Massive-MIMO Basing on Spherical Wave / Abdelhamid Riadi, Mohamed Boulouird, and Moha M’Rabet Hassani Enhancing Wireless Transmission Efficiency for Wireless Body Area Sensor Networks Based on Transposing of Sensors / Rahat Ali Khan, Shahzad Memon, and Qin Xin New Method to Detect the Congestion for Green Networking in MANET / Abdellah Nabou, My Driss Laanaoui, Mohammed Ouzzif, and Mohammed-Alamine El Houssaini Benchmarking Study of Machine Learning Algorithms Case Study: VANET Network / Sara Ftaimi and Tomader Mazri A Comparative Study of Detection Algorithm in VANET Network / Manale Boughanja and Tomader Mazri An Enhanced Energy-Efficient Hierarchical LEACH Protocol to Extend the Lifespan for Wireless Sensor Networks / Fatima Es-sabery and Abdellatif Hair A Survey of Security and Privacy for 5G Networks / Ahmed Ziani and Abdellatif Medouri An Adaptive Video Streaming Framework for Peer-To-Peer 5G Networks: Paving the Road to 5G-IMS / Adnane Ghani, El Hassan Ibn El Haj, Ahmed Hammouch, and Abdelaali Chaoub Recognition and Reconstruction of Road Marking with Generative Adversarial Networks (GANs) / Samir Allach, Mohamed Ben Ahmed, and Anouar Abdelhakim Boudhir Environmental Informatics & Sustainable Environment A Smart Agricultural System to Classify Agricultural Plants and Fungus Diseases Using Deep Learning / Oussama Bakkali Yedri, Mohamed Ben Ahmed, Mohammed Bouhorma, and Lotfi El Achaak Secure Data Collection for Wireless Sensor Network / Samir Ifzarne, Imad Hafidi, and Nadia Idrissi Computing Technologies to Construct an Islamic Geometric Patterns Respecting the “Hasba” Method / Yassine Ait Lahcen, Abdelaziz Jali, Ahmed El Oirrak, and Youssef Aboufadil Technology for Sustainable Development: Solar Adsorption Cooling System Cold Room Modelization Using Python / Hanane Abakouy, Hanae El Kalkha, and Adel Bouajaj Satellite Big Data Ingestion for Environmentally Sustainable Development / Badr-Eddine Boudriki Semlali and Chaker El Amrani A New Approach for Estimating Monthly Global Solar Irradiation Based on Empirical and Artificial Neural Networks Models: A Case Study of Al-Hoceima Province, in Morocco North Region / Badr Benamrou, Mustapha Ouardouz, Imane Allaouzi, and Mohamed Ben ahmed Computing Technologies for Sustainable Development Efficient Congestion Management for Sustainable Wireless Mesh Networks / Kaoutar Bazi and Bouchaib Nassereddine Classifying Security Attacks in IoT Using CTM Method / Hind Meziane, Noura Ouerdi, Mohammed Amine Kasmi, and Sanae Mazouz Exploring the Power of Computation Technologies for Entity Matching / Youssef Aassem, Imad Hafidi, and Noureddine Aboutabit Smart Sustainable Cities: A Chatbot Based on Question Answering System Passing by a Grammatical Correction for Serving Citizens / Bghiel Afrae, Ben Ahmed Mohamed, and Boudhir Anouar Abdelhakim Enhancing Wireless Transmission Efficiency for Sensors in Wireless Body Area Sensor Networks / Rahat Ali Khan, Shahzad Memon, and Qin Xin Study of Websocket Parent-Teachers/Qualified Teachers in Rural Areas: Case of Central African Republic / Ghislain Mervyl Saint-Juste Kossingou, Nadege Gladys Ndassimba, Edgard Ndassimba, Kéba Gueye, and Samuel Ouya A Comparison of QoS-Based Architecture Solutions for IoT/Edge Computing Environment / Nogaye Lo and Ibrahima Niang Towards Sustainable e-Learning Systems Using an Adaptive Learning Approach / El Miloud Smaili, Soukaina Sraidi, Salma Azzouzi, and My El Hassan Charaf Toward a Mobile Remote Controlled Robot for Early Childhood in Algeria / Ehlem Zigh, Ayoub Elhoucine, Abderrahmane Mallek, and Belcacem Kouninef Multi-Directional Total Variation and Wavelet Transform Based Methods: Application for Correlation Fringe Patterns Denoising and Demodulation / Mustapha Bahich and Mohammed Bailich A Multi-Agent System for Color Video Decomposition / Insaf Bellamine Serious Games for Sustainable Education in Emerging Countries: An Open-Source Pipeline and Methodology / Younes Alaoui, Lotfi El Achaak, Amine Belahbib, and Mohammed Bouhorma

Note: N.F. entfällt ab 57.2000. - Volltext auch als Teil einer Datenbank verfügbar , Ersch. ab 2000 in engl. Sprache mit dt. Hauptsacht.

Note: Table of Contents Introduction N. J. Price and K. R. McClay https://doi.org/10.1144/GSL.SP.1981.009.01.01 What is a Thrust? What is a Nappe? J. G. Dennis, R. A. Price, J. K. Sales, R. Hatcher, A. W. Bally, W. J. Perry, H. P. Laubscher, R. E. Williams, D. Elliott, D. K. Norris, D. W. Hutton, T. Emmett, and K. R. McClay https://doi.org/10.1144/GSL.SP.1981.009.01.02 I. Mechanics of Thrusts and Nappes Thoughts on the tectonics of folded belts A. W. Bally https://doi.org/10.1144/GSL.SP.1981.009.01.03 Pore pressure, discontinuities, isostasy and overthrusts P. E. Gretener https://doi.org/10.1144/GSL.SP.1981.009.01.04 Gravitational gliding in deltas G. Mandl and W. Crans https://doi.org/10.1144/GSL.SP.1981.009.01.05 Thrust sheet deformation at a ramp: summary and extensions of an earlier model D. V. Wiltschko https://doi.org/10.1144/GSL.SP.1981.009.01.06 Deformation and secondary faulting near the leading edge of a thrust fault D. A. Rodgers and W. D. Rizer https://doi.org/10.1144/GSL.SP.1981.009.01.07 Mechanical model of thrust sheet gliding and imbrication G. Mandl and G. K. Shippam https://doi.org/10.1144/GSL.SP.1981.009.01.08 The rock mechanics of thrust and nappe formation S. A. F. Murrell https://doi.org/10.1144/GSL.SP.1981.009.01.09 Subduction and coeval thrust belts, with particular reference to North America A. G. Smith https://doi.org/10.1144/GSL.SP.1981.009.01.10 The role of gravity in orogenic belts H. Ramberg https://doi.org/10.1144/GSL.SP.1981.009.01.11 II. Rock Products of Thrusting Dynamic analysis of a small imbricate thrust and related structures, Front Ranges, Southern Canadian Rocky Mountains J. H. Spang and S. P. Brown https://doi.org/10.1144/GSL.SP.1981.009.01.12 The microfabric of calcite tectonites from the Helvetic Nappes (Swiss Alps) S. M. Schmid, M. Casey, and J. Starkey https://doi.org/10.1144/GSL.SP.1981.009.01.13 Very low grade metamorphism with a reverse gradient induced by an overthrust in Haute-Savoie (France) J. Aprahamian and J.-L. Pairis https://doi.org/10.1144/GSL.SP.1981.009.01.14 Saline horizons acting as thrust planes along the southern margin of the Damara Orogen (Namibia/SW-Africa) H. J. Behr, H. Ahrendt, A. Schmidt, and K. Weber https://doi.org/10.1144/GSL.SP.1981.009.01.15 Sliding and other deformation mechanisms in a glacier of salt, S Iran C. J. Talbot https://doi.org/10.1144/GSL.SP.1981.009.01.16 The Caledonides of northern Norway: relation between preferred orientation of quartz lattice, strain and translation of the nappes A.-M. Boullier and J.-M. Quenardel https://doi.org/10.1144/GSL.SP.1981.009.01.17 Structure and distribution of fault rocks in the Alpine Fault Zone, New Zealand R. H. Sibson, S. H. White, and B. K. Atkinson https://doi.org/10.1144/GSL.SP.1981.009.01.18 Uplift rates and thermal structure in the Alpine Fault Zone and Alpine Schists, Southern Alps, New Zealand C. J. Adams https://doi.org/10.1144/GSL.SP.1981.009.01.19 III. Thrust and Nappe Regimes. A. ‘The Old World’ Caledonides The internal geometry of nappes: criteria for models of emplacement M. A. Cooper https://doi.org/10.1144/GSL.SP.1981.009.01.20 The strain profile above a major thrust fault, Finnmark, N Norway N. J. Milton and G. D. Williams https://doi.org/10.1144/GSL.SP.1981.009.01.21 The Moine Thrust Zone: an overview K. R. McClay and M. P. Coward https://doi.org/10.1144/GSL.SP.1981.009.01.22 Tectonic slides in the Caledonides D. H. W. Hutton https://doi.org/10.1144/GSL.SP.1981.009.01.23 Estimation of the rate and amount of absolute lateral shortening in an orogen using diachronism and strike slipped segments W. E. A. Phillips https://doi.org/10.1144/GSL.SP.1981.009.01.24 Strain within thrust sheets M. P. Coward and J. H. Kim https://doi.org/10.1144/GSL.SP.1981.009.01.25 III. Thrust and Nappe Regimes. A. ‘The Old World’ Alpine Tectonics of the Helvetic Nappes J. G. Ramsay https://doi.org/10.1144/GSL.SP.1981.009.01.26 The 3D propagation of décollement in the Jura H. P. Laubscher https://doi.org/10.1144/GSL.SP.1981.009.01.27 Fold-and-thrust tectonics in the Helvetic Nappes (E Switzerland) O. A. Pfiffner https://doi.org/10.1144/GSL.SP.1981.009.01.28 Some observations on the development of thrust faults in the Ultradauphinois Zone, French Alps A. Beach https://doi.org/10.1144/GSL.SP.1981.009.01.29 Gravity sliding in the Maritime Alps R. H. Graham https://doi.org/10.1144/GSL.SP.1981.009.01.30 III. Thrust and Nappe Regimes. A. ‘The Old World’ Eurasia Sutures, thrusts and nappes in the Variscan Arc of western Europe: plate tectonic implications Ph. Matte and J. P. Burg https://doi.org/10.1144/GSL.SP.1981.009.01.31 Wrench related thrusting along a Mesozoic-Cenozoic continental margin: Antalya Complex, SW Turkey N. H. Woodcock and A. H. F. Robertson https://doi.org/10.1144/GSL.SP.1981.009.01.32 Thrust and strike slip fault interaction along the Chaman transform zone, Pakistan R. D. Lawrence and R. S. Yeats S. H. Khan, A. Farah, and K. A. DeJong https://doi.org/10.1144/GSL.SP.1981.009.01.33 Active thrusting and the evolution of the Zagros fold belt J. A. Jackson and T. J. Fitch D. P. McKenzie https://doi.org/10.1144/GSL.SP.1981.009.01.34 An overview of thrusts and nappes of western Himalaya V. C. Thakur https://doi.org/10.1144/GSL.SP.1981.009.01.35 Ambiguity in interpretation of seismic data from modern convergent margins: an example from the IPOD Japan Trench transect R. von Huene, M. Arthur, and B. Carson https://doi.org/10.1144/GSL.SP.1981.009.01.36 Geometrical problems and implications of large scale over-thrusting in the Banda Arc -Australian margin collision zone M. G. Audley-Charles https://doi.org/10.1144/GSL.SP.1981.009.01.37 Neogene thrust emplacement from a frontal arc in New Guinea J. Milsom https://doi.org/10.1144/GSL.SP.1981.009.01.38 IV. Thrust and Nappe Regimes. B. ‘The New World’ The Americas The Cordilleran foreland thrust and fold belt in the southern Canadian Rocky Mountains R. A. Price https://doi.org/10.1144/GSL.SP.1981.009.01.39 The nature and significance of large ‘blind’ thrusts within the northern Rocky Mountains of Canada R. I. Thompson https://doi.org/10.1144/GSL.SP.1981.009.01.40 Metamorphic complex of SE Canadian Cordillera and relationship to foreland thrusting R. L. Brown https://doi.org/10.1144/GSL.SP.1981.009.01.41 Thrust nappes in the Rocky Mountain Foothills near Mountain Park, Alberta H. A. K. Charlesworth and W. E. Kilby https://doi.org/10.1144/GSL.SP.1981.009.01.42 Deformational styles in two Mesozoic fault zones, western Washington, USA D. S. Cowan and R. B. Miller https://doi.org/10.1144/GSL.SP.1981.009.01.43 Thrusts and nappes in the North American Appalachian Orogen R. D. Hatcher, Jr. https://doi.org/10.1144/GSL.SP.1981.009.01.44 COCORP seismic reflection profiling across thrust faults J. A. Brewer, F. A. Cook, L. D. Brown, J. E. Oliver, S. Kaufman, and D. S. Albaugh https://doi.org/10.1144/GSL.SP.1981.009.01.45 Mechanisms for basement shortening in the Andean foreland fold belt of southern South America Margaret A. Winslow https://doi.org/10.1144/GSL.SP.1981.009.01.46

Note: Articles Introduction J. Brooks https://doi.org/10.1144/GSL.SP.1983.012.01.01 Geological and Geochemical Studies of Northwest European Continental Shelf The role of the Department of Energy in petroleum exploration of the United Kingdom P. J. Walmsley https://doi.org/10.1144/GSL.SP.1983.012.01.02 Gas Exploration and Reserves in Europe A. Makourine https://doi.org/10.1144/GSL.SP.1983.012.01.03 A Review of Geochemical Data Related to the Northwest European Gas Province P. C. Barnard and B. S. Cooper https://doi.org/10.1144/GSL.SP.1983.012.01.04 Surface Geochemical Exploration in the North Sea J. L. Gevirtz, B. D. Carey, and S. R. Blanco https://doi.org/10.1144/GSL.SP.1983.012.01.05 Analytic Procedure and Results of an Isotope Geochemical Surface Survey in an Area of the British North Sea E. Faber and W. Stahl https://doi.org/10.1144/GSL.SP.1983.012.01.06 Petroleum Offshore Sniffer Exploration J. Sigalove https://doi.org/10.1144/GSL.SP.1983.012.01.07 Petroleum Exploration Onshore U.K. G. J. Candy https://doi.org/10.1144/GSL.SP.1983.012.01.08 North Sea petroleum exploration T. P. Brennand https://doi.org/10.1144/GSL.SP.1983.012.01.09 Exploration of the Norwegian Shelf Hans Rønnevik, Svein Eggen, and Jan Vollset https://doi.org/10.1144/GSL.SP.1983.012.01.10 Stratigraphy and Sedimentation of the Palaeocene Sands in the Northern North Sea D. C. Mudge and G. M. Bliss https://doi.org/10.1144/GSL.SP.1983.012.01.11 Geochemistry of Porosity Enhancement and Reduction in Clastic Sediments C. D. Curtis https://doi.org/10.1144/GSL.SP.1983.012.01.12 Applications of Geochemistry to Sandstone Reservoir Studies Hilary Irwin and Andrew Hurst https://doi.org/10.1144/GSL.SP.1983.012.01.13 Organofacies and Early Maturation Effects in Upper Jurassic Sediments From the Inner Moray Firth Basin, North Sea M. J. Pearson and D. Watkins https://doi.org/10.1144/GSL.SP.1983.012.01.14 Aspects of Burial Diagenesis, Organic Maturation and Palaeothermal History of an Area in the South Viking Graben, North Sea M. J. Pearson, D. Watkins, and J-L Pittion D. Caston and J. S. Small https://doi.org/10.1144/GSL.SP.1983.012.01.15 Some Geological Controls on Oil Composition in the U.K. North Sea C. Cornford, J. A. Morrow, A. Turrington, J. A. Miles, and J. Brooks https://doi.org/10.1144/GSL.SP.1983.012.01.16 Kerogen Types, Organic Maturation and Hydrocarbon Occurrences in the Moray Firth and South Viking Graben, North Sea Basin M. J. Fisher and Jennifer A. Miles https://doi.org/10.1144/GSL.SP.1983.012.01.17 Geochemistry of North and South Brae Areas, North Sea R. H. Reitsema https://doi.org/10.1144/GSL.SP.1983.012.01.18 The Search for Petroleum in Northern Ireland A. E. Griffith https://doi.org/10.1144/GSL.SP.1983.012.01.19 Frontier exploration in Western and Northwest Europe D. G. Roberts https://doi.org/10.1144/GSL.SP.1983.012.01.20 Petroleum Exploration of Europe Origins of Natural Gas in the Po Valley, N. Italy L. Mattavelli, T. Ricchiuto, and D. Grighani M. Schoell https://doi.org/10.1144/GSL.SP.1983.012.01.21 Isotope Geochemistry of Natural Gases in Central Europe M. Schoell and M. J. Whiticar https://doi.org/10.1144/GSL.SP.1983.012.01.22 Geochemical Observations and Oil Genesis in the German Alps and their foreland K. Kuckelkorn, H. Wehner, and H. Hufnagel https://doi.org/10.1144/GSL.SP.1983.012.01.23 Basin Evolution and Hydrocarbon Generation D. P. McKenzie https://doi.org/10.1144/GSL.SP.1983.012.01.25 Oil Potential of Coals: A Geochemical Approach B. Durand and M. Paratte https://doi.org/10.1144/GSL.SP.1983.012.01.26 Pyrolysis-Mass Spectrometry in Coal Chemistry: a study of the coalification of vitrites and the typification of Australian Brown Coals P. A. Schenck, J. W. de Leeuw, and T. C. Viets J. Haverkamp https://doi.org/10.1144/GSL.SP.1983.012.01.27 Identification of Amorphous Sedimentary Organic Matter by Transmitted Light Microscopy D. J. Batten https://doi.org/10.1144/GSL.SP.1983.012.01.28 Spectral Correlation of Spore Coloration Standards P. M. R. Smith https://doi.org/10.1144/GSL.SP.1983.012.01.29 Selection Criteria for the Use of Vitrinite Reflectance as a Maturity Tool J. M. A. Buiskool Toxopeus https://doi.org/10.1144/GSL.SP.1983.012.01.30 Use of Porphyrins as a Maturity Parameter for Oils and Sediments A. J. G. Barwise https://doi.org/10.1144/GSL.SP.1983.012.01.31 Petroleum Geochemical Principles and Techniques Organic Geochemistry and Basin Modelling — Important Tools in Petroleum Exploration D. H. Welte, M. A. Yükler, M. Radke, D. Leythaeuser, U. Mann, and U. Ritter https://doi.org/10.1144/GSL.SP.1983.012.01.24 Geological Information on Hydrocarbon Exploration on the U.K. Continental Shelf Introduction G. G. Baxter https://doi.org/10.1144/GSL.SP.1983.012.01.32 The Compilation of an Earth Science Bibliography for the North Sea and Adjacent Areas D. J. McKay https://doi.org/10.1144/GSL.SP.1983.012.01.33 Commercially Available Geological Databanks—U.K.C.S. P. Wigley https://doi.org/10.1144/GSL.SP.1983.012.01.34 Geological Information from Hydrocarbon Exploration on the United Kingdom Continental Shelf J. R. V. Brooks https://doi.org/10.1144/GSL.SP.1983.012.01.35 EXPHST—A Program to Analyse the History of Exploration Success within a Basin or Country K. J. Chew and H. Stephenson https://doi.org/10.1144/GSL.SP.1983.012.01.36 The Use of Computerized Information in Britoil, Exploration Division G. G. Baxter https://doi.org/10.1144/GSL.SP.1983.012.01.37

Note: 1. Introduction --- Robin Nicholson: Caledonian correlations: Britain and Scandinavia / Geological Society, London, Special Publications, 8:3-18, doi:10.1144/GSL.SP.1979.008.01.01 Anthony K. Higgins and W. E. Adrian Phillips: East Greenland Caledonides—an extension of the British Caledonides / Geological Society, London, Special Publications, 8:19-32, doi:10.1144/GSL.SP.1979.008.01.02 M. J. Kennedy: The continuation of the Canadian Appalachians into the Caledonides of Britain and Ireland / Geological Society, London, Special Publications, 8:33-64, doi:10.1144/GSL.SP.1979.008.01.03 2. Basement-Cover Relationships: Map: Basement-Cover Relationships / Geological Society, London, Special Publications, 8:67-91, doi:10.1144/GSL.SP.1979.008.01.04 David Bamford: Seismic constraints on the deep geology of the Caledonides of northern Britain / Geological Society, London, Special Publications, 8:93-96, doi:10.1144/GSL.SP.1979.008.01.06 Ian S. Sanders: Observations on eclogite- and granulite-facies rocks in the basement of the Caledonides / Geological Society, London, Special Publications, 8:97-100, doi:10.1144/GSL.SP.1979.008.01.07 Paul A. Rathbone and Anthony L. Harris: Basement-cover relationships at Lewisian inliers in the Moine rocks / Geological Society, London, Special Publications, 8:101-107, doi:10.1144/GSL.SP.1979.008.01.08 Derek Flinn, P. L. Frank, Maureen Brook, and I. R. Pringle: Basement-cover relations in Shetland / Geological Society, London, Special Publications, 8:109-115, doi:10.1144/GSL.SP.1979.008.01.09 G. S. Johnstone, Jane Plant, and Janet V. Watson: Regional geochemistry of the Northern Highlands of Scotland / Geological Society, London, Special Publications, 8:117-128, doi:10.1144/GSL.SP.1979.008.01.10 Martin Brewer, Maureen Brook, and Derek Powell: Dating of the tectono-metamorphic history of the southwestern Moine, Scotland / Geological Society, London, Special Publications, 8:129-137, doi:10.1144/GSL.SP.1979.008.01.11 - M. A. J. Piasecki and O. van Breemen: The ‘Central Highland Granulites’: cover-basement tectonics in the Moine / Geological Society, London, Special Publications, 8:139-144, doi:10.1144/GSL.SP.1979.008.01.12 Donald M. Ramsay and Brian A. Sturt: The status of the Banff nappe / Geological Society, London, Special Publications, 8:145-151, doi:10.1144/GSL.SP.1979.008.01.13 Charles Barry Long and Bruce William Yardley: The distribution of pre-Caledonian basement in the Ox Mountains inlier, Ireland / Geological Society, London, Special Publications, 8:153-156, doi:10.1144/GSL.SP.1979.008.01.14 - P. S. Kennan, W. E. A. Phillips, and P. Strogen: Pre-Caledonian basement to the paratectonic Caledonides in Ireland / Geological Society, London, Special Publications, 8:157-161, doi:10.1144/GSL.SP.1979.008.01.15 3. Tectonics --- M. R. W. Johnson, D. J. Sanderson, and N. J. Soper: Deformation in the Caledonides of England, Ireland and Scotland / Geological Society, London, Special Publications, 8:163-186, doi:10.1144/GSL.SP.1979.008.01.17 M. P. Coward and A. W. B. Siddans: The tectonic evolution of the Welsh Caledonides / Geological Society, London, Special Publications, 8:187-198, doi:10.1144/GSL.SP.1979.008.01.18 J. L. Roberts and J. E. Treagus: Stratigraphical and structural correlation between the Dalradian rocks of the SW and Central Highlands of Scotland / Geological Society, London, Special Publications, 8:199-204, doi:10.1144/GSL.SP.1979.008.01.19 Peter R. Thomas: New evidence for a Central Highland Root Zone / Geological Society, London, Special Publications, 8:205-211, doi:10.1144/GSL.SP.1979.008.01.20 H. J. Bradbury, A. L. Harris, and R. A. Smith: Geometry and emplacement of nappes in the Central Scottish Highlands / Geological Society, London, Special Publications, 8:213-220, doi:10.1144/GSL.SP.1979.008.01.21 Ben Harte: The Tarfside succession and the structure and stratigraphy of the eastern Scottish Dalradian rocks / Geological Society, London, Special Publications, 8:221-228, doi:10.1144/GSL.SP.1979.008.01.22 Graham J. Borradaile: Pre-tectonic reconstruction of the Islay anticline: implications for the depositional history of Dalradian rocks in the SW Highlands / Geological Society, London, Special Publications, 8:229-238, doi:10.1144/GSL.SP.1979.008.01.23 D. H. W. Hutton: Dalradian structure in the Creeslough area, NW Donegal, Ireland / Geological Society, London, Special Publications, 8:239-241, doi:10.1144/GSL.SP.1979.008.01.24 Peter William Geoffrey Tanner and Robert Milner Shackleton: Structure and stratigraphy of the Dalradian rocks of the Bennabeola area, Connemara, Eire / Geological Society, London, Special Publications, 8:243-256, doi:10.1144/GSL.SP.1979.008.01.25 W. E. A. Phillips, A. M. Flegg, and T. B. Anderson: Strain adjacent to the Iapetus suture in Ireland / Geological Society, London, Special Publications, 8:257-262, doi:10.1144/GSL.SP.1979.008.01.26 T. B. Anderson and T. D. J. Cameron: A structural profile of Caledonian deformation in Down / Geological Society, London, Special Publications, 8:263-267, doi:10.1144/GSL.SP.1979.008.01.27 Martin H. Eales: Structure of the Southern Uplands of Scotland / Geological Society, London, Special Publications, 8:269-273, doi:10.1144/GSL.SP.1979.008.01.28 Thomas J. Kelly and Michael D. Max: A strain section across part of the Caledonian orogen in W Ireland / Geological Society, London, Special Publications, 8:275-280, doi:10.1144/GSL.SP.1979.008.01.29 Patrick M. Shannon: The tectonic evolution of the lower Palaeozoic rocks of extreme SE Ireland / Geological Society, London, Special Publications, 8:281-285, doi:10.1144/GSL.SP.1979.008.01.30 Lindsay M. Parson: The state of strain adjacent to the Great Glen fault / Geological Society, London, Special Publications, 8:287-289, doi:10.1144/GSL.SP.1979.008.01.31 J. R. Mendum: Caledonian thrusting in NW Scotland / Geological Society, London, Special Publications, 8:291-297, doi:10.1144/GSL.SP.1979.008.01.32 Robert Milner Shackleton: The British Caledonides: comments and summary / Geological Society, London, Special Publications, 8:299-304, doi:10.1144/GSL.SP.1979.008.01.33 4. Metamorphism --- D. J. Fettes: A metamorphic map of the British and Irish Caledonides / Geological Society, London, Special Publications, 8:305-321, doi:10.1144/GSL.SP.1979.008.01.35 Ben Harte and Neil F. C. Hudson: Pelite facies series and the temperatures and pressures of Dalradian metamorphism in E Scotland / Geological Society, London, Special Publications, 8:323-337, doi:10.1144/GSL.SP.1979.008.01.36 P. R. A. Wells and S. W. Richardson: Thermal evolution of metamorphic rocks in the Central Highlands of Scotland / Geological Society, London, Special Publications, 8:339-344, doi:10.1144/GSL.SP.1979.008.01.37 J. A. Winchester and K. H. Whittles: The pattern of three-dimensional metamorphism in the Killin area, Inverness-shire: a direct method of determining the thickness of metamorphic zones in the Caledonides / Geological Society, London, Special Publications, 8:345-349, doi:10.1144/GSL.SP.1979.008.01.38 Harry J. Bradbury: Migmatisation, deformation and porphyroblast growth in the Dalradian of Tayside, Scotland / Geological Society, London, Special Publications, 8:351-356, doi:10.1144/GSL.SP.1979.008.01.39 J. R. Ashworth: Textural and mineralogical evolution of migmatites / Geological Society, London, Special Publications, 8:357-361, doi:10.1144/GSL.SP.1979.008.01.40 R. St J. Lambert, J. A. Winchester, and J. G. Holland: Time, space and intensity relationships of the Precambrian and lower Palaeozoic metamorphisms of the Scottish Highlands / Geological Society, London, Special Publications, 8:363-367, doi:10.1144/GSL.SP.1979.008.01.41 Bruce W. D. Yardley, C. Barry Long, and Michael D. Max: Patterns of metamorphism in the Ox Mountains and adjacent parts of Western Ireland / Geological Society, London, Special Publications, 8:369-374, doi:10.1144/GSL.SP.1979.008.01.42 B

Note: Table of Contents Japan The Shimanto Belt of Japan: Cretaceous-lower Miocene active-margin sedimentation A. Taira, H. Okada,J. H. Whitaker, and A. J. Smith https://doi.org/10.1144/GSL.SP.1982.010.01.01 Sedimentation across the Japan Trench off northern Honshu Island Roland von Huene and Michael A. Arthur https://doi.org/10.1144/GSL.SP.1982.010.01.02 Tectonics of some forearc fold belts in and around the arc-arc crossing area in central Japan Yujiro Ogawa https://doi.org/10.1144/GSL.SP.1982.010.01.03 Forearc geological structure of the Japanese Islands Tsunemasa Shiki and Yoshibumi Misawa https://doi.org/10.1144/GSL.SP.1982.010.01.04 Central America Facies belts of the Middle America Trench and forearc region, southern Mexico: results from Leg 66 DSDP J. Casey Moore, Joel S. Watkins, Kenneth J. McMillen, Stephen B. Bachman, Jeremy K. Leggett, Neil Lundberg, Thomas H. Shipley, Jean-Francois Stephan, Floyd W. Beghtel, Arif Butt, Borys M. Didyk, Nobuaki Niitsuma, Les E. Shephard, and Herbert Stradner https://doi.org/10.1144/GSL.SP.1982.010.01.05 Tectonic processes along the Middle America Trench inner slope Thomas H. Shipley, John W. Ladd, Richard T. Buffler, and Joel S. Watkins https://doi.org/10.1144/GSL.SP.1982.010.01.06 Sedimentation in different tectonic environments of the Middle America Trench, southern Mexico and Guatemala Kenneth J. McMillen, Robert H. Enkeboll, J. Casey Moore, Thomas H. Shipley, and John W. Ladd https://doi.org/10.1144/GSL.SP.1982.010.01.07 A summary of Deep Sea Drilling Project Leg 67 shipboard results from the Mid-America Trench transect off Guatemala Roland von Huene, Jean Aubouin, Jacques Azema, Grant Blackinton, Jerry A. Carter, William T. Coulbourn, Darrel S. Cowan, Joseph A. Curiale, Carlos A. Dengo, Richard W. Faas, William Harrison, Reinhard Hesse, Donald M. Hussong, John W. Ladd, … View all authors https://doi.org/10.1144/GSL.SP.1982.010.01.08 Evolution of the slope landward of the Middle America Trench, Nicoya Peninsula, Costa Rica Neil Lundberg https://doi.org/10.1144/GSL.SP.1982.010.01.9 South America Cenozoic structure, stratigraphy and tectonics of the central Peru forearc L. D. Kulm, T. M. Thornburg, and H.-J. Schrader J. M. Resig https://doi.org/10.1144/GSL.SP.1982.010.01.10 Forearc and other basins, continental margin of northern and southern Peru and adjacent Ecuador and Chile R. Moberly, G. L. Shepherd, and W. T. Coulbourn https://doi.org/10.1144/GSL.SP.1982.010.01.11 The geology of the western part of the Borbón Basin, North-west Ecuador C. D. R. Evans and J. E. Whittaker https://doi.org/10.1144/GSL.SP.1982.010.01.12 Aleutians Ancient plate boundaries in the Bering Sea region M. S. Marlow, A. K. Cooper, D. W. Scholl, and H. McLean https://doi.org/10.1144/GSL.SP.1982.010.01.13 The Chugach Terrane, a Cretaceous trench-fill deposit, southern Alaska Tor H. Nilsen and Gian G. Zuffa https://doi.org/10.1144/GSL.SP.1982.010.01.14 Structural evolution of coherent terranes in the Ghost Rocks Formation, Kodiak Island, Alaska Tim Byrne https://doi.org/10.1144/GSL.SP.1982.010.01.15 Asia and Australasia Sedimentation in the Sunda Trench and forearc region Gregory F. Moore, Joseph R. Curray, and Frans J. Emmel https://doi.org/10.1144/GSL.SP.1982.010.01.16 Development of the North Island Subduction System, New Zealand Gerrit J. van der Lingen https://doi.org/10.1144/GSL.SP.1982.010.01.17 Atlantic The Barbados Ridge Complex: tectonics of a mature forearc system G. K. Westbrook https://doi.org/10.1144/GSL.SP.1982.010.01.18 Sedimentology and structure of the Scotland Group, Barbados C. J. Pudsey and H. G. Reading https://doi.org/10.1144/GSL.SP.1982.010.01.19 Subduction and tectonics on the continental margin off northern Spain: observations with the submersible Cyana Jacques-André Malod, Gilbert Boillot, Claude Lepvier, Georges Mascle, and Josette Taugourdeau-Lantz Raymond Capdevila, Pierre-Alain Dupeuble, and Carla Müller https://doi.org/10.1144/GSL.SP.1982.010.01.20 Mediterranean Subduction in the Hellenic Trench: probable role of a thick evaporitic layer based on Seabeam and submersible studies X. Le Pichon, P. Huchon, J. Angelier, N. Lybéris, J. Boulin, and D. Bureau J.P. Cadet, J. Dercourt, G. Glaçon, H. Got, D. Karig, J. Mascle, L.E. Ricou, and F. Thiebault https://doi.org/10.1144/GSL.SP.1982.010.01.21 Detailed tectonic trends on the central part of the Hellenic Outer Ridge and in the Hellenic Trench System N. H. Kenyon, R. H. Belderson, and A. H. Stride https://doi.org/10.1144/GSL.SP.1982.010.01.22 The structure of the Calabro-Sicilian Arc: result of a post-orogenic intra-plate deformation Forese Carlo Wezel https://doi.org/10.1144/GSL.SP.1982.010.01.23 Makran of Iran and Pakistan Deformation of the Makran accretionary sediment prism in the Gulf of Oman (north-west Indian Ocean) Robert S. White https://doi.org/10.1144/GSL.SP.1982.010.01.24 The Late Cretaceous-Cenozoic history of western Baluchistan Pakistan—the northern margin of the Makran subduction complex Russell S. Arthurton, Abul Farah, and Wahiduddin Ahmed https://doi.org/10.1144/GSL.SP.1982.010.01.25 The Makran, Southeastern Iran: the anatomy of a convergent plate margin active from Cretaceous to Present G. J. H. McCall and R. G. W. Kidd https://doi.org/10.1144/GSL.SP.1982.010.01.26 California The Coastal Belt of the Franciscan: youngest phase of northern California subduction Steven B. Bachman https://doi.org/10.1144/GSL.SP.1982.010.01.27 The Franciscan Complex of northernmost California: sedimentation and tectonics K. R. Aalto https://doi.org/10.1144/GSL.SP.1982.010.01.28 Sedimentation, metamorphism and tectonic accretion of the Franciscan assemblage of northern California M. C. Blake, Jr, A. S. Jayko, and D. G. Howell https://doi.org/10.1144/GSL.SP.1982.010.01.29 Deformation of partly dewatered and consolidated Franciscan sediments near Piedras Blancas Point, California Darrel S. Cowan https://doi.org/10.1144/GSL.SP.1982.010.01.30 Initiation and evolution of the Great Valley forearc basin of northern and central California, U.S.A. Raymond V. Ingersoll https://doi.org/10.1144/GSL.SP.1982.010.01.31 Forearc Terranes in Orogenic Belts Cretaceous-Palaeogene Flysch Zone of the East Alps and Carpathians: identification and plate-tectonic significance of ‘dormant’ and ‘active’ deep-sea trenches in the Alpine-Carpathian Arc Reinhard Hesse https://doi.org/10.1144/GSL.SP.1982.010.01.32 The anatomy of a Lower Palaeozoic accretionary forearc: the Southern Uplands of Scotland J. K. Leggett W. S. McKerrow and D. M. Casey https://doi.org/10.1144/GSL.SP.1982.010.01.33 Sedimentology, volcanism, structure and metamorphism of the northern margin of a Lower Palaeozoic accretionary complex; Bail Hill-Abington area of the Southern Uplands of Scotland Barry C. Hepworth, Grahame J. H. Oliver, and Michael J. McMurtry https://doi.org/10.1144/GSL.SP.1982.010.01.34 Facies, Petrology and Models Sedimentary facies associations within subduction complexes Michael B. Underwood and Steven B. Bachman https://doi.org/10.1144/GSL.SP.1982.010.01.35 Composition of modern deep-sea sands from arc-related basins J. Barry Maynard, Renzo Valloni, and Ho-Shing Yu https://doi.org/10.1144/GSL.SP.1982.010.01.36 Initiation of subduction zones: implications for arc evolution and ophiolite development D. E. Karig https://doi.org/10.1144/GSL.SP.1982.010.01.37

Note: Vorwort Bankwitz, P.; Bankwitz, E.: Tektonische Fotointerpretation eines Sojus-22-Bildes (MKF-6) vom Südtjanshan-Pamir-Gebiet (UdSSR) Макаров, В.И.; Скобелев, С.Ф.; Трифонов, В.Г.; Флоренский, П.В.: Карта линеаменов территории СССР Bażyński, I.; Motyl-Rakowska, I. : Vorläufige Interpretation des Satellitenbildes "Meteor 25" für das Gebiet Polens Bankwitz, P.; Bankwitz, E.; Frischbutter, A.: Fototektonische Interpretation von Mitteleuropa nach Aufnahmen der sowjetischen Wettersatelliten Meteor 25 und 28 Krull, P.: Zum bruchtektonischen Bau des Territoriums der DDR und angrenzender Gebiete Feirer, K.; Viehweg, M.; Naumann, M.: Vorläufige Ergebnisse zur geologischen Interpretation der METEOR-Aufnahmen vom Territorium der DDR Хосбаяр, П.: О Южно-Монгольском полигоне Bankwitz, P.: Einige methodische Aspekte der Interpretation aerokosmischer Aufnahmen für bruchtektonische Analysen Söllner, R.: Anwendung der digitalen Bildfilterung zur Aufbereitung aerokosmischer Aufnahmen für die visuelle geologische Interpretation Weller, M.; Leiterer, U.; Söllner, R.: Erste Arbeiten zur Bestimmung der spektralen Eigenstrahlung der Atmosphäre in Zenitrichtung unter Verwendung der MKF-6-Aufnahmen Frey, L.; Krämer, I.: Informationen über Möglichkeiten der Nutzung von aerokosmischen Aufnahmen für die Herstellung von Kartengrundlagen der thematischen Kartographie Weichelt, H.: Probleme der Bildbearbeitung mit kohärentem Licht

Note: 1. Die Untersuchung bekannter Astasierungen 1.1. Die Aufgabe der Seismometrie und die Beziehung der Astasierung zu ihr 1.2. Die Auffassung von einer Astasierung bei Pendeln und Seismographen im historischen Überblick 1.3. Übliche Darstellungen mechanisch astasierter Seismographen 1.4. Astasierung bei geregelten elektronischen Seismographen 1.5. Grenzen bekannter Astasierungen 1.6. Erkenntnisse zum physikalischen Verständnis der Astasierung 1.7. Die Konsequenz dieser Erkenntnisse 2. Der dynamisch astasierte Seismograph 2.1. Die genäherte Übertragungsfunktion der Konfiguration HP2-HP1 2.2. Abschätzungen zur Stabilität 2.3. Untersuchung der Parametereinflüsse in der vollen Übertragungsfunktion mittels Rechnermodellierung 2.4. Vorschläge für technische Ausführungen dynamisch astasierter Seismographen 2.5. Modellierung auf einem Mikrorechner als Realisierungshilfe 3. Zum allgemeinen Anwendungsbereich des dynamisch astasierten mechanischen Schwingers 3.1. Anwendungskategorien 3.2. Rückschau und Ausblick Literatur

Note: A. A test for the Marussi condition. B. On the evaluation of the numerical amount of the residual term of the solution of the geodetic boundary value problem. C. The solution of the first mixed boundary value problem of the geodesy as an optimal method for the computation of the altimetrygravimetry problem. D. Gravity disturbances as boundary values on the surface of the Earth. E. A proof of the convergence of the spherical - harmonics series development of a potential exterior of a regular surface by the completeness of the system of the base functions at the surface.

Note: vollständige Fassung der am 6. November 1984 bei der Akademie der Wissenschaften der DDR verteidigte Dissertation A , 1. Einleitung 2. Zur Formalisierung fernerkundungsspezifischer Erkennungsprozesse 2.1. Das Vektorkonzept in der Fernerkundung 2.2. Stochastisch überwachte Erkennung 2.3. Physikalisch überwachte Erkennung 2.3.1. Fachspezifische und Fernerkundungsspezifische Objektmerkmale 2.3.2. Induktive und deduktive Modelle bei der physikalisch überwachten Erkennung 2.3.3. Vorschlag für ein Formalisierungsprinzip im Rahmen des physikalisch-überwachten Erkennungskonzeptes 2.3.4. Verfahren zur Merkmalsextraktion 3. Schaffung der experimentellen Voraussetzungen 3.1. Anforderungen an die Messung des spektralen gerichteten Remissionskoeffizienten 3.1.1. Anforderungen aus den speziellen Beleuchtungsbedingungen einer natürlichen Szene 3.1.2. Anforderungen aus speziellen Objekteigenschaften 3.2. Stand der experimentellen Gerätetechnik 3.3. Realisierung der experimentellen Voraussetzungen 3.4. Eigenschaften des Feldspektrometers BSP-83 3.4.1. Meßaufbau und -methoden 3.4.2. Spektralkanäle und Bandbreiten 3.4.3. Stabilität des Meßsignals 3.4.4. Öffnungswinkel des Bodenobjektivs und Indikatrix der Streuscheibe 3.4.5. Zeitlicher Ablauf des Meßvorganges 3.4.6. Bestimmung des Verstärkungsverhältnisses 4. Vorbereitung und Durchführung der Feldexperimente 1982/1983 4.1. Allgemeine methodische Grundlagen 4.2. Festlegung der Untersuchungsobjekte und Testgebiete 4.3. Auswahl der fachspezifischen Merkmale sowie der Störparameter 4.4. Aufstellung des Versuchsplanes 5. Aufbereitung der Meßdaten 5.1. Datenübernahme und Vorverarbeitung 5.2. Datenspeicherung 5.3. Statistische Datenanalyse 5.3.1. Faktorenanalyse 5.3.2. Varianzanalyse 5.3.3. Regressions- und Korrelationsanalyse 5.3.4. Diskriminanzanalyse 6. Auswertung und Ergebnisse der Feldexperimente 1982/83 6.1. Ergebnisse der Meßperiode 1982 6.2. Ergebnisse der Meßperiode 1983 6.3. Ergebnisse der Radiometermessungen 7. Zusammenfassung und Schlußfolgerungen 8. Literaturverzeichnis

Note: Zusammenfassung Summary резюме 1. Einleitung (H. Montag) 2. Das Bahnprogrammsystem POTSDAM-5 zur Analyse der Meßdaten (G. Gendt) 2.1. Verwendete Konstanten und Parameter 2.2. Realisierung der Referenzsysteme 2.2.1. Realisierung des Inertialsystems 2.2.2. Realisierung des terrestrischen Referenzsystems 2.2.3. Zusammenfassung der Transformationen 2.3. Positionen von Mond und Sonne 2.4. Reduktion der Laserentfernungsmessungen 2.5. Numerische Integration der Satellitenbewegungsgleichung und der Variationsgleichungen 2.6. Berechnung der auf den Satelliten wirkenden Beschleunigungen 2.6.1. Darstellung der Gravitation der Erde 2.6.2. Gravitation von Mond und Sonne 2.6.3. Gezeiten der festen Erde 2.6.4. Meeresgezeiten 2.6.5. Nichtgravitative Störungen 2.7. Berechnung der partiellen Ableitungen 2.1.1. Partielle Ableitungen für Bahnparameter 2.7.2. Partielle Ableitungen für Stations- und Polkoordinaten sowie Zeit und Erdrotation 2.7.3. Partielle Ableitungen für geodynamische Parameter 2.8. Parameterschätzung 3. Datenbereitstellung und Archivierung von Laserdaten 3.1. Datenbereitstellung (K. Kurth) 3.2. Archivierung von Laserdaten (K. Kurth) 3.3. Methode zur Berechnung von Normalpunkten aus Laserentfernungsmessungen (W. Korth) 4. Ergebnisse 4.1. Stationskoordinaten (R. Dietrich) 4.1.1. Bedeutung 4.1.2. Berechnung der Stationskoordinaten 4.1.3. Genauigkeit der Koordinaten 4.1.4. Weiterführende Untersuchungen zu zeitlichen Änderungen der Stationskoordinaten 4.2. Ergebnisse der Bestimmung von Erdrotationsparametern (H. Montag) 4.2.1. Allgemeine Betrachtungen 4.2.2. Ergebnisse für Polkoordinaten und Tageslängen 5. Vergleich mit anderen Lösungen und Wertung der Ergebnisse (H. Montag) 5.1. Vergleich der Ergebnisse verschiedener Analysenzentren für Laserentfernungsmessungen zu künstlichen Erdsatelliten 5.2. Vergleich der Ergebnisse verschiedener Methoden 5.3. Einschätzung der Ergebnisse und Schlußfolgerungen Literaturverzeichnis Anhang: Tabellen 9 - 12

Note: Contents Foreword Preface Acknowledgments Part I: The Need for Diversity Management Chapter 1 - The Business Case for Diversity Chapter 2 - Introduction to Diversity Measurement Part II: The Diversity Return-on-Investment (DROI) Process Chapter 3 - Introduction to the Diversity ROI Process Chapter 4 - Planning and Collecting Data Chapter 5 - Evaluating Diversity's Contribution Chapter 6 - Track and Assess Progress Part III: Building a Diversity Scorecard Chapter 7 - Basic Diversity Scorecard Components Chapter 8 - Diversity Leadership Commitment Perspective Chapter 9 - Workforce Profile Perspective Chapter 10 - Workplace Culture/Climate Perspective Chapter 11 - Learning and Growth Perspective Chapter 12 - Diverse Customer/Community Partnership Perspective Chapter 13 - Financial Impact Perspective Chapter 14 - Building Your Diversity Scorecard Part IV: Implementation Issues Chapter 15 - Achieving Strategic Alignment from Top to Bottom Chapter 16 - Implementing the Diversity Scorecard Process Appendix A - Hubbard Diversity Measurement and Productivity (DM&P) Institute: Creating Applied Sciences for Measuring Diversity Performance and Results Index About the Author

Note: Contents Part I Arctic Climate and Greenland 1 Arctic Climate Change, Variability, and Extremes / John E. Walsh 2 Precipitation Characteristics and Changes / Hengchun Ye, Daqing Yang, Ali Behrangi, Svetlana L. Stuefer, Xicai Pan, Eva Mekis, Yonas Dibike, and John E. Walsh 3 Snow Cover - Observations, Processes, Changes, and Impacts on Northern Hydrology / Ross Brown, Philip Marsh, Stephen Déry, and Daqing Yang 4 Evaporation Processes and Changes Over the Northern Regions / Yinsheng Zhang, Ning Ma, Hotaek Park, John E. Walsh, and Ke Zhang 5 Greenland Ice Sheet and Arctic Mountain Glaciers / Sebastian H. Mernild, Glen E. Liston, and Daqing Yang Part II Hydrology and Biogeochemistry 6 Regional and Basin Streamflow Regimes and Changes: Climate Impact and Human Effect / Michael Rawlins, Daqing Yang, and Shaoqing Ge 7 Hydrologic Extremes in Arctic Rivers and Regions: Historical Variability and Future Perspectives / Rajesh R. Shrestha, Katrina E. Bennett, Daniel L. Peters, and Daqing Yang 8 Overview of Environmental Flows in Permafrost Regions / Daniel L, Peters, Donald J. Baird, Joseph Culp, Jennifer Lento, Wendy A. Monk, and Rajesh R. Shrestha 9 Yukon River Discharge Response to Seasonal Snow Cover Change / Daqing Yang, Yuanyuan Zhao, Richard Armstrong, Mary J. Brodzik, and David Robinson 10 Arctic River Water Temperatures and Thermal Regimes / Daqing Yang, Hoteak Park, Amber Peterson, and Baozhong Liu 11 Changing Biogeochemical Cycles of Organic Carbon, Nitrogen, Phosphorus, and Trace Elements in Arctic Rivers / Jonathan O'Donnell, Thomas Douglas, Amanda Barker, and Laodong Guo 12 Arctic Wetlands and Lakes-Dynamics and Linkages / Kathy L. Young, Laura Brown, and Yonas Dibike 13 River Ice Processes and Changes Across the Northern Regions / Daqing Yang, Hotaek Park, Terry Prowse, Alexander Shiklomanov, and Ellie McLeod Part III Permafrost and Frozen Ground 14 Permafrost Features and Talik Geometry in Hydrologic System / Kenji Yoshikawa and Douglas L. Kane 15 Ground Temperature and Active Layer Regimes and Changes / Lin Zhao, Cangwei Xie, Daqing Yang, and Tingjun Zhang 16 Permafrost Hydrology: Linkages and Feedbacks / Tetsuya Hiyama, Daqing Yang, and Douglas L. Kane 17 Permafrost Hydrogeology / Barret L. Kurylyk and Michelle A. Walvoord Part IV Ecosystem Change and Impact 18 Greenhouse Gases and Energy Fluxes at Permafrost Zone / Masahito Ueyama, Hiroki Iwata, Hideki Kobayashi, Eugénie Euskirchen, Lutz Merbold, Takeshi Ohta, Takashi Machimura, Donatella Zona, Walter C. Oechel, and Edward A. G. Schuur 19 Spring Phenology of the Boreal Ecosystems / Nicolas Delbart 20 Diagnosing Environmental Controls on Vegetation Greening and Browning Trends Over Alaska and Northwest Canada Using Complementary Satellite Observations / Youngwook Kim, John S. Kimball, Nicholas Parazoo, and Peter Kirchner 21 Boreal Forest and Forest Fires / Yongwon Kim, Hideki Kobayashi, Shin Nagai, Masahito Ueyama, Bang-Yong Lee, and Rikie Suzuki 22 Northern Ecohydrology of Interior Alaska Subarctic / Jessica M. Young-Robertson, W. Robert Bolton, and Ryan Toohey 23 Yukon River Discharge-NDVI Relationship / Weixin Xu and Daqing Yang Part V Cross-System Linkage and Integration 24 River Freshwater Flux to the Arctic Ocean / Alexander Shiklomanov, Stephen Déry, Mikhail Tretiakov, Daqing Yang, Dmitry Magritsky, Alex Georgiadi, and Wenqing Tang 25 River Heat Flux into the Arctic Ocean / Daqing Yang, Shaoqing Ge, Hotaek Park, and Richard L. Lammers 26 Cold Region Hydrologic Models and Applications / Hotaek Park, Yonas Dibike, Fengge Su, and John Xiaogang Shi 27 Regional Climate Modeling in the Northern Regions / Zhenhua Li, Yanping Li, Daqing Yang, and Rajesh R. Shrestha 28 High-Resolution Weather Research Forecasting (WRF) Modeling and Projection Over Western Canada, Including Mackenzie Watershed / Yanping Li and Zhenhua Li 29 Responses of Boreal Forest Ecosystems and Permafrost to Climate Change and Disturbances: A Modeling Perspective / Shuhua Yi and Fengming Yuan 30 Future Trajectory of Arctic System Evolution / Kazuyuki Saito, John E. Walsh, Arvid Bring, Ross Brown, Alexander Shiklomanov, and Daqing Yang Correction to: Arctic Hydrology, Permafrost and Ecosystems / Daqing Yang, and Douglas L. Kane