ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Language
Number of Hits per Page
Default Sort Criterion
Default Sort Ordering
Size of Search History
Default Email Address
Default Export Format
Default Export Encoding
Facet list arrangement
Maximum number of values per filter
Auto Completion
Topics (search only within journals and journal articles that belong to one or more of the selected topics)
Feed Format
Maximum Number of Items per Feed
feed icon rss

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • Books  (5,273)
  • Online Books  (5,273)
Collection
  • Books  (5,273)
Language
Branch Library
  • 1
    Monograph available for loan
    Monograph available for loan
    Cham [u.a.] : Springer
    Call number: PIK N 076-16-89604
    Description / Table of Contents: The book outlines principal milestones in the evolution of the atmosphere, oceans and biosphere during the last 4 million years in relation with the evolution from primates to the genus Homo - which uniquely mastered the ignition and transfer of fire. The advent of land plants since about 420 million years ago ensued in flammable carbon-rich biosphere interfaced with an oxygen-rich atmosphere. Born on a flammable Earth surface, under increasingly unstable climates descending from the warmer Pliocene into the deepest ice ages of the Pleistocene, human survival depended on both-biological adaptations and cultural evolution, mastering fire as a necessity. This allowed the genus to increase entropy in nature by orders of magnitude. Gathered around camp fires during long nights for hundreds of thousandth of years, captivated by the flickering life-like dance of the flames, humans developed imagination, insights, cravings, fears, premonitions of death and thereby aspiration for immortality, omniscience, omnipotence and the concept of god. Inherent in pantheism was the reverence of the Earth, its rocks and its living creatures, contrasted by the subsequent rise of monotheistic sky-god creeds which regard Earth as but a corridor to heaven. Once the climate stabilized in the early Holocene, since about -7000 years-ago production of excess food by Neolithic civilization along the Great River Valleys has allowed human imagination and dreams to express themselves through the construction of monuments to immortality. Further to burning large part of the forests, the discovery of combustion and exhumation of carbon from the Earth's hundreds of millions of years-old fossil biospheres set the stage for an anthropogenic oxidation event, affecting an abrupt shift in state of the atmosphere-ocean-cryosphere system. The consequent ongoing extinction equals the past five great mass extinctions of species-constituting a geological event horizon in the history of planet Earth. Dr Andrew Glikson is an Earth and Paleo-climate Scientist, Visiting Fellow at the Australian National University, Research School of Earth Science, the School of Archaeology and Anthropology, and the Planetary Science Institute, and a member of the ANU Climate Change Institute.
    Type of Medium: Monograph available for loan
    Pages: XVII, 227 S. , Ill., graph. Darst.
    ISBN: 9783319225111
    Series Statement: Modern approaches in solid earth sciences 10
    Language: English
    Note: Foreword; Prologue; Acknowledgements; Contents; Chapter 1: Early Earth Systems; 1.1 Archaean and Proterozoic Atmospheres; 1.2 Early Biospheres; 1.3 Greenhouse States and Glaciations; Chapter 2: Phanerozoic Life and Mass Extinctions of Species; 2.1 Acraman Impact and Acritarchs Radiation; 2.2 Cambrian and Late Ordovician Mass Extinction; 2.3 Late and End-Devonian Mass Extinctions; 2.4 Late Permian and Permian-Triassic Mass Extinctions; 2.5 End-Triassic Mass Extinction; 2.6 Jurassic-Cretaceous Extinction; 2.7 K-T (Cretaceous-Tertiary Boundary) Mass Extinction; 2.8 Paleocene-Eocene Extinction. , 2.9 The End-Eocene FreezeChapter 3: Cenozoic Biological Evolution (by Colin Groves); 3.1 The Evolution of Mammals; 3.2 From Primates to Humans; 3.3 From Genetic Evolution to Cultural Evolution; Chapter 4: Fire and the Biosphere; 4.1 An Incendiary Biosphere; 4.2 The Deep-Time History of Fire; 4.3 Fire and Pre-historic Human Evolution; 4.4 Neolithic Burning and Early Civilizations; Chapter 5: The Anthropocene; 5.1 The Modern Atmosphere; 5.2 Neolithic Burning and Early Global Warming; 5.3 The Great Carbon Oxidation Event; 5.4 The Sixth Mass Extinction of Species; 5.5 The Faustian Bargain. , 5.6 The Post-anthropocene WorldChapter 6: Rare Earth; Chapter 7: Prometheus: An Epilogue; References; About the Book and the Authors; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    Monograph available for loan
    Monograph available for loan
    Abingdon, OX [u.a.] : Routledge
    Call number: IASS 16.89971
    Description / Table of Contents: In 2007/8 world food prices spiked and global economic crisis set in, leaving hundreds of millions of people unable to access adequate food. The international reaction was swift. In a bid for leadership, the 123 member countries of the United Nations' Committee on World Food Security (CFS) adopted a series of reforms with the aim of becoming the foremost international, inclusive and intergovernmental platform for food security. Central to the reform was the inclusion of participants (including civil society and the private sector) across all activities of the Committee. Drawing on data collect
    Type of Medium: Monograph available for loan
    Pages: xii, 242 S.
    ISBN: 9781138802520
    Series Statement: Routledge Studies in Food, Society and the Environment
    Language: English
    Note: Cover; Half Title; Title Page; Copyright Page; Dedication; Table of Contents; List of illustrations; Acknowledgements; Acronyms and abbreviations; 1 Introduction and overview: The world food price spikes; 2 Global governance: A framework for analysis; 3 The evolution of global food security policy; 4 The reform of the Committee on World Food Security; 5 Participation in global governance: Coordinating "the voices of those most affected by food insecurity"; 6 Multilateral power dynamics: Comparing outcomes of policy roundtables. , 7 Best practice: The Voluntary Guidelines on the Responsible Governance of Tenure8 Policy coordination at the global level: The Global Strategic Framework; 9 Conclusion: Reflections on civil society engagement in global food security governance; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
    Call number: Q 823 (8) / Regal 42
    Type of Medium: Monograph available for loan
    Pages: V, 196 S.
    ISBN: 9783662337813 , 9783662333846 (print)
    Series Statement: Wissenschaftliche Abhandlungen der Kaiserlichen Normal-Eichungs-Kommission VIII. Heft
    Language: German
    Note: Enth. u.a.: Zur Bestimmung der Ausdehnung von Materialien am Abbe-Fizeauschen Dilatometer / von W. Bein
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 4
    Monograph available for loan
    Monograph available for loan
    Berkeley : University of California Press
    Call number: PIK N 630-16-90153
    Type of Medium: Monograph available for loan
    Pages: xi, 772 S. , Ill., Kt.
    ISBN: 0520069218 (print)
    Series Statement: California natural history guides 56
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    Call number: IASS 16.90592
    Description / Table of Contents: Chapter 1. Introduction -- Chapter 2. China’s Arctic Policy -- Chapter 3. Japan’s Arctic Policy -- Chapter 4. Arctic Policy of South Korea (Republic of Korea) -- Chapter 5. Singapore’s Arctic Policy -- Chapter 6. India’s Arctic Policy -- Chapter 7. Conclusions
    Description / Table of Contents: This book examines the growing interest by Asian states, which are normally considered as ‘outsiders’ in the Arctic governance system. Whilst existing research asserts that Asian states are mostly interested in the economic aspect of the changing Arctic, including its mineral and fossil sources and the opening up of new sea routes, the book argues that the relation between Asian states and the Arctic is much more complex and dynamic, grounded in their unique perspective on national security and the role of economic development in securing their national interests. Aki Tonami is Researcher at the Nordic Institute of Asian Studies, Department of Political Science, University of Copenhagen, Denmark. She received her Ph.D from Kyoto University, Japan, and has worked as Research Advisor for the Ministry of Foreign Affairs of Japan. She has written extensively on East Asian environmental foreign policy, and her research interests include environmental governance, economic diplomacy, and the Polar Regions
    Type of Medium: Monograph available for loan
    Pages: xv, 140 Seiten , Illustrationen, Diagramme
    ISBN: 9781137537454 , 9781137537461 (eBook)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    Monograph available for loan
    Monograph available for loan
    Cham : Springer International Publishing
    Call number: 10/M 16.89929
    Description / Table of Contents: This work summarizes the historical progression of the field of lithium (Li) isotope studies and provides a comprehensive yet succinct overview of the research applications toward which they have been directed. In synthesizing the historical and current research, the volume also suggests prospective future directions of study. Not even a full decade has passed since the publication of a broadly inclusive summary of Li isotope research around the globe (Tomascak, 2004). In this short time, the use of this isotope system in the investigation of geo- and cosmochemical questions has increased dramatically, due, in part, to the advent of new analytical technology at the end of the last millennium. Lithium, as a light element that forms low-charge, moderate-sized ions, manifests a number of chemical properties that make its stable isotope system useful in a wide array of geo- and cosmochemical research fields.  
    Type of Medium: Monograph available for loan
    Edition: Online edition Springer eBook Collection. Earth and Environmental Science
    ISBN: 9783319014302 , 9783319014296
    Series Statement: Advances in isotope geochemistry
    Classification:
    Geochemistry
    Language: English
    Note: Methodology of Lithium Analytical Chemistry and Isotopic MeasurementsCosmochemistry of Lithium -- Li Partitioning, Diffusion and Associated Isotopic Fractionation: Theoretical and Experimental Insights -- Lithium in the Deep Earth: Mantle and Crustal Systems -- The Surficial Realm: Low Temperature Geochemistry of Lithium..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Monograph available for loan
    Monograph available for loan
    Cheltenham : Edward Elgar Publishing
    Call number: PIK B 160-16-90168
    Description / Table of Contents: Front matter -- Copyright -- Contents -- Figures -- Tables -- Contributors -- 1. They've 'never had it so good': the rise and rise of the super-rich and wealth inequality -- 2. Reconsidering the super-rich: variations, structural conditions and urban consequences -- PART I WEALTH, SELF AND SOCIETY -- 3. Historical geographies of wealth: opportunities, institutions and accumulation, c. 1800-1930 -- 4. On plutonomy: economy, power and the wealthy few in the second Gilded Age -- 5. Interrogating the legitimacy of extreme wealth: a moral economic perspective
    Description / Table of Contents: 6. Billionaire philanthropy: 'decaf capitalism' -- 7. Making money and making a self: the moral career of entrepreneurs -- 8. Taking up Caletrío's challenge: silence and the construction of wealth eliteness in Jamie Johnson's documentary film Born Rich -- 9. 'One time I'ma show you how to get rich!' Rap music, wealth and the rise of the hip-hop mogul -- 10. Biographies of illicit super-wealth -- PART II LIVING WEALTHY -- 11. Capital city? London's housing markets and the 'super-rich' -- 12. The residential spaces of the super-rich
    Description / Table of Contents: 13. Reconfiguring places - wealth and the transformation of rural areas -- 14. Performing wealth and status: observing super-yachts and the super-rich in Monaco -- 15. Flights of indulgence (or how the very wealthy fly): the aeromobile patterns and practices of the super-rich -- 16. Looking at luxury: consuming luxury fashion in global cities -- 17. The luxury of nature: the environmental consequences of super-rich lives -- PART III WEALTH AND POWER -- 18. Attracting wealth: crafting immigration policy to attract the rich -- 19. Sovereign wealth and the nation-state
    Description / Table of Contents: 20. Super-rich capitalism: managing and preserving private wealth management in the offshore world -- 21. Troubling tax havens: multi-jurisdictional arbitrage and corporate tax footprint reduction -- 22. No change there! Wealth and oil -- Index
    Description / Table of Contents: Fewer than 100 people own and control more wealth than 50 per cent of the world's population. The Handbook on Wealth and the Super-Rich is a unique examination of both the lives and lifestyles of the super-rich, as well as the processes that underpin super-wealth generation and its unequal distribution. Drawing on a multiplicity of international examples, leading experts from across the social sciences offer a landmark multidisciplinary contribution to emerging analyses of the global super-rich and their astonishing wealth. The book's 22 accessible and coherently organised chapters cover a ran
    Type of Medium: Monograph available for loan
    Pages: XI, 482 Seiten , Diagramme, Karten
    ISBN: 1783474041 (print) , 9781783474042 (print) , 9781783474035 (print)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Call number: M 16.90190
    Description / Table of Contents: Especially due to the increasing environmental problems there is a need to collect as many data as possible in the upper atmosphere. This book serves as a general multidisciplinary guide and introduction for a more effective use of the large amount of now available data from the Earth's atmosphere. It also shows the problems of the use of large amounts of time series data - for basic science as well as for environmental monitoring - and the related information systems. The book is aimed for scientists and students interested in the Earth's atmosphere which is vital for the understanding of environmental changes in the global system Earth
    Type of Medium: Monograph available for loan
    Pages: XVII, 1014 Seiten
    Edition: Online edition Springer eBook Collection. Earth and Environmental Science
    ISBN: 9783642787171 , 9783642787195 (print)
    Classification:
    Geosciences
    Language: English
    Note: I Physics of the Upper AtmosphereI.1 Introduction to the Earth’s Atmosphere -- I.2 Dynamics of the Atmosphere -- I.3 Atmospheric Tides -- I.4 Chemistry in the Atmosphere -- I.5 H2O in the Atmosphere -- I.6 Pollution of the Upper Atmosphere -- I.7 Transatmospheric Propagation of Radio Waves: The Role of the Atmosphere in Communication, Navigation, Geodesy etc. -- I.8 Atmosphere as a Part of the Biosphere -- I.9 Legal Aspects -- II Investigation Methods of the Upper Atmosphere -- II.1 Acoustic Methods for Probing the Upper Atmosphere -- II.2 Hydrodynamic and Electrodynamic Measurements -- II.3 Electromagnetic Waves in the Upper Atmosphere -- II.4 Chemistry and Physico-Chemistry -- II.5 Modification Methods -- III International Reference and Model Atmosphere -- III.1 Selected Features of the Middle Atmosphere -- III.2 The Thermosphere: Selected Features -- III.3 The Ionosphere -- III.4 Magnetosphere -- IV Special Phenomena of the Upper Atmosphere -- IV.1 Stratospheric Midwinter Warmings -- IV.2 The Antarctic Ozone Hole -- IV.3 Polar Mesospheric Clouds -- IV.4 Night Glow -- IV.5 Aurorae -- V Solar-Terrestrial Relations -- V.1 Solar Activity, Solar Cycle, Coordinates -- V.2 The Solar Wind and Its Effects on Geospace -- V.3 Geomagnetic Activity Indices -- VI Data Centres, Computer Network Communications, Observing Systems and Data Growth Rate Problems, Problems with Long-Term Data, Relevant for the Upper Atmosphere -- VI.1 General Overview of Online Services and Data Centres -- VI.2 The World Data Centre System, International Data Exchange, and New ICSU Programs -- VI.3 Computer Network Communications -- VI.4 SELDADS and SELSIS -- VI.5 Data Growth Rate Problems and Problems with Long-Term Data..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    Unknown
    Chicago : Precision Wordage Press
    Call number: 22/M 15.89567 (1. Ex.) ; 22/M 15.89567 (2. Ex.) ; 22/M 15.89567 (3. Ex.) ; 22/M 15.89567 (4. Ex.) ; 22/M 15.89567 (5. Ex.) ; 22/M 15.89567 (6. Ex.) ; 22/M 15.89567 (7. Ex.) ; 22/M 15.89567 (8. Ex.) ; 22/M 15.89567 (9. Ex.) ; 22/M 15.89567 (10. Ex.)
    Description / Table of Contents: Drawing from his own experience with corporations both large and small and as a business owner, Jack Molisani has seen every mistake the professional (or not-so-professional) can make in today's highly competitive job market. This book provides the tools for navigating these choppy waters. Starting with how to escape a dead-end job or an overbearing boss, to advancing one's career, and finally to achieving a higher standard of living, the book is divided into sections on finding new directions, making things happen, and optimizing the results. While most business guides focus on either job hun
    Pages: Online-Ressource (111 p)
    Edition: Online-Ausg.
    ISBN: 9780962709029
    Parallel Title: Print version: Be the Captain of Your Career : A New Approach to Career Planning and Advancement
    Language: English
    Note: Cover; Copyright; Praise; Introduction; Contents; Section 1: THINK IT; The First Thing to Do When You Find Yourself in a Hole: Stop Digging; Stay Positive; Never Lose Faith; Seven Career Lessons I Learned from Selling Ginsu Knives; A Turning Point; Stop. Breathe. Think. Then Act.; Overcoming Inertia; Overcoming Fear; Keep Swimming; Section 2: DO IT; What Is a Resume?; What Are Managers Looking For?; Dirty Little Resume Secrets; The T-Bomb; Current Experience; What You Do Is More Important than What You're Called; The Top Ten Mistakes Professionals Make When Looking for Work. , Resumes: A SummaryCover Your Letter; Following Up; Getting Interviews; Be Proactive; Be Visible; Social Networking; Four Critical Steps to Getting a Job Offer; Send Out Ships; Gold Calling; Section 3: HAVE IT; Creating the Path; Recession-Proof Your Career; Creating a PR Campaign; Taking the Initiative; Increase Your Ability to Find Work; Advancing Your Career through Personal Branding; Advancing Your Career through Progressive Information Disclosure; Honing Your Workplace Negotiation Skills; The Sky's the Limit; What Are You Waiting For?; About Making Money; Creating the Life You Want. , Recommended ReadingAbout the Author.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Monograph available for loan
    Monograph available for loan
    Amsterdam : Elsevier
    Call number: 19/M 16.90210
    Type of Medium: Monograph available for loan
    Pages: XVII, 321 Seiten , Illustrationen, Diagramme
    Edition: Second Edition
    Edition: Online-Ausg.
    ISBN: 9780128044889
    Classification:
    Mathematics
    Parallel Title: Print version Environmental data analysis with matlab
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    Monograph available for loan
    Monograph available for loan
    Oldenbourg : De Gruyter
    Call number: 18/M 16.90219
    Description / Table of Contents: 〈!doctype html public ""-//w3c//dtd html 4.0 transitional//en""〉 〈html〉〈head〉 〈meta content=""text/html; charset=iso-8859-1"" http-equiv=content-type〉 〈meta name=generator content=""mshtml 8.00.6001.23619""〉〈/head〉 〈body〉 〈P〉This book systematically describes important aspects when planning secure IT systems, as well as the different approaches that may be used. It presents procedures and protocols in detail and explains them with case examples. This book is a must-read for anyone involved in IT security.〈/P〉〈/body〉〈/html〉
    Type of Medium: Monograph available for loan
    Pages: XIV, 990 Seiten
    Edition: 9. Aufl.
    ISBN: 9783486778489
    Language: German
    Note: Vorwort; Inhaltsverzeichnis; 1 Einführung; 1.1 Grundlegende Begriffe; 1.2 Schutzziele; 1.3 Schwachstellen, Bedrohungen, Angriffe; 1.3.1 Bedrohungen; 1.3.2 Angriffs- undAngreifer-Typen; 1.3.3 Rechtliche Rahmenbedingungen; 1.4 ComputerForensik; 1.5 Sicherheitsrichtlinie; 1.6 Sicherheitsinfrastruktur; 2 Spezielle Bedrohungen; 2.1 Einführung; 2.2 Buffer-Overflow; 2.2.1 Einführung; 2.2.2 Angriffe; 2.2.3 Gegenmaßnahmen; 2.3 Computerviren; 2.3.1 Eigenschaften; 2.3.2 Viren-Typen; 2.3.3 Gegenmaßnahmen; 2.4 Würmer; 2.5 Trojanisches Pferd; 2.5.1 Eigenschaften; 2.5.2 Gegenmaßnahmen; 2.6 Bot-Netze undSpam. , 2.6.1 Bot-Netze2.6.2 Spam; 2.7 MobilerCode; 2.7.1 Eigenschaften; 2.7.2 Sicherheitsbedrohungen; 2.7.3 Gegenmaßnahmen; 2.7.4 MobileApps; 3 Internet-(Un-)Sicherheit; 3.1 Einführung; 3.2 Internet-Protokollfamilie; 3.2.1 ISO/OSI-Referenzmodell; 3.2.2 DasTCP/IP-Referenzmodell; 3.2.3 Das Internet-Protokoll IP; 3.2.4 DasTransmissionControlProtokoll TCP; 3.2.5 DasUserDatagramProtocolUDP; 3.2.6 DHCP und NAT; 3.3 Sicherheitsprobleme; 3.3.1 Sicherheitsprobleme von IP; 3.3.2 Sicherheitsprobleme von ICMP; 3.3.3 Sicherheitsprobleme vonARP; 3.3.4 Sicherheitsprobleme vonUDPundTCP. , 3.4 Sicherheitsprobleme vonNetzdiensten3.4.1 DomainNameService (DNS); 3.4.2 NetworkFileSystem(NFS); 3.4.3 WeitereDienste; 3.5 Web-Anwendungen; 3.5.1 World Wide Web (WWW); 3.5.2 Sicherheitsprobleme; 3.5.3 OWASPTop-TenSicherheitsprobleme; 3.6 Analysetools undSystemhärtung; 4 Security Engineering; 4.1 Entwicklungsprozess; 4.1.1 AllgemeineKonstruktionsprinzipien; 4.1.2 Phasen; 4.1.3 BSI-Sicherheitsprozess; 4.2 Strukturanalyse; 4.3 Schutzbedarfsermittlung; 4.3.1 Schadensszenarien; 4.3.2 Schutzbedarf; 4.4 Bedrohungsanalyse; 4.4.1 Bedrohungsmatrix; 4.4.2 Bedrohungsbaum; 4.5 Risikoanalyse. , 4.5.1 Attributierung4.5.2 Penetrationstests; 4.6 Sicherheitsarchitektur und Betrieb; 4.6.1 Sicherheitsstrategie undSicherheitsmodell; 4.6.2 Systemarchitektur undValidierung; 4.6.3 Aufrechterhaltung im laufenden Betrieb; 4.7 Sicherheitsgrundfunktionen; 4.8 Realisierung der Grundfunktionen; 4.9 Security Development Lifecycle (SDL); 4.9.1 Die Entwicklungsphasen; 4.9.2 Bedrohungs- und Risikoanalyse; 5 Bewertungskriterien; 5.1 TCSEC-Kriterien; 5.1.1 Sicherheitsstufen; 5.1.2 Kritik am Orange Book; 5.2 IT-Kriterien; 5.2.1 Mechanismen; 5.2.2 Funktionsklassen; 5.2.3 Qualität; 5.3 ITSEC-Kriterien. , 5.3.1 Evaluationsstufen5.3.2 Qualität und Bewertung; 5.4 Common Criteria; 5.4.1 Überblick über dieCC; 5.4.2 CC-Funktionsklassen; 5.4.3 Schutzprofile; 5.4.4 Vertrauenswürdigkeitsklassen; 5.5 Zertifizierung; 6 Sicherheitsmodelle; 6.1 Modell-Klassifikation; 6.1.1 Objekte undSubjekte; 6.1.2 Zugriffsrechte; 6.1.3 Zugriffsbeschränkungen; 6.1.4 Sicherheitsstrategien; 6.2 Zugriffskontrollmodelle; 6.2.1 Zugriffsmatrix-Modell; 6.2.2 RollenbasierteModelle; 6.2.3 Chinese-Wall Modell; 6.2.4 Bell-LaPadula Modell; 6.3 Informationsflussmodelle; 6.3.1 Verbands-Modell; 6.4 Fazit undAusblick. , 7 Kryptografische Verfahren.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
    Monograph available for loan
    Monograph available for loan
    Cambridge, Mass. : Belknap Press of Harvard University
    Call number: IASS 16.90614
    Type of Medium: Monograph available for loan
    Pages: 323 S.
    ISBN: 0674794850 , 9780674794856
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 13
    Call number: IASS 16.89795
    Description / Table of Contents: Interdisciplinarity has seemingly become a paradigm for modern and meaningful research. Clearly, the interdisciplinary modus of deliberation enables to unfold relevant but quite different disciplinary perspectives to the reflection of broader scientific questions or societal problems. However, whether the comprehensive results of interdisciplinary reflection prove to be valid or to be acceptable in trans-disciplinary terms depends upon certain preconditions, which have to be fulfilled for securing scientific quality and social trust in advisory contexts. The present book is written by experts and practitioners of interdisciplinary research and policy advice. It analyses topical and methodological approaches towards interdisciplinarity, starting with the current role of scientific research in society. The volume continues with contributions to the issues of knowledge and acting and to trans-disciplinary deliberation. The final conclusions address the scientific system as substantial actor itself as well as the relevant research and education politics
    Type of Medium: Monograph available for loan
    Pages: XVI, 195 p. 6 illus., 4 illus. in color
    Edition: Online edition Springer eBook Collection. Engineering
    ISBN: 9783319114002 , 9783319113999
    Series Statement: Ethics of Science and Technology Assessment, Schriftenreihe der EA European Academy of Technology and Innovation Assessment GmbH 43
    Language: English
    Note: IntroductionScience in Society -- Knowing and Acting -- Trans-disciplinary Deliberation -- Conclusions/Recommandations..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 14
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: PIK P 120-16-89806
    Description / Table of Contents: Deutschland wird seine bisher weitgehend auf fossilen Brennstoffen basierende Energieversorgung bis zum Jahr 2050 auf großtenteils regenerative Energien umstellen. Die Burgerinnen und Burger dieses Landes kennen dieses weltweit einzigartige Projekt unter dem Namen Energiewende. Von ihren gesellschaftlichen Wurzeln, dem Beginn ihrer Umsetzung und ihrer rasanten Entwicklung in den letzten Jahren berichtet Klaus-Dieter Maubach. Er beschreibt, wie das deutsche Energiesystem der Zukunft aussehen muss, und schlagt einen kurzfristigen Aktionsplan vor, der die volkswirtschaftlichen Kosten eindammt und
    Type of Medium: Monograph available for loan
    Pages: XX, 293 Seiten
    Edition: 2. Auflage
    ISBN: 3658054735 , 9783658054731
    Language: German
    Note: Vorwort zur zweiten Auflage; Vorwort; Inhalt; Abkürzungen; Einführung; Teil I; Eine kurze Geschichte der Energiewende; Fukushima und Ausstieg (2011); Fundamente der Energiewende (1980 - 1998); EnWG und EEG (1998 - 2003); Emissionshandel und Energiepreise (2003 - 2008); Netzregulierung und EEG (2004 - 2008); Krise in Europa (2009 - 2012); Teil II; Die Zukunft der Energiewende; Standortbestimmung (2013); 2050: Energiewende; Fossile Primärenergien; Die Regenerativen; Energiesystem der Zukunft; Politik für die Energiewende; 1 Braunkohle und Erdgas; 2 Auslaufbetrieb der Kernenergie ; 3 Energieeffizienz ; 4 Emissionshandel ; 5 EEG Reform ; 6 Regulierung der Stromnetze ; 7 Strommarktgestaltung ; 8 Koordinierung der Energiewende ; Zusammenfassung.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Call number: PIK 16-89825
    Type of Medium: Monograph available for loan
    Pages: Getr. Zählung , Ill., graph. Darst.
    Edition: Online-Ausg. Berlin Humboldt-Universität zu Berlin, Universitätsbibliothek 2011 〈〈Nach einem Exemplar der Humboldt-Universität zu Berlin, Universitätsbibliothek mit der Signatur: 〉〉Diss Geo11 P134
    Language: German
    Note: Berlin, Humboldt-Univ., Diss., 2011
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    Monograph available for loan
    Monograph available for loan
    Baden-Baden : Nomos
    Call number: IASS 16.90030
    Description / Table of Contents: Demokratie ist mehr als eine Methode, Regierende zu wählen. Sie ist auch eine besondere Art, sich das Politische als offenen und freien Raum vorzustellen und zu erleben. Demokratische Repräsentation bringt dies zum Ausdruck und mobilisiert dafür Symbole. Das Buch untersucht diesen Mechanismus und macht das Symbolische und das Imaginäre zum ersten Mal zum Gegenstand einer Theorie politischer Repräsentation. Es zeichnet die Transformationen der politischen Repräsentation nach den demokratischen Revolutionen nach und analysiert dabei die symbolische Bedeutung des Körpers. Denn eine der Hauptinnovationen der Demokratie war der Abschied von der Verkörperung
    Type of Medium: Monograph available for loan
    Pages: 387 S.
    Edition: 1. Aufl.
    ISBN: 9783848727773 (print)
    Series Statement: Studien zur Politischen Soziologie. Studies on Political Sociology 34
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
    Call number: M 16.90275
    Description / Table of Contents: Preface -- Contents -- Contributors -- Part I: Limnology, History and Comparative Legends -- 1: Pavin, the Birthplace of French Limnology (1770-2012), and Its Degassing Controversy (1986-2016) -- 1.1 Introduction -- 1.2 Analysis of Pavin Actors, History and Perception Through an Interdisciplinary and Intercomparative Approach -- 1.3 Pavin, a Typical Maar-Lake Above any Contamination Source -- 1.3.1 Pavin General Features -- 1.3.2 Pavin Compared to Other Lakes of the Cézallier Lake District -- 1.3.3 Pavin Compared to Other European Maar-Lakes -- 1.3.3.1 Eifel Lakes
    Description / Table of Contents: 1.3.3.2 Italian Lakes -- 1.4 Pavin Scientific Exploration (1770-1985) -- 1.4.1 Chevalier's Expedition (1770) -- 1.4.2 Lecoq, the Great Auvergne Naturalist, Normalizes Pavin… with Fishes (1847-1871) -- 1.4.3 The First Golden Age of Science at Pavin: Berthoule, Delebecque, Martel, Bruyant (1880-1914) -- 1.4.3.1 Clermont Botanists and Zoologists Establish the Limnological Station at Besse -- 1.4.3.2 André Delebecque at Pavin (1892) -- 1.4.3.3 Edouard-Alfred Martel at Creux de Soucy (1892) -- 1.4.4 Pavin Meromixis Discovery by Olivier and Pelletier (1950-1960s)
    Description / Table of Contents: 1.5 Pavin Acquires a Status of International Field Laboratory (1965-2000) -- 1.5.1 International Projects Select Pavin as a Pristine Lake (1965-1975) -- 1.5.2 Pavin, a Laboratory for Innovative Lake Research (1965-1986) -- 1.6 Maar Lakes Degassing Evidence in Cameroun and Italy -- 1.6.1 Nyos (21 August 1986) and Monoun (15 August 1984) Degassing Events and Their Effects on Populations -- 1.6.2 Ancient Degassing Events in Italian Maar-Lakes, Albano and Monticchio -- 1.6.2.1 The Albano Catastrophic Degassing and Spillover Event in Latium (398 BC)
    Description / Table of Contents: 1.6.2.2 Monticchio Lakes (Southern Italy) and Their Pioneer Degassing Studies, 1777-1838 -- 1.7 Sensory Grid of Degassing in Maar-Lakes -- 1.8 Pavin Degassing Controversy (1986-2016) -- 1.9 Conclusions -- References -- 2: Pavin, A Rich but Fragmented History (200 AD-2016) -- 2.1 Introduction -- 2.2 Finding Pavin Puzzle Pieces -- 2.3 Pavin's History Highlights -- 2.3.1 Antiquity: A Pompeian Millstone Retrieved from Pavin Waters in 1909 -- 2.3.2 Early Antique and Medieval Worship Near Pavin, on the Vassivière Mountain
    Description / Table of Contents: 2.3.3 Lacus pavens Terrifies the Whole Region Throughout the Sixteenth Century -- 2.3.3.1 The Terrible Explosion Witnessed at Vassivière by Besse People (28 August 1551 Pavin Event) -- 2.3.3.2 A Hazardous Abyss, Generating Storm, Thunder and Hail, Presented to Charles IX (1566) -- 2.3.3.3 Pavin Painted on the First Realistic Landscape Picture in France (1571-1579) -- 2.3.3.4 Pavin Marvelous Response to a Thrown Stone in Belleforest's Cosmographia Universalis (1575) -- 2.3.3.5 Lacus pavens, the Terrifying Lake, Is the Original Pavin Name (Banc 1605)
    Description / Table of Contents: 2.3.4 The Admirable and Terrifying Pavens Gets Famous During the Seventeenth Century
    Type of Medium: Monograph available for loan
    Pages: XV, 421 S.
    ISBN: 9783319399607
    Classification:
    Historical Geology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 18
    Call number: M 17.90713
    Type of Medium: Monograph available for loan
    Pages: VI, 205 S. , Ill.
    ISBN: 9789401031288 , 9789027702111 (print)
    Classification:
    Geomagnetism, Geoelectromagnetism
    Language: English
    Note: Composition and Dynamics of the Solar Wind PlasmaThe Configuration of the Interplanetary Magnetic Field -- Scattering and Scintillations of Discrete Radio Sources as a Measure of the Interplanetary Plasma Irregularities -- Galactic Cosmic Ray Modulation by the Interplanetary Medium (Including the Problem of the Outer Boundary) -- Low-Energy Cosmic Rays in Interplanetary Space -- Energetic Solar Particles in the Interplanetary Medium -- Discontinuities and Shock Waves in the Interplanetary Medium and Their Interaction with the Magnetosphere -- Interaction of the Solar Wind with the Moon..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 19
    Call number: IASS 16.90380
    Description / Table of Contents: Chapter 2 Governance of marine fisheries and biodiversity conservation: Convergence or coevolution?Introduction; Selected strands in fishery governance; Selected strands in conservation governance; Parallel strands in conservation and fishery governance; Discussion and conclusion; Notes; References; Chapter 3 Governance of marine fisheries and biodiversity conservation: The integration challenge; Introduction; Sustainable development backdrop; Integration process; Integration factors; Integration through interaction; Concluding thoughts; Notes; References; Part 2 Governance dimensions
    Description / Table of Contents: Chapter 4 Bio-ecological dimensions of fisheries management, biodiversity and governanceIntroduction and background; Fisheries management up to the 1990s; The ecological categories of impacts of fishing and their management; Areas of overlap and potential for inconsistencies between fisheries and conservation of biodiversity approaches; Venues for change; Conclusions; References; Chapter 5 The economic dimension: Addressing behaviour, incentives and context for effective governance; Introduction; Economic foundations of governance; The economic context of governance
    Description / Table of Contents: Evolving economic scope of governanceEconomic instruments in fisheries and marine conservation; Discussion: Economic instruments and prospects for governance integration; References; Chapter 6 The social dimension: The challenge of dealing with equity; Introduction: The two cultures; Fisheries management: creating wealth, forgetting about distribution; Conservation: creating values with unequal distribution of costs; Reconciling fisheries management and conservation; Consultation and co-management; Fisheries management and conservation within larger frameworks; Lessons learnt; Notes
    Description / Table of Contents: Governance of Marine Fisheries and Biodiversity Conservation; Copyright; Contents; Notes on contributors; Foreword Bonnie J. McCay; Foreword Árni M. Mathiesen; Foreword Braulio Ferreira de Souza Dias; Preface Serge M. Garcia, Jake Rice and Anthony Charles; Acknowledgements; List of selected acronyms; Glossary; Part 1 Governance trends and challenges; Chapter 1 Governance of marine fisheries and biodiversity conservation: A history; Introduction; Historical developments in fishery governance; Historical developments in biodiversity conservation; Conclusions; Notes; References
    Description / Table of Contents: Part 4. Regional governance. Regional governance for fisheries and biodiversity / R. Warner, K.M. Gjerde and D. Freestone ; Regional governance: The case of NEAFC and OSPAR / K. Hoydal, D. Johnson and A.H. Hoel ; Regional governance: The Mediterranean cradle / F. Simard, M. Camilleri and L. Sbai ; CCAMLR and Antarctic conservation: The leader to follow? / D. Miller and N.M. Slicer ; Implementation of the Ecosystem Approach to Fisheries in the Benguela Current LME area / J. Augustyn, S. Petersen, L. Shannon and H. Hamukuaya ; Governance of marine fisheries and conservation in the context of the European Union / S. Beslier and B. Drobenko -- Part 5. National governance. The use of national frameworks for sustainable development of marine fisheries and conservation, ecosystem-based management and integrated ocean management / K. Sainsbury, P. Gullestad and J. Rice ; Small-scale fisheries: Importance, vulnerability and deficient knowledge / J. Kolding, C. Béné and M. Bavinck ; Stewardship in tropical small-scale fisheries: Community and national perspectives / P. Christie, L.M. Campbell and N. Armada ; Making space for small-scale fishing communities: Use and misuse of spatial management instruments / M.R. Sowman, R. Rajagopalan, C. Sharma and J. Sunde ; ENGOs and SIDS: Environmental interventions in small island developing states / P. McConney, R. Pomeroy and Z. Khan ; The role of capacity building for improving governance of fisheries and conservation of marine ecosystems / J.C. Seijo and S. Salas ; Fishers' organizations: Their role in decision-making for fisheries and conservation / M. Makino, A.S. Cabanban and S. Jentoft ; The role of courts in fisheries management and marine biodiversity protection: US and EU systems / P. Shelley and T. van Rijn --
    Description / Table of Contents: Part 5. Conclusion. A tale of two streams: Synthesizing governance of marine fisheries and biodiversity conservation / A. Charles, S.M. Garcia and J. Rice -- Annexes. Annex 1: History of fisheries and biodiversity conservation: A timeline of key events (1850-2012) ; Annex 2: Key global institutions, bodies and processes: Roles, participation and main focus
    Description / Table of Contents: Part 1. Governance trends and challenges. Governance of marine fisheries and biodiversity conservation: A history / S.M. Garcia, J. Rice and A. Charles ; Governance of marine fisheries and biodiversity conservation: Convergence or coevolution? / S.M. Garcia, J. Rice and A. Charles ; Governance of marine fisheries and biodiversity conservation: The integration challenge / S.M. Garcia, J. Rice and A. Charles -- Part 2. Governance dimensions. Bio-ecological dimensions of fisheries management, biodiversity and governance / J. Rice and P. Mace ; The economic dimension: Addressing behaviour, incentives and context for effective governance / S. Hanna ; The social dimension: The challenge of dealing with equity / B. Hersoug ; The global legal dimension: Navigating the legal currents of rights and responsibilities / A.H. Hoel and D. VanderZwaag ; Spatial dimensions of fisheries and biodiversity governance / R. Kenchington, O. Vestergaard and S.M. Garcia ; Scientific foundation: Towards integration / J. Rice, S. Jennings and A. Charles -- Part 3. Global governance. Global level institutions and processes: Frameworks for understanding critical roles and foundations of cooperation and integration / L. Ridgeway ; Global level institutions and processes: Assessment of critical roles, foundations of cooperation and integration and their contribution to integrated marine governance / L. Ridgeway ; Integrative policy and legal instruments, approaches and tools: Fisheries and biodiversity conservation / B. Kuemlangan, J. Sanders, P. Deupmann and C. De Young ; Conservation and risk of extinction of marine species / P. Mace, C. O'Criodain, J. Rice and G. Sant ; Parallel initiatives: CBD's Ecologically or Biologically Significant Areas (EBSAs) and FAO's Vulnerable Marine Ecosystems (VMEs) criteria and processes / J. Rice, J. Lee and M. Tandstad --
    Description / Table of Contents: Governance of Marine Fisheries and Biodiversity Conservation explores governance of the world's oceans with a focus on the impacts of two inter-connected but historically separate streams of governance: one for fisheries, the other for biodiversity conservation. Chapters, most co-authored by leading experts from both streams, investigate the interaction of these governance streams from ecological, economic, social and legal perspectives, with emphasis on policies, institutions processes, and outcomes on scales from the global to the local community, and with coverage of a range of them
    Type of Medium: Monograph available for loan
    Pages: XXXVIII, 511 Seiten , Illustrationen, Karten
    ISBN: 9781118392645 (cloth)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 20
    Call number: PIK M 039-17-90409
    Description / Table of Contents: This book considers a relatively new metric in complex systems, transfer entropy, derived from a series of measurements, usually a time series. After a qualitative introduction and a chapter that explains the key ideas from statistics required to understand the text, the authors then present information theory and transfer entropy in depth. A key feature of the approach is the authors' work to show the relationship between information flow and complexity. The later chapters demonstrate information transfer in canonical systems, and applications, for example in neuroscience and in finance. The book will be of value to advanced undergraduate and graduate students and researchers in the areas of computer science, neuroscience, physics, and engineering
    Type of Medium: Monograph available for loan
    Pages: XXIX, 190 Seiten , Illustrationen, Diagramme
    ISBN: 9783319432212 (print)
    Language: English
    Note: Introduction -- Statistical Preliminaries -- Information Theory -- Transfer Entropy -- Information Transfer in Canonical Systems -- Information Transfer in Financial Markets -- Miscellaneous Applications of Transfer Entropy -- Concluding Remarks
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 21
    Call number: M 17.90543
    Description / Table of Contents: This book is a new edition of Roederer’s classic Dynamics of Geomagnetically Trapped Radiation, updated and considerably expanded. The main objective is to describe the dynamic properties of magnetically trapped particles in planetary radiation belts and plasmas and explain the physical processes involved from the theoretical point of view. The approach is to examine in detail the orbital and adiabatic motion of individual particles in typical configurations of magnetic and electric fields in the magnetosphere and, from there, derive basic features of the particles’ collective “macroscopic” behavior in general planetary environments. Emphasis is not on the “what” but on the “why” of particle phenomena in near-earth space, providing a solid and clear understanding of the principal basic physical mechanisms and dynamic processes involved. The book will also serve as an introduction to general space plasma physics, with abundant basic examples to illustrate and explain the physical origin of different types of plasma current systems and their self-organizing character via the magnetic field. The ultimate aim is to help both graduate students and interested scientists to successfully face the theoretical and experimental challenges lying ahead in space physics in view of recent and upcoming satellite missions and an expected wealth of data on radiation belts and plasmas
    Type of Medium: Monograph available for loan
    Pages: xviii, 192 Seiten
    Edition: Second edition
    ISBN: 9783642415296
    Series Statement: Astrophysics and Space Science Library 403
    Classification:
    Geomagnetism, Geoelectromagnetism
    Language: English
    Note: Particle Drifts and the First Adiabatic InvariantParticle Trapping, Drift Shells and the Second Adiabatic Invariant -- Periodic Drift Motion and the Third Adiabatic Invariant -- Trapped Particle Distributions and Flux Mapping -- Violation of the Adiabatic Invariants and Trapped Particle Diffusion -- Introduction to Plasma Physics..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    Call number: 9783319429281 (e-book)
    Description / Table of Contents: This Handbook presents a complete and rigorous overview of the fundamentals, methods and applications of the multidisciplinary field of Global Navigation Satellite Systems (GNSS), providing an exhaustive, one-stop reference work and a state-of-the-art description of GNSS as a key technology for science and society at large. All global and regional satellite navigation systems, both those currently in operation and those under development (GPS, GLONASS, Galileo, BeiDou, QZSS, IRNSS/NAVIC, SBAS), are examined in detail. The functional principles of receivers and antennas, as well as the advanced algorithms and models for GNSS parameter estimation, are rigorously discussed. The book covers the broad and diverse range of land, marine, air and space applications, from everyday GNSS to high-precision scientific applications and provides detailed descriptions of the most widely used GNSS format standards, covering receiver formats as well as IGS product and meta-data formats. The full coverage of the field of GNSS is presented in seven parts, from its fundamentals, through the treatment of global and regional navigation satellite systems, of receivers and antennas, and of algorithms and models, up to the broad and diverse range of applications in the areas of positioning and navigation, surveying, geodesy and geodynamics, and remote sensing and timing. Each chapter is written by international experts and amply illustrated with figures and photographs, making the book an invaluable resource for scientists, engineers, students and institutions alike.
    Type of Medium: 12
    Pages: 1 online resource (1,335 pages) : , illustrations (some color), photographs, tables.
    ISBN: 9783319429267 , 9783319429281 (e-book)
    Series Statement: Springer Handbooks
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
    Call number: M 17.90783
    Type of Medium: Monograph available for loan
    Pages: 358 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9785020384132
    Language: Russian
    Note: Zusammenfassung, Einführung und Inhaltsverzeichnis auch in engl. Sprache
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 24
    Call number: ISO 50001
    Type of Medium: Non-book medium
    Pages: Online Ressource
    Series Statement: ISO 50001:2011
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Monograph available for loan
    Monograph available for loan
    New York, NY : Springer New York
    Call number: M 17.91078
    Description / Table of Contents: Fracture in structural materials remains a vital consideration in engineering systems, affecting the reliability of machines throughout their lives. Impressive advances in both the theoretical understanding of fracture mechanisms and practical developments that offer possibilities of control have re-shaped the subject over the past four decades. The contributors to this volume, including some of the most prominent researchers in the field, give their long-range perspectives of the research on the fracture of solids and its achievements. The subjects covered in this volume include: statistics of brittle fracture, transition of fracture from brittle to ductile, mechanics and mechanisms of ductile separation of heterogenous solids, the crack tip environment in ductile fracture, and mechanisms and mechanics of fatigue. Materials considered range from the usual structural solids to composites. The chapters include both theoretical points of view and discussions of key experiments. Contributors include: from MIT, A.S. Argon, D.M. Parks; from Cambridge, M.F. Ashby; from U.C. Santa Barbara, A.G. Evans, R. McMeeking; from Glasgow, J. Hancock; from Harvard, J.W. Hutchinson, J.R. Rice; from Sheffield, K.J. Miller; from Brown, A. Needleman; from the Ecole des Mines, A. Pineau; from U.C. Berkeley, R. O. Ritchie; and from Copenhagen, V. Tvergaard
    Type of Medium: Monograph available for loan
    Pages: 346 Seiten
    Edition: Online edition Springer eBook Collection. Engineering
    ISBN: 9781461229346 , 9781461277262 (print)
    Classification:
    Engineering
    Language: English
    Note: 1. Peierls Framework for Analysis of Dislocation Nucleation from a Crack Tip2. Advances in Characterization of Elastic-Plastic Crack-Tip Fields -- 3. Constraint and Stress State Effects in Ductile Fracture -- 4. Void Growth in Plastic Solids -- 5. Crack Blunting and Void Growth Models for Ductile Fracture -- 6. Global and Local Approaches of Fracture - Transferability of Laboratory Test Results to Components -- 7. Growth of Cracks By Intergranular Cavitation in Creep -- 8. Cracking and Fatigue in Fiber-Reinforced Metal and Ceramic Matrix Composites -- 9. Metal Fatigue - A New Perspective -- 10. Reflections on Contributions to Deformation and Fracture..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    facet.materialart.12
    New York, Basingstoke : Freeman
    Call number: 9781464138744
    Type of Medium: 12
    Pages: 1 Online-Ressource (755 Seiten) , Illustrationen, Diagramme, Karten
    Edition: 7th edition
    ISBN: 978-1-4641-3874-4 , 1-4641-3874-5
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Call number: 9783893365500 (print)
    In: Schriften des Forschungszentrums Jülich
    Description / Table of Contents: Die Anzahl wissenschaftlicher Publikationen in Zeitschriften, die Anzahl von Zitationen in diesen Zeitschriftenartikeln und die Anzahl angemeldeter Patente steigen kontinuierlich und scheinbar unaufhaltsam. Der Einsatz von Bibliometrie eröffnet die Möglichkeit, diese Kommunikation in der Wissenschaft transparenter zu machen: So können mit Hilfe von Bibliometrie die Entwicklung von Themen nachvollzogen, die Wahrnehmung von Einrichtungen bestimmt und mögliche Kooperationspartner identifiziert werden. Die Dissertation illustriert, wie es mit Hilfe von quantitativen bibliometrischen Methoden möglich ist, einen objektiven Eindruck wissenschaftlicher Entwicklung zu gewinnen. Sie befasst sich dabei mit der Frage, wie Bibliometrie im Kontext von Trendbeobachtung und Trenderkennung in der Naturwissenschaft eingesetzt werden kann und welcher Nutzen sich hieraus ergibt. | The number of scientific publications in journals, the number of citations in these journal articles and the number of patent applications are all rising steadily in what appears to be an unstoppable manner. The use of bibliometrics is one way of making this communication within science more transparent. Bibliometrics can be used as an aid to understand the development of topics, to determine the perception of institutions, and to identify possible cooperation partners. This dissertation will explain how quantitative bibliometric methods can be used to gain an objective impression of scientific development. It looks at how bibliometrics can be used for trend observation and trend recognition in the natural sciences and the benefits that arise as a result.
    Type of Medium: 12
    Pages: Online Ressource (311 Seiten) , Illustrationen, Diagramme
    ISBN: 9783893365500
    Series Statement: Schriften des Forschungszentrums Jülich 19
    Language: German
    Note: Zugl.: Regensburg, Univ., Diss., 2007
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    Call number: IASS 20.93439
    Type of Medium: Monograph available for loan
    Pages: 255 Seiten , graphische Darstellungen
    ISBN: 9783946356134
    Series Statement: Wuppertal Spezial 55
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
  • 30
    Monograph available for loan
    Monograph available for loan
    Cham : Springer International Publishing AG
    Call number: IASS 19.93029
    Type of Medium: Monograph available for loan
    Pages: x, 198 Seiten , graphische Darstellungen
    Edition: 1st ed. 2019
    ISBN: 9783319937298 , 3319937294 , 9783319937304 , 3319937308
    Series Statement: Sustainable Production, Life Cycle Engineering and Management
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 31
    Call number: 9783658282356 (e-book)
    Type of Medium: 12
    Pages: 1 Online-Ressource (433 Seiten) , Illustrationen
    ISBN: 9783658282356 (e-book)
    Series Statement: Politik gestalten - Kommunikation, Deliberation und Partizipation bei politisch relevanten Projekten
    Language: English
    Note: Inhaltsverzeichnis Vorhabenträger auf dem Weg zu gesellschaftlich tragfähigen Lösungen / Frank Brettschneider und Ulrich Müller Baustellenbeirat und Baggerballett / Sarah Rögele Kommunikationsmanagement bei Bau- und Infrastrukturprojekten / Lisa Fehrentz Dialogorientierte Baukommunikation / Annika Zimmer Atomausstieg 2022 / Julia Schabel
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Monograph available for loan
    Monograph available for loan
    Oxfordshire, England ;New York, New York : Routledge
    Call number: IASS 15.89077
    Type of Medium: Monograph available for loan
    Pages: x, 201 Seiten , Illustrationen
    ISBN: 9781138796362
    Series Statement: Routledge Studies in Sustainable Development
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Monograph available for loan
    Monograph available for loan
    Malden, MA : Blackwell Pub
    Call number: PIK W 101-15-89162
    Description / Table of Contents: In an increasingly globalized world, an understanding of the role of international trade is central to the study of agricultural economics and agribusiness. This text interweaves these two elements, explaining the theories and practices relevant to agricultural trade. Using real-life examples to explain theories and models, the text prepares readers to critically examine agricultural trade issues. In addition to its comprehensive coverage, each chapter features chapter overviews and summaries, key concepts, questions for review, and suggested readings.Explains the theories and practices releva
    Type of Medium: Monograph available for loan
    Pages: XIV, 280 S. , graph. Darst. , 26 cm
    ISBN: 1405108002 (hardback : alk. paper) , 0470759186 , 9781405108003
    Language: English
    Note: Classical theory of comparative advantageComparative advantage with two factors of production -- Comparative advantage and factor endowments : the Heckscher-Ohlin theorem -- Imperfect competition and economies of scale in trade -- The partial equilibrium analysis of international trade -- Trade restrictions : tariffs -- Non-tariff trade barriers -- Domestic support policies and trade -- Multilateral trade negotiations and U.S. trade policy -- Economic integration -- Foreign exchange markets and the exchange rate -- Agricultural trade and the exchange rate -- International capital movements and multinational corporations -- Agricultural trade and economic development -- Trade and the environment..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Call number: PIK N 071-15-89205
    Description / Table of Contents: This book offers new perspectives of transdisciplinary research, in methodological as well as theoretical respects. It provides insights in the two-fold bio-physical and the socio-cultural global embeddedness of local living conditions on the basis of selected empirical studies from Latin America, Asia, Africa, Australia, and Europe. The theoretical foundations of ecological research and sustainability policies were developed at the end of the nineteenth century. They are largely based on investigations of living spaces, and the evolution and differentiation of varied life forms. This perspective is embedded in the practical and theoretical European problem situations of the past and lacks social and cultural differentiation. The transformation of spatial and natural relations as a result of the globalization process is so radical that new theories are needed to solve 21st century ecological problems. Moreover, in view of the lack of an ontologically sound and promising strategy for transdisciplinary problem solving, as well as an acceptable consideration of the power of cultural schemas relating to natural living’s interpretations, there is a strong need to focus on sustainable social practices, habits, and routines, rather than on predominantly living spaces or eco-topes. This book elaborates on the transdisciplinary approach by reflecting on the theoretical heritage and a global perspective of sustainability, by focusing on the primary role of a social approach in sustainability research, and by putting emphasis on cultural dimension of sustainability. It postulates that global sustainability is grounded in a global understanding of our everyday activities
    Type of Medium: Monograph available for loan
    Pages: XV, 300 S. , Ill., graph. Darst.
    ISBN: 9783319164779 , 9783319164762
    Language: English
    Note: Introduction; Benno WerlenPreface: Speech at TIERS Conference in Jena on 8 June 2012; Matthias Machnig -- PART I: INTEGRATED TRANSDISCIPLINARY RESEARCH -- Chapter 1: Sustainability and Territory: An Approach from the Perspective of the Imaginary in Shaping Development; Enrique Aliste -- Chapter 2: Challenges for Transdisciplinary Research; Joske Bunders -- Chapter 3: Narratives for a Sustainable Future. Vision and Motivation for Collective Action; Ilan Chabay -- PART II: KNOWLEDGE -- Chapter 4: Carving a Niche for the Social Sciences in Trans-disciplinary Research on Climate Change Adaptation and Agriculture in Southern Africa; Chipo Plaxedes Mubaya -- Chapter 5: From Co-Production of Knowledge to Transdisciplinary Research. Lessons from the Quest for Producing Socially Robust Knowledge; Juergen Weichselgartner and Bernhard Truffer -- PART III: INTERFACES SOCIETY NATURE -- Chapter 6: Terrestrial Ecosystems Dynamic in the Senegalese Agro-silvopastoral Center-east in the Second Half of the XXe Century; Aliou Dijouf and Matthew G. Hatvany -- Chapter 7: Integrated Global Change Research in West Africa: Flood Vulnerability Studies; Ibidun Adelekan -- Chapter 8: Integrated Approach in Environment Management: Context Bangladesh; Raquib Ahmed -- Chapter 9: Awareness of and Responses to the 2011 Flood Warnings among Vulnerable Communities in Lagos, Nigeria; Olokesusi, F., Olorunfemi, F.B., Onwuemele A. and Oke, M.O -- PART IV: INTERFACES SCIENCE POLICY -- Chapter 10: Solution-Based Spatial Planning for Disaster Risk Reduction and Adaptation to Climate Change in Taiwan; Yu-Fang Lin -- Chapter 11: Institutions and Planning: A Reflection from the Disaster Management Planning in Indonesia; Hendricus A Simarmata and Raka W Suryandaru -- Chapter 12: Could the Search for Sustainability Reinforce the Socio-ecological Conflict? The Mining Industry in Chile and its Impact at the Local and Regional Level; Fernando Campos-Medina -- Chapter 13: Institutions and Planning: A Reflection from Disaster Management Planning in Indonesia; Hendricus A. Simarmata and Raka W. Suryandaru -- Chapter 14: Could the Search for Sustainability Reinforce the Socio-ecological Conflict? The Mining Industry in Chile and its Impact at the Local and Regional Level; Fernando Campos-Medina -- Chapter 15: Political decision-making and Scientific Insights. A comment form the Political Arena; Matthias Machnig..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Monograph available for loan
    Monograph available for loan
    Berlin : Springer
    Call number: 6/M 16.89656
    Description / Table of Contents: Geodetic datum (including coordinate datum, height datum, depth datum, gravimetry datum) and geodetic systems (including geodetic coordinate system, plane coordinate system, height system, gravimetry system) are the common foundations for every aspect of geomatics. This course book focuses on geodetic datum and geodetic systems, and describes the basic theories, techniques, methods of geodesy. The main themes include: the various techniques of geodetic data acquisition, geodetic datum and geodetic control networks, geoid and height systems, reference ellipsoid and geodetic coordinate systems, Gaussian projection and Gaussian plan coordinates and the establishment of geodetic coordinate systems. The framework of this book is based on several decades of lecture noted and the contents are developed systematically for a complete introduction to the geodetic foundations of geomatics.
    Description / Table of Contents: REVIEW: "The present work integrates both classical materials and modern developments in geodesy, it describes pure theoretical approaches and recent practical applications. The book can be used as a general textbook for undergraduates studying geomatics and survejing and mapping in higher education institutions. For technicians who are engaged in geomatic and surveying engineering, the book is strongly recommended as a basic and useful reference guide."
    Type of Medium: Monograph available for loan
    Pages: XXI, 401 S.
    ISBN: 9783642412455 , 9783642412448
    Classification:
    Geodesy
    Language: English
    Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Call number: doi:10.1007/BFb0117757
    Description / Table of Contents: The book gives a general overview of recent approaches to debris flows. Problems of both occurrences and dynamics of debris flow are treated, taking into account new results from theoretical and experimental research and field observations. Finally, the functioning of the main control devices are reconsidered in the light of the state of the art.
    Type of Medium: 12
    Pages: X, 226 Seiten , Illustrationen, Diagramme
    ISBN: 354062466X , 978-3-540-62466-0 , 978-3-540-49729-5
    Series Statement: Lecture notes in earth sciences 64
    Language: English
    Note: Pages 1-6, Introduction, Etsuro Shimokawa --- Pages 7-26, Prediction of debris flow for warning and evacuation, Muneo Hirano --- Pages 27-45, Large and small debris flows—Occurrence and behaviour, Tim R. Davies --- Pages 46-63, Field survey for debris flow in volcanic area, Etsuro Shimokawa, Takashi Jitousono --- Pages 65-69, Introduction, Pierre Julien --- Pages 70-92, A comparison between gravity flows of dry sand and sand-water mixtures, Haruyuki Hashimoto --- Pages 93-116, Review dynamic modeling of debris flows, Chyan-Deng Jan, Hsieh Wen Shen --- Pages 117-143, Dynamics of the inertial and viscous debris flows, Tamotsu Takahashi --- Pages 144-162, Selected notes on debris flow dynamics, P. Y. Julien, J. S. O'Brien --- Pages 163-165, Introduction, Aronne Armanini --- Pages 166-185, Development of new methods for countermeasures against debris flows, Shun Okubo, Hiroshi Ikeya, Yoshiharu Ishikawa, Takashi Yamada --- Pages 186-207, Torrent check dams as a control measure for debris flows, Martin N. R. Jaeggi, Stefano Pellandini --- Pages 208-226, On the dynamic impact of debris flows, Aronne Armanini
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    Monograph available for loan
    Monograph available for loan
    Paris : OECD
    Call number: PIK W 101-16-89599
    Description / Table of Contents: This annual publication provides information on policy developments and related support to agriculture in OECD countries and selected partner economies, measured with the OECD Producer Support Estimate methodology. Countries covered represent about 80% of the global value added in agriculture. The report includes a general discussion on developments in agricultural policies and specific chapters for each country covered
    Description / Table of Contents: This annual publication provides information on policy developments and related support to agriculture in OECD countries and selected partner economies, measured with the OECD Producer Support Estimate methodology. Countries covered represent about 80% of the global value added in agriculture. The report includes a general discussion on developments in agricultural policies and specific chapters for each country covered.
    Type of Medium: Monograph available for loan
    Pages: 293 S. , graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9789264234529
    Language: English
    Note: Foreword; Acknowledgements; Table of contents; Reader's guide; Definition of OECD indicators of agricultural support; Nominal indicators used in this report; Ratio indicators and percentage indicators; Box 1. Definitions of categories in the PSE classification; Decomposition indicators; Definition of GSSE categories; Sources and definitions of contextual indicators; Table X.1. Contextual indicators; Box 2. Definitions of categories in the GSSE classification; Figure X.2. Main macroeconomic indicators; Figure X.3. Agro-food trade; OECD indicators of support; Currencies. , List of acronyms and abbreviationsExecutive summary; Recommendations; Chapter 1. Developments in agricultural policy and support; Key economic and market developments; Table 1.1. Key economic indicators; Figure 1.1. Commodity world price indices, 2007 to 2014; Main features of agricultural policies; Box 1.1. Agriculture and COP21; Box 1.2. Developments post the 2013 Bali WTO Ministerial; Developments in agricultural support; Countries' importance in global agriculture has changed since the mid-1990s - and so has their role in supporting agriculture. , Figure 1.2. Country shares in total agricultural GDP and in total TSE, 1995-97 and 2012-14Total monetary transfers to the agricultural sector were stable in some countries, but increased significantly in others; Figure 1.3. Evolution of Total Support Estimate, 1995-97 to 2012-14; However the relative cost of agricultural support for the economies has decreased significantly over time in most of the countries; Figure 1.4. Total Support Estimate by country, 1995-97 and 2012-14. , The total agricultural support is dominated by support to agricultural producers, while expenditures on key general services to the sector are relatively smallFigure 1.5. Composition of Total Support Estimate by country, 2012-14; Average support to agricultural producers in OECD countries and emerging economies is converging; Figure 1.6. Evolution of Producer Support Estimate, 1995 to 2014; However short- and long-term changes across individual countries remain very uneven; Figure 1.7. Producer Support Estimate by country, 2013 and 2014. , Box 1.3. What drove changes in the monetary value of producer support in 2014?Figure 1.8. Contribution of various factors to the change in the Producer Support Estimate in 2014; Box 1.3. What drove changes in the monetary value of producer support in 2014? (cont.); Figure 1.9. Evolution of producer support at different stages of economic development, 1986 to 2013; Figure 1.10. Producer Support Estimate by country, 1995-97 and 2012-14; Differences in policy approaches are also reflected in policy instruments; Figure 1.11. Composition of Producer Support Estimate by country, 2012-14. , Figure 1.12. Composition of payments based on area, animal numbers, receipts and income by country, 1995-97 and 2012-14.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
    Monograph available for loan
    Monograph available for loan
    Princeton : Princeton University Press
    Call number: PIK E 713-15-0146
    Description / Table of Contents: As countless love songs, movies, and self-help books attest, men and women have long sought different things. The result? Seemingly inevitable conflict. Yet we belong to the most cooperative species on the planet. Isn't there a way we can use this capacity to achieve greater harmony and equality between the sexes? In The War of the Sexes, Paul Seabright argues that there is--but first we must understand how the tension between conflict and cooperation developed in our remote evolutionary past, how it shaped the modern world, and how it still holds us back, both at home and at work. 〈
    Type of Medium: Monograph available for loan
    Pages: XI, 241 S. : Ill.
    ISBN: 9780691159720
    Language: English
    Note: Cover; Title Page; Copyright Page; Dedication Page; Table of Contents; Acknowledgments; Part One: Prehistory; 1. Introduction; 2. Sex and Salesmanship; 3. Seduction and the Emotions; 4. Social Primates; Part Two: Today; 5. Testing for Talent; 6. What Do Women Want?; 7. Coalitions of the Willing; 8. The Scarcity of Charm; 9. The Tender War; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 39
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
    Monograph available for loan
    Monograph available for loan
    London : Routledge
    Call number: IASS 16.90562
    Description / Table of Contents: This book analyzes the expanding oil and gas activities in the Arctic from a social and developmental perspective, raising questions concerning the interaction between indigenous peoples, governments and oil and gas companies
    Type of Medium: Monograph available for loan
    Pages: xi, 390 S. , graph. Darst., Kt.
    ISBN: 041544330X (hbk) , 9780415443302 (hbk) , 0415619823 (pbk) , 9780415619820 (pbk) , 0203893743 (ebook) , 9780203893746 (ebook)
    Series Statement: Routledge explorations in environmental economics
    Language: English
    Note: Book Cover; Title; Copyright; Contents; Figures; Tables; Contributors; Preface; Acknowledgements; 1 Introduction; Part I The Arctic: Context, framework and methodology; 2 Framing oil and gas in the Arctic from a sustainable development perspective; 3 Climate change and consequences for the Arctic; 4 Corporate social responsibility: The economic and institutional responsibility of business in society; 5 Framework and methodology: Regulation and discourse analysis as a research strategy; Part II Legal and institutional framework: Case studies. , 6 Legal and institutional framework: A comparative analysis7 Expanding oil and gas activities on the North Slope of Alaska; 8 Oil and gas activities at the Mackenzie Delta, in Canada's Northwest Territories; 9 Going North: The new petroleum province of Norway; 10 The Russian model: Merging profit and sustainability; Part III Comparisons and managerial implications; 11 Human rights and indigenous peoples in the Arctic: What are the implications for the oil and gas industry?; 12 Perceptions of Arctic challenges: Alaska, Canada, Norway and Russia compared; 13 Managerial implications; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 41
    Monograph available for loan
    Monograph available for loan
    London ; New York : I.B.Tauris
    Call number: IASS 16.90564
    Description / Table of Contents: As climate change makes the Arctic a region of key political interest, so questions of sovereignty are once more drawing international attention. The promise of new sources of mineral wealth and energy, and of new transportation routes, has seen countries expand their sovereignty claims. Increasingly, interested parties from both within and beyond the region, including states, indigenous groups, corporate organizations, and NGOs and are pursuing their visions for the Arctic. What form of political organization should prevail? Contesting the Arctic provides a map of potential governance optio
    Type of Medium: Monograph available for loan
    Pages: XIII, 209 S. , Ill., Kt.
    ISBN: 9781780761480 , 9780857738448 (ebook)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    Monograph available for loan
    Monograph available for loan
    London ; New York : Routledge
    Call number: IASS 16.90582
    Type of Medium: Monograph available for loan
    Pages: XIV, 110 Seiten
    ISBN: 9781138799202 (hbk) , 9781315756196 (ebk)
    Series Statement: Global Institutions
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
    Monograph available for loan
    Monograph available for loan
    Princeton : Princeton University Press
    Call number: PIK B 120-15-0145
    Description / Table of Contents: In one lifetime, GDP, or Gross Domestic Product, has ballooned from a narrow economic tool into a global article of faith. It is our universal yardstick of progress. As The Little Big Number demonstrates, this spells trouble. While economies and cultures measure their performance by it, GDP ignores central facts such as quality, costs, or purpose. It only measures output: more cars, more accidents; more lawyers, more trials; more extraction, more pollution-all count as success. Sustainability and quality of life are overlooked. Losses don't count. GDP promotes a form of stupid growth and igno
    Type of Medium: Monograph available for loan
    Pages: IX, 398 S. : graph. Darst.
    ISBN: 9780691166520
    Language: English
    Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; Introduction: We Become What We Measure; Casting a Spell; Exploring a Path; 1. More, Better, Faster: The Beginnings ; Productivity, Growth, and Success; Goals and Measures; Values and Measures; 2. The Origins of Bling: The Spirit of Economic Growth ; The World of Growth: Refining the Measure; Business Accounting Goes National; 3. The Crucible of Crisis: The Great Depression and the Need for Economic Indicators ; 4. Born from Disaster: The Making of a Key Measure ; The Challenge; The Players; The Method; The Findings. , The Big Conundrum: Translating Findings into Action5. Forged in War; 6. Global Domination: The Age of GDP ; For Richer or Poorer; A Stunted Priesthood; Stopgap Consensus; Going Global; New Rules; GDP Junkies; Shackled in Fool's Gold; 7. Today's ABC of GDP ; It's an Emperor, but Does It Have Clothes?; Why It Matters; 8. More Is Not Enough ; The Little Big Number: Our Report Card for Success; Emerging Dissent; 9. "The People of Plenty Are a People of Waste"; Breaking the Spell; 10. From Alchemy to Reason: What If? A Thought Experiment; Mental Cobwebs; One More Time: Simon Kuznets. , Clearing a Path11. Looking Forward; A Daring Vision; A Moment of Possibility; Appendix A. The Measure as Guide; Notes; Bibliography; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 44
    Monograph available for loan
    Monograph available for loan
    Princeton : Princeton University Press
    Call number: PIK D 020-15-0143 ; IASS 15.89713
    Description / Table of Contents: Complexity science-made possible by modern analytical and computational advances-is changing the way we think about social systems and social theory. Unfortunately, economists' policy models have not kept up and are stuck in either a market fundamentalist or government control narrative. While these standard narratives are useful in some cases, they are damaging in others, directing thinking away from creative, innovative policy solutions. Complexity and the Art of Public Policy outlines a new, more flexible policy narrative, which envisions society as a complex evolving system that is uncont
    Type of Medium: Monograph available for loan
    Pages: VIII, 310 S.
    ISBN: 9780691152097
    Language: English
    Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; PART I. THE COMPLEXITY FRAME FOR POLICY; Chapter 1. Twin Peaks; Chapter 2. Government With, Not Versus, the Market; Chapter 3. I Pencil Revisited: Beyond Market Fundamentalism; Chapter 4. The Complexity Policy Frame; PART II. EXPLORING THE FOUNDATIONS; Chapter 5. How Economics Lost the Complexity Vision; Chapter 6. How Macroeconomics Lost the Complexity Vision; Chapter 7. Complexity: A New Kind of Science?; Chapter 8: A New Kind of Complexity Economics?; Chapter 9. Nudging toward a Complexity Policy Frame. , PART III. LAISSEZ-FAIRE ACTIVISM IN PRACTICEChapter 10. The Economics of Influence; Chapter 11. Implementing Influence Policy; Chapter 12. Laissez-Faire Activism; Chapter 13. Getting the Ecostructure of Government Right; PART IV. THE LOST AGENDA; Chapter 14. Getting the Ecostructure of Social Science Education Right; Chapter 15. The Lost Agenda; Notes; Bibliography; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
    Monograph available for loan
    Monograph available for loan
    Princeton [u.a.] : Princeton University Press
    Call number: PIK B 130-15-0139
    Description / Table of Contents: Efficiently Inefficient describes the key trading strategies used by hedge funds and demystifies the secret world of active investing. Leading financial economist Lasse Heje Pedersen combines the latest research with real-world examples and interviews with top hedge fund managers to show how certain trading strategies make money-and why they sometimes don't. Pedersen views markets as neither perfectly efficient nor completely inefficient. Rather, they are inefficient enough that money managers can be compensated for their costs through the profits of their trading strategies and efficient e
    Type of Medium: Monograph available for loan
    Pages: XIV,348 S. , graph. Darst.
    ISBN: 9780691166193
    Language: English
    Note: Cover; Title; Copyright; Contents; The Main Themes in Three Simple Tables; Preface; Who Should Read the Book?; Acknowledgments; About the Author; Introduction; i. Efficiently Inefficient Markets; ii. Global Trading Strategies: Overview of the Book; iii. Investment Styles and Factor Investing; Part I Active Investment; Chapter 1 Understanding Hedge Funds and Other Smart Money; Chapter 2 Evaluating Trading Strategies: Performance Measures; Chapter 3 Finding and Backtesting Strategies: Profiting in Efficiently Inefficient Markets; Chapter 4 Portfolio Construction and Risk Management. , Chapter 5 Trading and Financing a Strategy: Market andPart II Equity Strategies; Chapter 6 Introduction to Equity Valuation and Investing; Chapter 7 Discretionary Equity Investing; Interview with Lee S. Ainslie III of Maverick Capital; Chapter 8 Dedicated Short Bias; Interview with James Chanos of Kynikos Associates; Chapter 9 Quantitative Equity Investing; Interview with Cliff Asness of AQR Capital Management; Part III Asset Allocation and Macro Strategies; Chapter 10 Introduction to Asset Allocation: The Returns to the Major Asset Classes; Chapter 11 Global Macro Investing. , Interview with George Soros of Soros Fund ManagementChapter 12 Managed Futures: Trend-Following Investing; Interview with David Harding of Winton Capital Management; Part IV Arbitrage Strategies; Chapter 13 Introduction to Arbitrage Pricing and Trading; Chapter 14 Fixed-Income Arbitrage; Interview with Nobel Laureate Myron Scholes; Chapter 15 Convertible Bond Arbitrage; Interview with Ken Griffin of Citadel; Chapter 16 Event-Driven Investments; Interview with John A. Paulson of Paulson & Co.; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 46
    Monograph available for loan
    Monograph available for loan
    Cham [u.a.] : Springer
    Call number: IASS 16.90595
    Description / Table of Contents: In the late 18th century explorers and scientists started venturing into the Arctic in a heroic and sometimes deadly effort to understand and unveil the secrets of the unforgiving and mysterious polar region of the high north. Despite that the Arctic was already populated mattered less for the first wave of polar researchers and explorations who nevertheless, brought back valuable knowledge. Today the focus in Arctic science and discourse has changed to one which includes the peoples and societies, and their interaction with the world beyond. The image of a static Arctic - heralded first by explorers - prevailed for a long time, but today the eyes of the World see the Arctic very differently. Few, if any, other places on Earth are currently experiencing the kind of dramatic change witnessed in the Arctic. According to model forecasts, these changes are likely to have profound implications on biophysical and human systems, and will accelerate in the decades to come.  “The New Arctic” highlights how, and in what parts, the natural and political system is being transformed. We’re talking about a region where demography, culture, and political and economic systems are increasingly diverse, although many common interests and aspects remain; and with the new Arctic now firmly placed in a global context. Settlements range from small, predominantly indigenous communities, to large industrial cities, and all have a link to the surrounding environment, be it glaciers or vegetation or the ocean itself. “The New Arctic” contributes to our further understanding of the changing Arctic. It offers a range of perspectives, which reflect the deep insight of a variety of scientific scholars across many disciplines bringing a wide range of expertise. The book speaks to a broad audience, including policy-makers, students and scientific colleagues
    Type of Medium: Monograph available for loan
    Pages: XXII, 352 Seiten , Illustrationen
    ISBN: 9783319176017 (print) , 9783319176024 (eBook)
    Parallel Title: Print version The New Arctic
    Language: English
    Note: Foreword; Preface; Contents; Authors' Biography; Chapter 1: Paths to the New Arctic; Chapter 2: Indigenous Peoples in the New Arctic; Chapter 3: Pioneering Nation: New Narratives About Greenland and Greenlanders Launched Through Arts and Branding; Chapter 4: Perpetual Adaption? Challanges for the Sami and Reindeer Husbandry in Sweden; Chapter 5: On Past, Present and Future Arctic Expeditions; Chapter 6: Arctopias: The Arctic as No Place and New Place in Fiction; Chapter 7: The Fleeting Glaciers of the Arctic; Chapter 8: Arctic Carbon Cycle: Patterns, Impacts and Possible Changes; Chapter 9: Arctic Vegetation Cover: Patterns, Processes and Expected Change; Chapter 10: Human Development in the New Arctic; Chapter 11: Issues in Arctic Tourism; ...
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 47
    Call number: M 15.89237 ; a.d. M 15.89237
    Description / Table of Contents: Umfassende Informationen, Normenaktualität, leichte Verständlichkeit und schnelle Nutzbarkeit der Auslegungs- oder Berechnungsgleichungen ermöglichen die sofortige Dimensionierung von Bauteilen. Unter www.roloff-matek.de findet man interaktive Excel-Arbeitsblätter zu ausgesuchten Hauptkapiteln des Lehrbuchs. Unter www.mdesign.de/roloff-matek kann die Software MDESIGN kostenlos heruntergeladen werden. In der vorliegenden 22. Auflage wurde die zurückgezogene DS 952 durch die neue Richtlinie DVS 1612 für Schweißverbindungen im Schienenfahrzeugbau ersetzt und hierbei auch die Berechnung der Schweißnahtspannungen überarbeitet. Bei hochfesten Schraubenverbindungen ist die Berechnung jetzt an die aktuelle VDI 2230 (Ausgabe 12/2014) angepasst. Die Punktschweißverbindungen wurden auch auf den europäischen Standard gemäß EC 3 bzw. EC 9 gebracht. Der Inhalt Konstruktionsgrundlagen - Toleranzen und Passungen - Festigkeitsberechnung - Tribologie - Kleb- und Lötverbindungen - Schweiß-, Niet- und Schraubenverbindungen - Bolzen- und Stiftverbindungen - Elastische Federn - Achsen, Wellen, Zapfen - Wellen/Nabenverbindungen - Kupplungen - Bremsen - Wälz- und Gleitlager - Riemen- und Kettengetriebe - Rohrleitungen - Dichtungen - Zahnräder und Zahnradgetriebe - Außenverzahnte Stirnräder, Kegelräder, Schraubrad- und Schneckengetriebe Die Zielgruppen Studierende, Techniker und Ingenieure des Maschinenbaus, die mit der Auslegung und Berechnung sowie ausgeführten Maschinenelementen in der Konstruktion zu tun haben Die Autoren Dipl.-Ing. (FH) Herbert Wittel, OStR a.D., unterrichtete Konstruktionslehre und Maschinenelemente an der Fachschule Technik in Reutlingen. Dipl.-Ing. Dieter Muhs, OStR a.D. unterrichtete diese Fächer an der Fachschule Technik in Braunschweig. Prof. Dr.-Ing. Dieter Jannasch lehrt Konstruktion und Maschinenelemente an der Hochschule Augsburg. Prof. Dr.-Ing. Joachim Voßiek lehrt Maschinenelemente und Technische Mechanik an der Hochschule Augsburg
    Type of Medium: Monograph available for loan
    Pages: Ill., graph. Darst. , Tabellenbuch
    Edition: 22., überarb. und erw. Aufl.
    ISBN: 9783658090821 , 9783658090814
    Parallel Title: Druckausg.: Roloff/Matek Maschinenelemente
    Language: German
    Note: Konstruktionsgrundlagen Toleranzen und Passungen -- Festigkeitsberechnung -- Tribologie -- Kleb- und Lötverbindungen -- Schweiß-, Niet- u. Schraubverbindungen -- Bolzen- und Stiftverbindungen -- Elastische Federn -- Achsen, Wellen, Zapfen -- Wellen/Nabenverbindungen -- Kupplungen -- Bremsen -- Wälz- und Gleitlager -- Riemen- und Kettengetriebe -- Rohrleitungen -- Dichtungen -- Zahnräder und Zahnradgetriebe -- Außenverzahnte Stirnräder, Kegelräder, Schraubrad- und Schneckengetriebe..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    Call number: PIK N 076-16-90270/2 ; M 17.90270
    Description / Table of Contents: Teil 1: Globale Klimaprojektionen und regionale Projektionen für Deutschland und Europa -- Teil 2: Klimawandel in Deutschland: Regionale Besonderheiten und Extreme -- Teil 3: Auswirkungen des Klimawandels in Deutschland -- Teil 4: Übergreifende Risiken und Unsicherheiten -- Teil 5: Integrierte Strategien zur Anpassung an den Klimawandel
    Description / Table of Contents: Erstmals trägt dieses nationale Assessment den Forschungsstand zum Klimawandel umfassend für alle Themenbereiche und gesellschaftlichen Sektoren zusammen. Womit müssen wir in Deutschland rechnen, welche Auswirkungen werden die Klimaveränderungen auf Wirtschaft und Gesellschaft haben, und wie können wir uns wappnen? 126 Autoren aus ganz Deutschland äußern sich zu Themen wie bereits beobachtete und zukünftige Veränderungen, Wetterkatastrophen und deren Folgen, den Projektionen für die Zukunft, den Risiken sowie möglichen Anpassungsstrategien. Die Autoren stellen in verständlicher Sprache den aktuellen Forschungsstand dar und veranschaulichen die wichtigsten Gedanken in Grafiken und Tabellen. Alle Texte wurden mehrfach wissenschaftlich begutachtet. Klimawandel in Deutschland ist die erste Gesamtschau zu dem Themenkomplex, benennt offene Fragestellungen und liefert eine Grundlage für Entscheidungen im Zusammenhang mit dem Klimawandel. Deutschland reiht sich damit ein in die Liste von Ländern wie die Vereinigten Staaten, Österreich und Großbritannien, in denen derartige Berichte bereits vorliegen. Die Herausgeber: Prof. Dr. Guy Brasseur und Prof. Dr. Daniela Jacob, ehemaliger Direktor und gegenwärtige Direktorin des Climate Center Germany/Helmholtz-Zentrum Geesthacht, und Susanne Schuck-Zöller, die auch die Projektleitung übernommen hat, werden bei diesem Buch unterstützt von einem Editorial Board, dem elf herausragende Wissenschaftler aus den wichtigsten Klimaforschungseinrichtungen in Deutschland angehören
    Type of Medium: Monograph available for loan
    Pages: XX, 348 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9783662503966 (print)
    Classification:
    Meteorology and Climatology
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    Monograph available for loan
    Monograph available for loan
    Berkeley : University of California Press
    Call number: IASS 16.89932
    Description / Table of Contents: Charles C. Ragin's "The Comparative Method" proposes a synthetic strategy, based on an application of Boolean algebra, that combines the strengths of both qualitative and quantitative sociology. Elegantly accessible and germane to the work of all the social sciences, and now updated with a new introduction, this book will continue to garner interest, debate, and praise
    Type of Medium: Monograph available for loan
    Pages: xxx, 185 S.
    ISBN: 9780520280038
    Language: English
    Note: Cover; Contents; Preface and Overview; Acknowledgments; Introduction to the 2014 Edition; 1. The Distinctiveness of Comparative Social Science; 2. Heterogeneity and Causal Complexity; 3. Case-Oriented Comparative Methods; 4. The Variable-Oriented Approach; 5. Combined Versus Synthetic Comparative Strategies; 6. A Boolean Approach to Qualitative Comparison: Basic Concepts; 7. Extensions of Boolean Methods of Qualitative Comparison; 8. Applications of Boolean Methods of Qualitative Comparison; 9. The Dialogue of Ideas and Evidence in Social Research; Bibliography; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    Monograph available for loan
    Monograph available for loan
    New York : Routledge
    Call number: IASS 16.89933
    Description / Table of Contents: Bringing together papers written by Norman Fairclough over a 25 year period, Critical Discourse Analysis represents a comprehensive and important contribution to the development of this popular field.  The book is divided into seven sections covering the following themes:  language in relation to ideology and powerdiscourse in processes of social and cultural change dialectics of discourse, dialectical relations between discourse and other moments of social lifemethodology of critical discourse analysis research analysis of political discourse discourse in globalisation and ?transition' critic
    Type of Medium: Monograph available for loan
    Pages: xi, 591 S.
    Edition: Second edition
    Edition: Online-Ausg.
    ISBN: 9781405858229 (pbk.)
    Language: English
    Note: section A. Language, ideology and powersection B. Discourse and sociocultural change -- section C. Dialectics of discourse: theoretical developments -- section D. Methodology in CDA research -- section E. Political discourse -- F. Globalisation and 'transition' -- section G. Language and education..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
    Call number: 5/M 17.90712
    Description / Table of Contents: 1. Introduction -- 2. Applications of Seismic Monitoring in Combating Rock Burst Hazard -- 3. Seismic Parameters and their Physical Meaning -- 4. Ranges of Parameters -- 5. Interpretation Methods of Mine Induced Seismicity -- 6. Palabora Seismic History -- 7. Palabora Caving Process as Evidenced by Induced Seismicity -- 8. Caving Process and Seismic Hazard -- 9. Problems Related to Software Versions -- 10. Seismic Preconditioning below Lift 1 Mine and its Influence on the Cavability of Lift 2 Cave -- 11. Palabora Lift 2 Mine Seismic System -- 12. Seismic Hazard Monitoring for Lift 2 -- Appendices -- Index
    Description / Table of Contents: This book offers an in-depth analysis and interpretation methods applicable to mine-induced seismicity. It is based on over 40 years of experience in mine and exploration geophysics. Another unique feature of this book is the complete history of the caving process as evidenced by the recorded seismicity at the South African copper mine Palabora Lift 1. Until now, the literature has only presented theory and case studies discussing the interpretation of results, and there has been no discussion of the input-data quality or why a certain interpretation technique was applied. This book fills that gap. This book is a fascinating read, written by one of the world’s leading mine seismologists. It summarises the history and progression of mine seismology. It outlines the practical use of back analysis of data and how it can be used on a daily basis. The book explains how mine seismology can be used as an effective monitoring tool for key events as the mine progresses as well as for future caving operations. Anthony Allman MAusIMM, CP(Min), RPEQ Antcia Consulting Pty Ltd, Director, Mining Engineer The content of the book is really solid and robust and I have no doubt it is going to be considered a great contribution for the mining community. Raul Fuentes, Former Director of Master Program in Geomechanics Applied to Mining, Universidad de los Andes, Santiago, Chile This book is long overdue and helps to present some difficult concepts in a way that they can be clearly understood by non-experts in this area. Stefan has personally managed to take mine seismology from being a black-art into a useful tool to help make mines a safer and more controlled environment. Neil Hepworth C. Eng, MIMMM, Geomin Consultorio - Brazil, Consultant Mining and Geotechnics Seismic monitoring is an important tool in cave management. The information from monitoring allows a number of key production factors to be determined including cave advance rates, the approximate location of the cave back, insight into the size of the air gap and allows the tracking of broad changes in stress. These all assist in the day to day management of a safe and successful cave. Dr. Glazer’s book provides guidance on the application of microseismicity to cave management through a review of appropriate theory and more importantly illustrates its use through case histories, particularly from the Palabora block cave. The text will be a good addition for all practitioners in cave engineering and operations. All ...
    Type of Medium: Monograph available for loan
    Pages: XV, 414 S.
    Edition: Online edition Springer eBook Collection. Earth and Environmental Science
    ISBN: 9783319326115
    Classification:
    Seismology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 52
    facet.materialart.12
    Berlin; Heidelberg : Springer
    Call number: doi:10.1007/BFb0048731
    Description / Table of Contents: This book focuses on the experimental determination of the physical properties of silicate melts and magmas close to glass transition. Abundant new data are presented. The same type of measurement is performed on a range of melts to test the effect of composition on physical properties; and a range of different techniques are used to determine the same physical properties to illustrate the relationships between the relaxation of the melt structure and the relaxation of its physical properties. This book is of interest to experimental researchers in the discussion of data obtained from both a materials science and a geoscientific point of view.
    Type of Medium: 12
    Pages: VIII, 74 Seiten , Diagramme
    ISBN: 3540631291 , 978-3-540-63129-3 , 978-3-540-69152-5
    Series Statement: Lecture notes in earth sciences 67
    Language: English
    Note: Introduction, Pages 1-2 --- Relaxation, Pages 3-16 --- Shear Relaxation, Pages 17-32 --- Volume Relaxation, Pages 33-43 --- Enthalpy Relaxation, Pages 45-62 --- Summary, Pages 63-72
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 53
    facet.materialart.12
    Berlin; Heidelberg : Springer
    Call number: doi:10.1007/BFb0028315
    Description / Table of Contents: This book deals with the application of fractal and nonlinear time-series analysis to seismicity and earthquakes within the framework of earthquake prediction research. Emphasis is on theoretical foundations as well as practical implementation and pitfalls to enable readers to conduct their own analyses. The theoretical parts include introductions to fractals and multifractals, the relation between fractal dimension and entropy, the Hurst phenomenon, basic ideas of low-dimensional chaotic dynamics and a roadmap of nonlinear time-series analysis. Practical implementation is discussed in each case and synthetic data sets are analyzed. Fractal methods are applied to landslide and seismicity patterns in space and time, nonlinear analysis is carried out for radon and strain data as well as earthquake intervals. Due to the comprehensive coverage of theoretical background and step-by-step applications, readers of all levels will benefit from this book.
    Type of Medium: 12
    Pages: XI, 178 Seiten , Diagramme
    ISBN: 3540648933 , 978-3-540-64893-2 , 978-3-540-68459-6
    Series Statement: Lecture notes in earth sciences 77
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
    Monograph available for loan
    Monograph available for loan
    Cham : Springer International Publishing
    Call number: 11/M 16.89937
    Description / Table of Contents: Constitutive Equation -- Micromechanics -- Variational Energy Formulation -- Anisotropy -- Governing Equation -- Analytical Solution -- Fundamental Solution and Integral Equation -- Poroelastodynamics -- Poroviscoelasticity -- Porothermoelasticity -- Porochemoelasticity -- Appendices -- Index
    Description / Table of Contents: This book treats the mechanics of porous materials infiltrated with a fluid (poromechanics), focussing on its linear theory (poroelasticity). Porous materials from inanimate bodies such as sand, soil and rock, living bodies such as plant tissue, animal flesh, or man-made materials can look very different due to their different origins, but as readers will see, the underlying physical principles governing their mechanical behaviors can be the same, making this work relevant not only to engineers but also to scientists across other scientific disciplines. Readers will find discussions of physical phenomena including soil consolidation, land subsidence, slope stability, borehole failure, hydraulic fracturing, water wave and seabed interaction, earthquake aftershock, fluid injection induced seismicity and heat induced pore pressure spalling as well as discussions of seismoelectric and seismoelectromagnetic effects. The work also explores the biomechanics of cartilage, bone and blood vessels. Chapters present theory using an intuitive, phenomenological approach at the bulk continuum level, and a thermodynamics-based variational energy approach at the micromechanical level. The physical mechanisms covered extend from the quasi-static theory of poroelasticity to poroelastodynamics, poroviscoelasticity, porothermoelasticity, and porochemoelasticity. Closed form analytical solutions are derived in details. This book provides an excellent introduction to linear poroelasticity and is especially relevant to those involved in civil engineering, petroleum and reservoir engineering, rock mechanics, hydrology, geophysics, and biomechanics
    Type of Medium: Monograph available for loan
    Pages: XXVI, 877 p. 171 illus., 62 illus. in color
    ISBN: 9783319252025 , 9783319252001
    Series Statement: Theory and Applications of Transport in Porous Media 27
    Parallel Title: Print version Poroelasticity
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 55
    Monograph available for loan
    Monograph available for loan
    Berlin : Springer Spektrum
    Call number: M 16.90000
    Description / Table of Contents: Was ist Wissenschaftskommunikation? Dieses Buch bietet Einblicke in die Theorie und Praxis der Wissenschafts- und Technikkommunikation. Es macht ihre Herausforderungen und Möglichkeiten in verständlicher Weise und mit zahlreichen Praxisbeispielen deutlich. Ob Zeitung oder Internet, Museum oder Science Café: Es gibt zahlreiche Möglichkeiten, wie Wissenschaft und Öffentlichkeit zusammenkommen. Wie aber werden komplexe Sachverhalte aus Forschung und Technik interessant und verständlich aufbereitet? Wie wird die gesellschaftliche Relevanz von Forschungsergebnissen dargestellt? Worin liegen die Probleme eines „Public Understanding of Science“, welche Chancen eröffnen sich durch „Dialog“ und „Bürgerwissenschaft“? Marc-Denis Weitze und Wolfgang M. Heckl begeben sich mit den Lesern auf Expeditionen in das Spannungsfeld zwischen Marketing und Partizipation. Zielgruppen sind alle, die Wissenschaftskommunikation betreiben, sich für die Hintergründe interessieren und an ihrer Weiterentwicklung mitwirken. Die Autoren halten ein Plädoyer für eine sehr breite Sichtweise auf die Thematik. … Sowohl Einsteiger als auch erfahrene Kommunikatoren können hier wie aus einer Wundertüte viele Anregungen zum Selbermachen und zum Weiterdenken erhalten. Metin Tolan, TU Dortmund Eine allgemein verständliche Übersicht über ein so breites Feld im Taschenbuchformat könnte manals Wagnis und als Anmaßung verstehen. … Hier ist es gelungen, wesentliche Perspektiven aus Theorie und Praxis zusammen zu tragen - das Buch wird dadurch die weitere Diskussion und Entwicklung anregen. Peter Weingart, Universität Bielefeld und University of Stellenbosch Die Autoren Marc-Denis Weitze ist Leiter des Themenschwerpunkts Technikkommunikation in der Geschäftsstelle der Deutschen Akademie der Technikwissenschaften (acatech) in München. Wolfgang M. Heckl ist Generaldirektor des Deutschen Museums in München, Inhaber des Oskar-von-Miller-Lehrstuhls für Wissenschaftskommunikation und Professor für Experimentalphysik an der TU München
    Type of Medium: Monograph available for loan
    Pages: IX, 303 Seiten , 12 Illustrationen
    Edition: 1. Aufl. 2016
    ISBN: 9783662478431 , 9783662478424 (print)
    Language: German
    Note: 1. Eine kurze Geschichte der Wissenschaftskommunikation 3 Schlüsselideen -- 2. Wissenschaft und Gesellschaft: Vom Elfenbeinturm auf den Marktplatz -- 3. Technik und Gesellschaft -- 4. Öffentlichkeit: Wen erreicht Wissenschaftskommunikation? -- 5. Dimensionen der Verständlichkeit -- 6. Erklärungen: Gute Bekannte oder falsche Freunde? -- 7. Bildung: Wer sollte was über Wissenschaft wissen? -- 8. Kontroversen: Ein Schlüssel zur Wissenschaftskommunikation -- 9. isiko: Zwischen Wahrnehmung und Konstrukt -- 10. Vertrauen: Eine Art der Komplexitätsreduktion -- 11 Einstellungen und Rezeption -- 12. Akzeptanz: Ziel oder Unwort? -- Akteure und Ansätze -- 13. Wissenschaftler als Kommunikatoren -- 14. Schule und andere Lernorte -- 15. Experimente: Jeder ist ein Forscher -- 16. Gläserne Wissenschaft -- 17. Journalisten und Medien -- 18. Wissenschaftskommunikation in sozialen Netzwerken -- 19. Wissenschaftskommunikation als Marketing -- 20. Wissenschaft berät Politik und Gesellschaft -- 21. Dialog: Austausch auf Augenhöhe und in beide Richtungen -- Fallbeispiele -- 22. Evolutionstheorie: Wissen, Glauben, Kontroverse -- 23. Chemie: Vom Umweltproblem zum Problemlöser? -- 24. Nanotechnologie: Visionen, Definitionen, Kontroversen -- 25. Kernenergie: Von der Hochglanzbroschüre zum Vertrauensverlust -- 26. Gentechnik: Verhärtete Fronten oder kommunikativer Neubeginn?- Epilog -- 27. Aktuelle Herausforderungen und Ziele..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 56
    Monograph available for loan
    Monograph available for loan
    Cambridge, Mass : MIT Press
    Call number: IASS 16.90011
    Type of Medium: Monograph available for loan
    Edition: Online-Ausg.
    ISBN: 0585374848 (electronic bk.) , 9780585374840 (electronic bk.) , 0262530457 (print)
    Parallel Title: Print version Macroeconomics after Keynes
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
    Monograph available for loan
    Monograph available for loan
    Cheltenham, UK : Edward Elgar Publishing
    Call number: IASS 16.90012
    Type of Medium: Monograph available for loan
    Pages: ix, 512 Seiten
    Edition: Online-Ausg.
    ISBN: 97817847166777 , 9781784716660 (print) , 9781784716653 (print)
    Language: English
    Note: ""Cover""; ""Copyright""; ""Contents""; ""Preface""; ""Conventions""; ""Abbreviations""; ""1. Introduction""; ""PART I The Early Years""; ""2. Early attempts at monetary union and the Hague Summit""; ""3. The Werner Report and the collapse of Bretton Woods""; ""4. The 'snake in the tunnel' reappears""; ""5. Monetarism arrives amidst currency turmoil""; ""6. The Delors Report""; ""7. Onward to Maastricht""; ""8. The Maastricht Treaty""; ""9. Converging to crisis and austerity""; ""10. The ideological straitjacket""; ""11. The Stability and Growth Pact (SGP)"". , ""12. The convergence farce: smokescreens and denial""""PART II The Path to Crisis""; ""13. The first few years: smug self-congratulation and mass delusion""; ""14. The 2003 fiscal crisis""; ""15. The German 'jobwunder'""; ""16. European Groupthink: denial on a grand scale""; ""PART III The Options for Europe""; ""17. A monetary framework for fiscal policy activism""; ""18. Framing the debate: two alternative visions of the economy""; ""19. The basic principles of functional finance""; ""20. The federal solution""; ""21. Overt Monetary Financing""; ""22. Abandoning the euro"". , ""23. Employment guarantees""""References""; ""Index"".
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 58
    Call number: IASS 16.90013
    Description / Table of Contents: The 2008-10 financial crisis and the global recession it created is a complex phenomenon that warrants detailed examination. The various essays in this book utilise several alternative paradigms to provide a plausible explanation and a credible cure. Great detail is given to this important analysis from different theoretical perspectives, presenting a clearer understanding of what went wrong and expounding misinterpretations of current theories and practices. Fourteen insightful chapters by eminent scholars investigate the background of the crisis and draw lessons for economic theory and polic
    Type of Medium: Monograph available for loan
    Pages: ix, 260 Seiten
    ISBN: 9781849807456 , 1283072130 (ebk) , 9781283072137 (MyiLibrary) , 9781849807463 (electronic) , 1855754827 (print)
    Language: English
    Note: CONTENTS; List of Figures; List of Tables; List of Contributors; Introduction; PART I: ECONOMISTS ON TRIAL; 1. Who predicted the crisis and what can we learn from them? ; 2 A brief note on economic recessions, banking reform and the future of capitalism; 3 Understanding crisis: on the meaning of uncertainty and probability; 4 Financial crisis and risk measurement: the historical perspective and a new methodology; 5 Did economic analysis fail in the current financial crisis?; PART II: WHAT DOES HISTORY TELL US? ; 6 Does the current global crisis remind us of the Great Depression?. , 7 Innovation, growth, cycles and finance: three (or four or more) stories from the 1930s and their lessons8 Epic Recession and economic theory; 9 Did asset prices cause the current crisis?; 10 The role of the history of economic thought in the development of economic theory and policy; PART III: COUNTRY CASES IN A GLOBAL CRISIS; 11. Testimony to the Financial Crisis Inquiry Commission by Alan Greenspan; 12 Long-term depression and new markets: economists and the 2008 recession; 13 Manifestations of the global crisis in a small open economy. , 14 The aftermath of a long decade of real nil interest rates (Spain 1996-2008)Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 59
    Monograph available for loan
    Monograph available for loan
    Washington : American Geophysical Union
    Call number: IASS 16.90053
    Type of Medium: Monograph available for loan
    Pages: v, 261 Seiten , Illustrationen
    Uniform Title: Izmenenii︠a︡ klimata. 〈engl.〉
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
    Monograph available for loan
    Monograph available for loan
    Redlands, California : Esri Press
    Call number: IASS 16.90055
    Type of Medium: Monograph available for loan
    Pages: 507 Seiten , Illustraionen
    Edition: Second edition
    ISBN: 9781589484603
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 61
    Call number: M 16.90059
    Description / Table of Contents: This handbook brings together a great deal of new data on the static and dynamic elastic properties of granular and other composite material. The authors are at the very center of today's research and present new and imported theoretical tools that have enabled our current understanding of the complex behavior of rocks.There are three central themes running throughout the presentation: ? Rocks as the prototypical material for defining a class of materials? The PM space model as a useful theoretical construct for developing a phenomenology? A sequence of refined analysis methods. This suite of
    Type of Medium: Monograph available for loan
    Pages: XIII, 395 S. , ill., maps
    ISBN: 9783527407033
    Classification:
    Planetary Interiors
    Language: English
    Note: Nonlinear Mesoscopic Elasticity; Contents; Preface; Acknowledgements; 1 Introduction; 1.1 Systems; 1.2 Examples of Phenomena; 1.3 The Domain of Exploration; 1.4 Outline; References; 2 Microscopic/Macroscopic Formulation of the Traditional Theory of Linear and Nonlinear Elasticity; 2.1 Prefatory Remarks; 2.2 From Microscopic to Continuum; 2.2.1 A Microscopic Description; 2.2.2 Microscopic Description and Thermodynamics; 2.2.3 From Microscopic Model to Continuum Elasticity; 2.3 Continuum Elasticity and Macroscopic Phenomenology; 2.3.1 Displacement, Strain, and Stress. , 2.3.2 Dynamics of the Displacement Field2.3.3 Coupling Continuum Elasticity to Auxiliary Fields; 2.3.4 Inhomogeneous Elastic Systems; 2.4 Thermodynamics; 2.4.1 Thermodynamic Derivatives; 2.4.2 Series Expansion for ES; 2.4.3 Series Expansion for EZ; 2.4.4 Series Expansion for FT; 2.4.5 Assemble the Pieces; 2.5 Energy Scales; References; 3 Traditional Theory of Nonlinear Elasticity, Results; 3.1 Quasistatic Response; Linear and Nonlinear; 3.1.1 Quasistatic Response; Linear; 3.1.2 Quasistatic Response; Nonlinear; 3.2 Dynamic Response; Linear; 3.3 Quasistatic/Dynamic Response; Nonlinear. , 3.4 Dynamic Response Nonlinear; 3.4.1 Basic Equations; 3.4.2 Wave Propagation; 3.4.3 Resonant Bar; 3.5 Exotic Response; Nonlinear; 3.6 Green Functions; 3.6.1 Green Function, Free Space; 3.6.2 Green Function, Resonant Bar; References; 4 Mesoscopic Elastic Elements and Macroscopic Equations of State; 4.1 Background; 4.2 Elastic Elements; 4.2.1 Hertz-Mindlin Contacts; 4.2.2 Hysteretic Hertzian Contacts; 4.2.3 Hertzian Asperities; 4.2.4 Van der Waals Surfaces; 4.2.5 Other; 4.3 Effective Medium Theory; 4.4 Equations of State; Examples; 4.4.1 Hertzian Contacts; 4.4.2 Van der Waals Surfaces. , 4.4.3 Generalization and CaveatsReferences; 5 Auxiliary Fields; 5.1 Temperature; 5.2 Saturation; 5.2.1 Saturation/Strain Coupling; 5.2.2 Saturation/Strain Response; 5.3 The Conditioning Field, X; References; 6 Hysteretic Elastic Elements; 6.1 Finite Displacement Elastic Elements; Quasistatic Response; 6.1.1 Finite Displacement Elastic Elements: The Model; 6.1.2 Finite Displacement Elastic Element: Implementing the Model; 6.2 Finite Displacement Elastic Elements: Inversion; 6.3 Finite Displacement Elastic Elements: Dynamic Response; 6.3.1 Finite Displacement Elastic Element: Resonant Bar. , 6.3.2 Finite Displacement Elastic Element: Wave Mixing6.4 Models with Hysteresis; 6.5 Summary; 6.6 Models with Hysteresis, Detail; 6.6.1 Hertzian Contacts; 6.6.2 The Masing Rules; 6.6.3 The Endochronic Formalism; References; 7 The Dynamics of Elastic Systems; Fast and Slow; 7.1 Fast/Slow Linear Dynamics; 7.1.1 Quasistatic Response; 7.1.2 AC Response; 7.2 Fast Nonlinear Dynamics; 7.3 Auxiliary Fields and Slow Dynamics; 7.3.1 X = The Conditioning Field; 7.3.2 X = Temperature; 7.4 Summary; References; 8 Q and Issues of Data Modeling/Analysis; 8.1 Attenuation in Linear Elastic Systems. , 8.1.1 Wave Vector Dispersion.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 62
    Monograph available for loan
    Monograph available for loan
    Leiden : Brill
    Call number: IASS 16.90084
    Description / Table of Contents: In a social world whose pace continues to accelerate the future becomes an increasingly difficult terrain. While the focus of social life is narrowing down to the present, the futures we create on a daily basis cast ever longer shadows. This book addresses this paradox and its deep ethical implications
    Type of Medium: Monograph available for loan
    Pages: xvii, 218 Seiten , Illustrationen , 25 cm
    ISBN: 9004161775 , 9789004161771
    Series Statement: Supplements to The study of time v. 3
    Language: English
    Note: List of Figures; Acknowledgements; Prologue; Chapter One Introduction; Chapter Two The Future Told; Chapter Three The Future Tamed; Chapter Four Futures Traded; Chapter Five Futures Transformed; Chapter Six Futures Traversed; Chapter Seven Futures Thought; Chapter Eight Futures Tended; Chapter Nine Futures Transcended; Epilogue; Glossary of Key Terms; Bibliography; Name Index; Subject Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Call number: 6/M 16.90069 ; 6/M 16.90069/ 2. Ex. ; 6/M 16.90069/ 3. Ex.
    In: International Association of Geodesy Symposia, 143
    Description / Table of Contents: This proceedings contains a selection of peer-reviewed papers presented at the IAG Scientific Assembly, Postdam, Germany, 1-6 September, 2013. The scientific sessions were focussed on the definition, implementation and scientific applications of reference frames; gravity field determination and applications; the observation and assessment of earth hazards. It presents a collection of the contributions on the applications of earth rotations dynamics, on observation systems and services as well as on imaging and positioning techniques and its applications.
    Type of Medium: Monograph available for loan
    Pages: xiv, 798 S.
    ISBN: 9783319246031
    Series Statement: International Association of Geodesy Symposia 143
    Classification:
    Geodesy
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
    Monograph available for loan
    Monograph available for loan
    Bremen : MARUM - Zentrum für Marine Umweltwissenschaften, Fachbereich Geowissenschaften, Universität Bremen
    Associated volumes
    Call number: ZSP-166(314)
    In: Berichte aus dem MARUM und dem Fachbereich Geowissenschaften der Universität Bremen
    Type of Medium: Monograph available for loan
    Pages: 204 Seiten : Illustrationen, Diagramme, Karten
    Series Statement: Berichte aus dem MARUM und dem Fachbereich Geowissenschaften der Universität Bremen No. 314
    Parallel Title: Erscheint auch als R/V MARIA S. MERIAN cruise report MSM57
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 65
    Monograph available for loan
    Monograph available for loan
    Bremen : MARUM - Zentrum für Marine Umweltwissenschaften der Universität Bremen
    Associated volumes
    Call number: ZSP-166(315)
    In: Berichte aus dem MARUM und dem Fachbereich Geowissenschaften der Universität Bremen
    Type of Medium: Monograph available for loan
    Series Statement: Berichte, MARUM – Zentrum für Marine Umweltwissenschaften, Fachbereich Geowissenschaften, Universität Bremen 315
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Monograph available for loan
    Monograph available for loan
    Cheltenham, UK : Edward Elgar Publishing
    Call number: PIK O 040-16-90328
    Description / Table of Contents: This lucid and comprehensive book explores the ways in which the State, the market and the citizen can collaborate to satisfy people's health care needs. It argues that health care is not a commodity like any other. It asks if its unique properties mean that there is a role for social regulation and political management. Apples and oranges can be left to the buyers and the sellers. Health care may require an input from the consensus, the experts, the insurers, the politicians and the bureaucrats as well. David Reisman makes a fresh contribution to the debate. He argues that the three policy is
    Type of Medium: Monograph available for loan
    Pages: viii, 371 Seiten
    ISBN: 9781785365201 (print) , 1785365215 (print) , 9781785365218 (print)
    Language: English
    Note: Contents: Front Matter -- Copyright -- Contents -- Acknowledgements -- 1. Introduction -- 2. Good health -- 3. The invisible mind -- 4. Inputs and outcomes -- 5. The individual -- 6. The practitioner -- 7. The public -- 8. The logic of insurance -- 9. Insurance: private and public -- 10. Equity and equality -- 11. The right to health -- 12. Inequality and health -- 13. Narrowing the gap -- 14. Equalising medical care -- 15. The cost of care -- 16. Cost containment -- 17. State, market and cost -- 18. Conclusion -- References -- Index
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    Monograph available for loan
    Monograph available for loan
    Beijing :O'Reilly,
    Call number: 18/M 17.90449
    Type of Medium: Monograph available for loan
    Pages: xxxiii, 553 Seiten , Illustrationen, Karten
    Edition: First Edition.
    ISBN: 9781491920510
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Call number: M 18.91817
    Description / Table of Contents: This book is focused on the basics of applying thermochronology to geological and tectonic problems, with the emphasis on fission-track thermochronology. It is conceived for relatively new practitioners to thermochronology, as well as scientists experienced in the various methods. The book is structured in two parts. Part I is devoted to the fundamentals of the fission-track method, to its integration with other geochronologic methods, and to the basic principles of statistics for fission-track dating and sedimentology applied to detrital thermochronology. Part I also includes the historical development of the technique and thoughts on future directions. Part II is devoted to the geological interpretation of the thermochronologic record. The thermal frame of reference and the different approaches for the interpretation of fission-track data within a geological framework of both basement and detrital studies are discussed in detail. Separate chapters demonstrate the application of fission-track thermochronology from various perspectives (e.g., tectonics, petrology, stratigraphy, hydrocarbon exploration, geomorphology), with other chapters on the application to basement rocks in orogens, passive continental margins and cratonic interiors, as well as various applications of detrital thermochronology.
    Type of Medium: Monograph available for loan
    Pages: XV, 393 Seiten , Illustrationen
    ISBN: 9783319894195
    Series Statement: Springer Textbooks in Earth Sciences, Geography and Environment
    Classification:
    Applied Geology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    facet.materialart.12
    Berlin : De Gruyter Saur
    Call number: 9783110278736 (e-book)
    Description / Table of Contents: Das Buch ist sowohl eine Einführung in die Themen Linked Data, Open Data und Open Linked Data als es auch den konkreten Bezug auf Bibliotheken behandelt. Hierzu werden konkrete Anwendungsprojekte beschrieben. Der Band wendet sich dabei sowohl an Personen aus der Bibliothekspraxis als auch an Personen aus dem Bibliotheksmanagement, die noch nicht mit dem Thema vertraut sind. Das Buch ist eine Einführung in die Themen Data. | This book is an introduction to the subjects of linked data, open data and open linked data, and to their specific relevance for libraries. It illustrates these concepts through detailed descriptions of actual data projects. The volume will be useful to individuals involved in library practice and those in library management who have not yet become familiarized with these important contemporary fields.
    Type of Medium: 12
    Pages: 1 Online-Ressource (1 electronic resource (vi, 244 p.))
    Edition: Online-Ausg.
    ISBN: 9783110278736 , 9783110276343
    Series Statement: Bibliotheks- und Informationspraxis 50
    Language: Undetermined
    Note: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Call number: M 18.91931
    Type of Medium: Monograph available for loan
    Pages: 272 Seiten
    ISBN: 9783503170074
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Monograph available for loan
    Monograph available for loan
    [Melville, New York] : ASA Press | Cham : Springer Nature Zwitzerland AG
    Call number: 16/M 18.91954
    Description / Table of Contents: List of Contributors -- 1 Fundamentals of Nonlinear Acoustical Techniques and Sideband Peak Count -- 2 Nonlinear Resonant Ultrasound Spectroscopy: Assessing Global Damage -- 3 Modelling and Numerical Simulations in Nonlinear Acoustics Used for Damage Detection -- 4 Structural Damage Detection Based on Nonlinear Acoustics - Application Examples -- 5 Nonlinear and Hysteretic Constitutive Models for Wave Propagation in Solid Media With Cracks and Contacts -- 6 Nonlinear Ultrasonic Techniques for Material Characterization -- 7 Nonlinear Ultrasonic Responses of Contacting Interfaces -- 8 Nonlinear Acoustic Response of Damage Applied for Diagnostic Imaging -- 9 Nonlinear Guided Waves and Thermal Stresses -- 10 Subharmonic Phased Array for Crack Evaluation (SPACE) -- 11 A Unified Treatment of Nonlinear Viscoelasticity and Non-Equilibrium Dynamics -- 12 Cement-Based Material Characterization Using Nonlinear Single Impact Resonant Acoustic Spectroscopy -- 13 Dynamic Acousto-Elastic Testing -- 14 Time Reversal Acoustics -- 15 Multiscale Quantification of Damage Precursor in Composites -- 16 Anharmonic Interactions of Probing Ultrasonic Waves with the Applied Loads Including Applications Suitable for Structural Health Monitoring -- 17 Noncontact Nonlinear Ultrasonic Wave Modulation for Fatigue Crack and Delamination Detection -- 18 Characterizing Fatigue Cracks Using Active Sensor Networks -- Index
    Description / Table of Contents: This multi-contributed volume provides a practical, applications-focused introduction to nonlinear acoustical techniques for nondestructive evaluation. Compared to linear techniques, nonlinear acoustical/ultrasonic techniques are much more sensitive to micro-cracks and other types of small distributed damages. Most materials and structures exhibit nonlinear behavior due to the formation of dislocation and micro-cracks from fatigue or other types of repetitive loadings well before detectable macro-cracks are formed. Nondestructive evaluation (NDE) tools that have been developed based on nonlinear acoustical techniques are capable of providing early warnings about the possibility of structural failure before detectable macro-cracks are formed. This book presents the full range of nonlinear acoustical techniques used today for NDE. The expert chapters cover both theoretical and experimental aspects, but always with an eye towards applications. Unlike other titles currently available, which treat nonlinearity as a physics problem and focus on different analytical derivations, the present volume emphasizes NDE applications over detailed analytical derivations. The introductory chapter presents the fundamentals in a manner accessible to anyone with an undergraduate degree in Engineering or Physics and equips the reader with all of the necessary background to understand the remaining chapters. This self-contained volume will be a valuable reference to graduate students through practising researchers in Engineering, Materials Science, and Physics. Represents the first book on nonlinear acoustical techniques for NDE applications Emphasizes applications of nonlinear acoustical techniques Presents the fundamental physics and mathematics behind nonlinear acoustical phenomenon in a simple, easily understood manner Covers a variety of popular NDE techniques based on nonlinear acoustics in a single volume
    Type of Medium: Monograph available for loan
    Pages: XIV, 759 Seiten , Illustrationen
    Edition: Online edition Springer eBook Collection. Engineering
    ISBN: 9783319944746 (print)
    Classification:
    Physics
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    In: Marine Chemistry, 3664
    Description / Table of Contents: Profiles of particulate and dissolved 234Th (t1/2=24.1 days) in seawater and particulate 234Th collected in drifting traps were analyzed in the Barents Sea at five stations during the ALV3 cruise (from June 28 to July 12, 1999) along a transect from 78°15′N–34°09′E to 73°49′N–31°43′E. 234Th/238U disequilibrium was observed at all locations. 234Th data measured in suspended and trapped particles were used to calibrate the catchment efficiency of the sediment traps. Model-derived 234Th fluxes were similar to 234Th fluxes measured in sediment traps based on a steady-state 234Th model. This suggests that the sediment traps were not subject to large trapping efficiency problems (collection efficiency ranges from 70% to 100% for four traps). The export flux of particulate organic carbon (POC) can be calculated from the model-derived export flux of 234Th and the POC/234Th ratio. POC/234Th ratios measured in suspended and trapped particles were very different (52.0±9.9 and 5.3±2.2 μmol dpm−1, respectively). The agreement between calculated and measured POC fluxes when the POC/234Th ratio of trapped particles was used confirms that the POC/234Th ratio in trap particles is representative of sinking particles. Large discrepancies were observed between calculated and measured POC fluxes when the POC/234Th ratio of suspended particles was used. In the Barents Sea, vertical POC fluxes are higher than POC fluxes estimated in the central Arctic Ocean and the Beaufort Sea and lower than those calculated in the Northeast Water Polynya and the Chukchi Sea. We suggest that the latter fluxes may have been strongly overestimated, because they were based on high POC/234Th ratios measured on suspended particles. It seems that POC fluxes cannot be reliably derived from thorium budgets without measuring the POC/234Th ratio of sediment trap material or of large filtered particles.
    Type of Medium: 13
    ISSN: 0304-4203 , 1872-7581
    Language: English
    Note: Outline Abstract Keywords 1. Introduction 2. Methods 2.1. Sample collection 2.2. 234Th analyses 2.3. Particulate organic carbon analyses 3. Results 3.1. Hydrography 3.2. Nutrients 3.3. 234Th activities and POC concentrations 3.4. Trapped material 4. Discussion 4.1. Origins of 234Th/238U disequilibrium 4.2. Determining 234Th fluxes 4.3. Calibration of sediment trap with 234Th 4.4. Vertical flux of particulate organic carbon and the POC/234Thp ratio 5. Conclusion Acknowledgements References
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
    Call number: M 20.93497
    Description / Table of Contents: The Himalayas are a region that is most dependent, but also frequently prone to hazards from changing meltwater resources. This mountain belt hosts the highest mountain peaks on earth, has the largest reserve of ice outside the polar regions, and is home to a rapidly growing population in recent decades. One source of hazard has attracted scientific research in particular in the past two decades: glacial lake outburst floods (GLOFs) occurred rarely, but mostly with fatal and catastrophic consequences for downstream communities and infrastructure. Such GLOFs can suddenly release several million cubic meters of water from naturally impounded meltwater lakes. Glacial lakes have grown in number and size by ongoing glacial mass losses in the Himalayas. Theory holds that enhanced meltwater production may increase GLOF frequency, but has never been tested so far. The key challenge to test this notion are the high altitudes of 〉4000 m, at which lakes occur, making field work impractical. Moreover, flood waves can attenuate rapidly in mountain channels downstream, so that many GLOFs have likely gone unnoticed in past decades. Our knowledge on GLOFs is hence likely biased towards larger, destructive cases, which challenges a detailed quantification of their frequency and their response to atmospheric warming. Robustly quantifying the magnitude and frequency of GLOFs is essential for risk assessment and management along mountain rivers, not least to implement their return periods in building design codes. [...]
    Type of Medium: Dissertations
    Pages: 122 Seiten , Illustrationen, Diagramme
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 74
    Non-book medium
    Non-book medium
    Heidelberg : Spektrum der Wissenschaft Verlagsgesellschaft
    Call number: (OCoLC)838497963
    Type of Medium: Non-book medium
    Pages: Online-Ressource (114 Seiten) , Illustrationen
    Series Statement: Sterne und Weltraum 50.2011,5
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Call number: M 20.93499
    Description / Table of Contents: Precipitation as the central meteorological feature for agriculture, water security, and human well-being amongst others, has gained special attention ever since. Lack of precipitation may have devastating effects such as crop failure and water scarcity. Abundance of precipitation, on the other hand, may as well result in hazardous events such as flooding and again crop failure. Thus, great effort has been spent on tracking changes in precipitation and relating them to underlying processes. Particularly in the face of global warming and given the link between temperature and atmospheric water holding capacity, research is needed to understand the effect of climate change on precipitation. The present work aims at understanding past changes in precipitation and other meteorological variables. Trends were detected for various time periods and related to associated changes in large-scale atmospheric circulation. The results derived in this thesis may be used as the foundation for attributing changes in floods to climate change.…
    Type of Medium: Dissertations
    Pages: 112 Seiten , Illustrationen, Diagramme, Karten
    Language: English
    Note: Contents Summary 1. Introduction 1.1 Background 1.1.1 Precipitation changes 1.1.2 Large-scale atmospheric patterns 1.2 Objectives and research questions 1.3 Thesis outline and author contribution High spatial and temporal organization of changes inprecipitation over Germany for 1951–2006 2.1 Introduction 2.2 Data 2.3 Methods 2.3.1 Threshold between wet and dry days 2.3.2 Derivation of time series of precipitation characteristics 2.3.3 Trend analyses under consideration of temporal and spatial correlation 2.3.4 Visualization of results 2.4 Results and discussion 2.4.1 Changes in total precipitation 2.4.2 Changes in mean, variability, and heavy precipitation indicators 2.4.3 Transition probabilities 2.4.4 Seven-day precipitation amount with return period 100 years 2.5 Conclusions Can local climate variability be explained by weatherpatterns? A multi-station evaluation for the Rhine basin 3.1 Introduction 3.2 Data 3.3 Methods 3.3.1 Weather pattern classification 3.3.2 Finding optimal classification parameters 3.3.3 Evaluation of classifications 3.4 Results 3.4.1 Stratification of local climate variables 3.4.2 Performance of GCMs 3.5 Discussion 3.5.1 On the optimal classification 3.5.2 On the skill of GCMs 3.6 Conclusions 3.7 Data availability 3.A Appendix Do changing weather types explain observed climatictrends in the Rhine basin? An analysis of within andbetween-type changes 4.1 Introduction 4.2 Data and weather pattern classification 4.3 Methods 4.3.1 Relationship of WPs and large-scale circulation modes 4.3.2 Trend detection methods 4.3.3 Relative share of between- and within-type changes 4.4 Results 4.4.1 Attribution of WPs to large-scale circulation modes 4.4. 2Between-Type Changes 4.4.3 Within-Type Changes 4.4.4 Relative share of between- and within-type changes 4.5 Discussion and conclusions 4.A Appendix 4.S Supplementary Discussion and conclusions 5.1 Main results 5.2 Discussion and directions for further research 5.2.1 Weather pattern classification for downscaling 5.2.2 Limitations for downscaling 5.3 Concluding remarks Bibliography
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    Call number: M 20.93506
    Description / Table of Contents: In the Highlands of Sri Lanka, erosion and chemical weathering rates are among the lowest for global mountain denudation. In this tropical humid setting, highly weathered deep saprolite profiles have developed from high-grade metamorphic charnockite during spheroidal weathering of the bedrock. The spheroidal weathering produces rounded corestones and spalled rindlets at the rock-saprolite interface. I used detailed textural, mineralogical, chemical, and electron-microscopic (SEM, FIB, TEM) analyses to identify the factors limiting the rate of weathering front advance in the profile, the sequence of weathering reactions, and the underlying mechanisms. The first mineral attacked by weathering was found to be pyroxene initiated by in situ Fe oxidation, followed by in situ biotite oxidation. Bulk dissolution of the primary minerals is best described with a dissolution – re-precipitation process, as no chemical gradients towards the mineral surface and sharp structural boundaries are observed at the nm scale. Only the local oxidation in pyroxene and biotite is better described with an ion by ion process. The first secondary phases are oxides and amorphous precipitates from which secondary minerals (mainly smectite and kaolinite) form. Only for biotite direct solid state transformation to kaolinite is likely. [...]
    Type of Medium: Dissertations
    Pages: ix, 107, XXIV Seiten , Illustrationen, Diagramme
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Call number: IASS 19.93023
    Description / Table of Contents: The two-volume set IFIP AICT 566 and 567 constitutes the refereed proceedings of the International IFIP WG 5.7 Conference on Advances in Production Management Systems, APMS 2019, held in Austin, TX, USA. The 161 revised full papers presented were carefully reviewed and selected from 184 submissions. They discuss globally pressing issues in smart manufacturing, operations management, supply chain management, and Industry 4.0. The papers are organized in the following topical sections: lean production; production management in food supply chains; sustainability and reconfigurability of manufacturing systems; product and asset life cycle management in smart factories of industry 4.0; variety and complexity management in the era of industry 4.0; participatory methods for supporting the career choices in industrial engineering and management education; blockchain in supply chain management; designing and delivering smart services in the digital age; operations management in engineer-to-order manufacturing; the operator 4.0 and the Internet of Things, services and people; intelligent diagnostics and maintenance solutions for smart manufacturing; smart supply networks; production management theory and methodology; data-driven production management; industry 4.0 implementations; smart factory and IIOT; cyber-physical systems; knowledge management in design and manufacturing; collaborative product development; ICT for collaborative manufacturing; collaborative technoloy; applications of machine learning in production management; and collaborative technology
    Type of Medium: Monograph available for loan
    Pages: XXVII, 735 Seiten , graphische Darstellungen
    Edition: 1st ed. 2019
    ISBN: 9783030299996
    Series Statement: IFIP Advances in Information and Communication Technology 566
    URL: Cover
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    facet.materialart.12
    Göttingen : Wallstein Verlag
    Call number: 9783835344945 (e-book)
    Description / Table of Contents: Eine Medien- und Wissensgeschichte von Biologie und Ozeanographie im Kielwasser der Walfänger. Immer wieder entzieht sich der Wal wissenschaftlicher Klassifikation und Darstellbarkeit. Wale sind buchstäblich nicht zu fassen - als sich die neuen biologischen Wissenschaften im 19. Jahrhundert daran machten, »das Leben« zu erklären, blieb das der Wale ein Problem. Doch Walfänger durchkreuzten auf ihren Spuren im 19. Jahrhundert die Meere der Welt. Kartographen erschlossen auf den Spuren dieser Walfänger die Nordwestpassage und den pazifischen Ozean, während Naturhistoriker und Zoologen sie in die Lebensräume der Wale begleiten. Felix Lüttge erzählt die Geschichte der Walfänger, die den Walen, und der Wissenschaftler, die wiederum den Walfängern folgten.Es ist eine Medien- und Wissensgeschichte des Wals wie auch der Meere, die auf seinen Spuren durchfahren und vermessen wurden. Felix Lüttge beschreibt die komplexen Austauschprozesse, mit denen Walfänger und Wissenschaftler ökonomisches, ozeanographisches, zoologisches und geographisches Wissen hervorbrachten.
    Type of Medium: 12
    Pages: 1 Online-Ressource (278 Seiten) , Illustrationen, Karten
    ISBN: 9783835344945
    Language: German
    Note: Dissertation, Humboldt-Universität Berlin, 2018 , Inhalt I. Einleitung 1. Auf den Spuren des Wals 2. Geographien des Lebens 3. Ein neuer Leviathan II. Intelligente Walfänger: Entstehung einer historiographischen Figur 1. An den Rändern des Golfstroms 2. Nachrichten aus dem Pazifik 3. Nomaden des Meeres III. Die Daten der Walfänger: Der Kartograph im Archiv 1. Ozeanographie als Globalwissenschaft 2. Humboldts amerikanische Söhne und die Erforschung der Meere 3. Aufschreibesysteme des Walfangs 4. Datenmeere 5. Kurven im Meer. IV. Der Wal als taxonomische Anomalie: Kleine Klassifikationsgeschichte des Wals V. Jäger und Sammler: Unmögliche Forschung 1. Strandgut, Spektakel 2. Beuteforschung 3. Zerlegen und Zusammensetzen VI. Elementare Obdachlosigkeit: Unmögliches Leben 1. Weißwale am Broadway 2. Zu Gast im Meer VII. Schluss Epilog: Gattungsfragen Quellen Literatur Bildnachweise Dank
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
    Call number: 9781351698757 (e-book)
    Description / Table of Contents: Science during the Cold War has become a matter of lively interest within the historical research community, attracting the attention of scholars concerned with the history of science, the Cold War, and environmental history. The Arctic--recognized as a frontier of confrontation between the superpowers, and consequently central to the Cold War--has also attracted much attention. This edited collection speaks to this dual interest by providing innovative and authoritative analyses of the history of Arctic science during the Cold War.
    Type of Medium: 12
    Pages: 1 Online-Ressource (320 Seiten) , Illustrationen , 24 cm
    ISBN: 9781351698757 (e-book)
    Series Statement: Routledge studies in the history of science, technology and medicine 38
    Language: English
    Note: Table of Contents Introductory perspectives Chapter 1: Introduction: Cold War science in the North American Arctic / by Stephen Bocking, Daniel Heidt Strategic science Chapter 2: Ice and the depths of the ocean: probing Greenland's Melville Bay during the Cold War / by Mark Nuttall Chapter 3: Leadership, cultures, the Cold War and the establishment of Arctic scientific stations: situating the Joint Arctic Weather Stations (JAWS) / by P. Whitney Lackenbauer, Daniel Heidt Chapter 4: Frontier footage: science and colonial attitudes on film in Northern Canada, 1948–1954 / by Matthew S. Wiseman Chapter 5: Portraying America's last frontier: Alaska in the media during the Second World War and the Cold War / by Victoria Herrmann Chapter 6: Making “Man in the Arctic”: academic and military entanglements, 1944–49 / by Matthew Farish Cold War economies Chapter 7: Arctic pipelines and permafrost science: North American rivalries in the shadow of the Cold War, 1968–1982 / by Robert Page Chapter 8: Cold oil: linking strategic and resource science in the Canadian Arctic / by Stephen Bocking Chapter 9: Icebergs in Iowa: Saudi dreams, Antarctic hydrologics and the production of Cold War environmental knowledge / by Rafico Ruiz Chapter 10: Science and Indigenous knowledge in land claims settlements: negotiating the Inuvialuit Final Agreement, 1977–1978 / by Andrew Stuhl Science crossing borders Chapter 11: Knowledge base: polar explorers and the integration of science, security, and US foreign policy in Greenland, from the Great War to the Cold War / by Dawn Alexandrea Berry Chapter 12: Institutions and the changing nature of Arctic research during the early Cold War / by Lize-Marié van der Watt, Peder Roberts, Julia Lajus Chapter 13: Rockets over Thule? American hegemony, ionosphere research and the politics of rockets in the wake of the 1968 Thule B-52 accident / by Henrik Knudsen Chapter 14: Applied science and practical cooperation: Operation Morning Light and the recovery of cosmos 954 in the Northwest Territories, 1978 / by P. Whitney Lackenbauer, Ryan Dean Chapter 15: Melting the ice curtain: indigeneity and the Alaska Siberia Medical Research Program, 1982–1988 / by Tess Lanzarotta Epilogue: global Cold War—the Antarctic and the Arctic Chapter 16: Antarctic science and the Cold War / by Adrian Howkins
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 80
    Call number: 9781789200294 (e-book)
    Type of Medium: 12
    Pages: 1 Online-Ressource (334 Seiten) , Illustrationen
    ISBN: 9781789200294
    Series Statement: Studies in German history 22
    Language: English
    Note: CONTENTS List of Figures and Tables Acknowledgments Introduction: German Histories and Pacific Histories / Ulrike Strasser, Frank Biess, and Hartmut Berghoff Part I. Missionaries, Explorers, and Knowledge Transfer 1. German Apothecaries and Botanists in Early Modern Indonesia, the Philippines, and Japan / Raquel A. G. Reyes 2. A Bohemian Mapmaker in Manila: Travels, Transfers, and Traces between the Pacific Ocean and Germans Lands / Ulrike Strasser 3. German Naturalists in the Pacific around 1800: Entanglement, Autonomy, and a Transnational Culture of Expertise / Andreas W. Daum 4. Georg Wilhelm Steller and Carl Heinrich Merck: German Scientists in Russian Service as Explorers in the North Pacific in the Eighteenth Century / Kristina Küntzel-Witt 5. Johann Reinhold Forster and the Ship Resolution as a Space of Knowledge Production / Anne Mariss 6. Engineering Empire: German Influence on Chinese Industrialization, 1880-1925 / Shellen Wu Part II. Expansion, Entanglements, and Colonialism in the Long Nineteenth Century 7. Expanding the Frontier(s): The Spreckels Family and the German-American Penetration of the Pacific, 1 870-1920 / Uwe Spiekermann 8. Work and Non-work in the "Paradise of the South Sea": Samoa, ca. 1890-1914 195 / Jürgen Schmidt 9. German Women in the South Sea Colonies, 1884-1919 / Livia Rivotti 10. Sacrifice, Heroism, Professionalization, and Empowerment: Colonial New Guinea in the Lives of German Religious Women, 1899-1919 / Katharina Stornig 11. Rape, Indenture, and the Colonial Courts in German New Guinea / Emma Thomas 12. The Trans-Pacific "Ghadar" Movement: The Role of the Pacific in the Indo-German Plot to Overthrow the British Empire during World War I / Douglas T. McGetchin 13. The Vava'u Germans: History and Identity Construction of a Transcultural Community with Tongan and Pomeranian Roots / Reinhard Wendt Epilogue German Histories and Pacific Histories: New Directions / Matt Matsuda Index
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Call number: IASS 15.89611
    Description / Table of Contents: Die Technologie der CO2-Abtrennung und -Speicherung (CCS) sowie die CO2-Nutzung (CCR) wird in diesem Fachbuch umfassend und aus unterschiedlicher Perspektive beleuchtet. Experten aus Forschung und Industrie stellen die CCS- und CCR-Technologie auf Basis der naturwissenschaftlichen und technischen Grundlagen vor und legen den Stand der Technik dar. Sie vergleichen Energiebilanzen für verschiedene Techniken und diskutieren rechtliche, wirtschaftliche und gesellschaftspolitische Aspekte. In Szenarioanalysen zeigen sie den möglichen zukünftigen Beitrag der Technologien auf und stellen die Sichtweisen der verschiedenen Stakeholder-Gruppen vor. Die Autoren haben den Anspruch, wertfrei zu informieren. Dabei legen sie die Kriterien für die Bewertung der einzelnen Sichtweisen offen. Die Zielgruppen Das Buch richtet sich sowohl an Entscheidungsträger in Industrie, Wirtschaft, Verwaltung und Politik als auch an Wissenschaftler und Studenten. Aufgrund der ganzheitlichen Betrachtungsweise ist es für eine Vielzahl weiterer Akteure aus allen gesellschaftlichen Bereichen von großem Interesse. Der Inhalt I Einleitung und Motivation. - II CO2: Eigenschaften, Herkunft, Verwendung und Mengen. - III CO2-Abtrennung und -Speicherung. - IV CO2-Nutzung (CCR). - V Multikriterielle Bewertung von CCS und CCR. - VI Szenarien. - VII CCS aktuell. Die Herausgeber Prof. Dr.-Ing. Manfred Fischedick ist Vizepräsident am Wuppertal Institut für Klima, Umwelt, Energie sowie Professor an der Schumpeter School of Business and Economics der Bergischen Universität Wuppertal. Prof. Dr. Ing. habil. Klaus Görner ist Leiter des Lehrstuhls für Umweltverfahrenstechnik und Anlagentechnik der Universität Duisburg-Essen. Er ist gleichzeitig wissenschaftlicher Vorstand des Gas- und Wärme-Instituts e.V., Essen. Dipl.-Geogr. Margit Thomeczek ist Leiterin des Netzwerks Kraftwerkstechnik NRW der EnergieAgentur.NRW und Mitglied des Vorstands des Rhein Ruhr Power e.V., Düsseldorf
    Type of Medium: Monograph available for loan
    Pages: XXXII, 855 S. , Ill., graph. Darst.
    ISBN: 9783642195273
    Language: German
    Note: I Einleitung und MotivationII CO2 Eigenschaften, Herkunft, Verwendung und Mengen -- III CO2-Abtrennung und -Speicherung -- IV CO2-Nutzung (CCR) -- V Multikriterielle Bewertung von CCS und CCR -- VI Szenarien -- VII CCS aktuell..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Call number: 8/M 15.89430
    In: Geotechnical, geological and earthquake engineering, Vol. 37
    Description / Table of Contents: This book offers a broad perspective on important topics in earthquake geotechnical engineering and gives specialists and those that are involved with research and application a more comprehensive understanding about the various topics. Consisting of eighteen chapters written by authors from the most seismic active regions of the world, such as USA, Japan, Canada, Chile, Italy, Greece, Portugal, Taiwan, and Turkey, the book reflects different views concerning how to assess and minimize earthquake damage. The authors, a prominent group of specialists in the field of earthquake geotechnical engineering, are the invited lecturers of the International Conference on Earthquake Geotechnical Engineering from Case History to Practice in the honour of Professor Kenji Ishihara held in Istanbul, Turkey during 17-19 June 2013
    Type of Medium: Monograph available for loan
    Pages: XV, 479 p. , Ill.
    ISBN: 9783319107851
    Series Statement: Geotechnical, Geological and Earthquake Engineering 37
    Classification:
    Seismology
    Language: English
    Note: Geotechnical damage in the downstream reaches of the Tone river in the 2011 East Japan EarthquakeAmplification Effects of Thin Soft Surface Layers: A Study for NBCC 2015 -- New design spectra in Eurocode 8 and preliminary application to the seismic risk of Thessaloniki, Greece -- Incorporating Site Response into Seismic Hazard Assessments for Critical Facilities: A Probabilistic Approach -- Stress Scaling Factors For Seismic Soil Liquefaction Engineering Problems: A Performance-Based Approach -- Site amplification formula using Average Vs in equivalent surface layer based on vertical array strong motion records -- Observations from Istanbul vertical arrays and site specific response analysis -- Combined failure mechanism of a breakwater subject to Tsunami during 2011 East Japan Earthquake -- Lessons Learned From Dams Behavior Under Recent Earthquakes -- Nonlinear dynamic analyses of liquefaction effects on dams -- The Effects of Liquefaction on Earthquake Ground Motions -- Shaking model tests on liquefaction mitigation of embedded lifeline -- Effect of Long Duration of the Main Shock and a Big Aftershock on the Liquefaction-Induced Damage During the 2011 Great East Japan Earthquake -- Liquefaction Observed During the 2010 Chile Earthquake -- A Case Study of Silty Sand Liquefaction- 2010 Hsin Hwa Liquefaction in Taiwan -- Post-earthquake analysis for a seismic retrofitting: the case history of a piled foundation in Augusta (Italy) -- Pile design in laterally spreading soil: Feedback from numerical predictions and model test results -- Integrating use of Swedish weight sounding tests for earthquake reconnaissance investigations..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Monograph available for loan
    Monograph available for loan
    Potsdam : Institute for Advanced Sustainability Studies (IASS)
    Call number: IASS 16.89609
    Type of Medium: Monograph available for loan
    Pages: XV, 212 S.
    Edition: Online edition Online-Ressource Online-Ausg. Stuttgart : Universitätsbibliothek der Universität Stuttgart. Online-Ressource
    ISBN: 978-3-943550-02-3
    Series Statement: IASS Dissertation
    Language: German
    Note: Stuttgart, Univ., Diss., 2015
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: M 16.89855
    Description / Table of Contents: The first global overview of intraplate earthquakes, their mechanical models and investigative geophysical techniques, for academic researchers, professionals and engineers
    Type of Medium: Monograph available for loan
    ISBN: 9781107040380
    Parallel Title: Print version: Intraplate Earthquakes
    Language: English
    Note: Cover; Half title; Title; Copyright; Contents; Contributors; Preface; 1 Introduction; 2 Intraplate earthquakes in Australia; 2.1 Introduction; 2.2 Two centuries of earthquake observations in Australia; 2.2.1 Mechanism, geographic distribution, and strain rate; 2.2.2 Seismogenic depth; 2.2.3 Attenuation and scaling relations; 2.3 A long-term landscape record of large (morphogenic) earthquakes; 2.3.1 Variation in fault scarp length and vertical displacement; 2.3.2 The influence of crustal type and character on seismic activity rates; 2.4 Patterns in earthquake occurrence. , 2.5 Maximum magnitude earthquake2.5.1 Scarp length as a proxy for paleo-earthquake magnitude; 2.6 Implications for SCR analogue studies: factors important in earthquake localisation; 2.6.1 Mechanical and thermal influences; 2.6.2 Structural architectural influences; 2.7 Conclusions; Acknowledgements; 3 Intraplate seismicity in Brazil; 3.1 Introduction; 3.2 Earthquake catalogue; 3.3 Seismicity map; 3.4 Seismotectonic correlations; 3.4.1 Lower seismicity in Precambrian cratonic provinces; 3.4.2 Intraplate seismicity and cratonic roots; 3.4.3 Passive margin seismicity. , 3.4.4 Influence of neotectonic faults3.4.5 Flexural stresses; 3.5 Discussion and conclusions; Acknowledgments; 4 Earthquakes and geological structures of the St. Lawrence Rift System; 4.1 Introduction; 4.2 Historical earthquakes and their impact; 4.3 Seismic zones of the SLRS; 4.3.1 Charlevoix; 4.3.2 Lower St. Lawrence; 4.3.3 Western Quebec; 4.3.4 Background seismicity; 4.4 The St. Lawrence Rift System; 4.5 The rift hypothesis and the SLRS: discussion and conclusions; Acknowledgments; 5 Intraplate earthquakes in North China; 5.1 Introduction; 5.2 Tectonic background; 5.2.1 Geological history. , 5.2.2 Lithospheric structure5.2.3 Major seismogenic faults; 5.3 Active tectonics and crustal kinematics; 5.4 Strain rates and seismicity; 5.5 Seismicity; 5.5.1 Paleoseismicity; 5.5.2 Large historic events; 1303 Hongdong earthquake (M 8.0); 1556 Huaxian earthquake (M 8.3); 1668 Tancheng earthquake (M 8.5); 1679 Sanhe earthquake (M 8.0); 1695 Linfen earthquake (M 7.5-8.0); 5.5.3 Large instrumentally recorded earthquake; The 1966 Xingtai earthquake (Ms 7.2); The 1975 Haicheng earthquake (Ms 7.3); The 1976 Tangshan earthquake (Ms 7.8); 5.6 Spatiotemporal patterns of large earthquakes. , 5.6.1 Long-distance roaming of large earthquakes5.6.2 Fault coupling and interaction; 5.6.3 A conceptual model for mid-continental earthquakes; 5.7 Implications for earthquake hazards; Acknowledgements; 6 Seismogenesis of earthquakes occurring in the ancient rift basin of Kachchh, Western India; 6.1 Introduction; 6.2 Tectonic framework, structure, and tectonic evolution of Kachchh Rift basin; 6.2.1 Structure and tectonics; 6.2.2 Tectono-volcanic events; 6.2.3 Tectonic evolution and existing earthquake generation models of the Kachchh Rift zone. , 6.2.4 Identification of magmatic intrusive bodies.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Call number: PIK N 454-16-89861
    Description / Table of Contents: This book presents an analysis of land and water resources in Siberia, initially characterizing the landscapes, their ecosystems, crucial processes, human impacts on soil and water quality, and the status quo of available research. Further chapters deal with modern monitoring and management methods that can lead to a significant knowledge shift and initiate sustainable soil and water resources use. These include soil hydrological laboratory measurement methods; process-based field evaluation methods for land and water quality; remote sensing and GIS technology-based landscape monitoring methods; process and ecosystem modeling approaches; methods of resource and process evaluation and functional soil mapping; and tools for controlling agricultural land use systems. More than 15 of these concrete monitoring and management tools can immediately be incorporated into research and practice. Maintaining the functions of great landscapes for future generations will be the reward for these efforts
    Type of Medium: Monograph available for loan
    Pages: XXIII, 760 Seiten , Ill., graph. Darst.
    ISBN: 9783319244099 , 9783319244075
    Series Statement: Springer water
    Language: English
    Note: Land and Water Resources of Siberia, their Functioning and Ecological StateStatus Report about Understanding, Monitoring and Controlling Landscape Processes in Siberia -- Methods for Monitoring the Chemical Composition of Lake Baikal Water -- Microbiological Monitoring of Lake Baikal -- Developing the Regional Indicator Indexes of Zooplankton for Water Quality Class Determination of Water Bodies in Siberia -- Measuring and Estimating Fluxes of Carbon, Major and Trace Elements to the Arctic Ocean -- Measuring Snowmelt in Siberia: Causes, Process and Consequences -- Estimation of Biomass and Net Primary Production (NPP) in West Siberian Boreal Ecosystems: In-Situ and Remote Sensing Methods -- GIS and Remote Sensing Data Based Methods for Monitoring Water and Soil Objects in the Steppe Biome of Western Siberia -- Significant Siberian Vegetation Change is Inevitably Brought on by the Changing Climate..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    Call number: IASS 16.90373
    Type of Medium: Monograph available for loan
    Pages: 234 Seiten
    Edition: 1. Auflage
    ISBN: 9783845271415 (Online) , 9783848725250 (Print)
    Series Statement: Umweltsoziologie Band 3
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: IASS 16.90372 ; PIK D 022-19-89867
    Description / Table of Contents: Wir leben auf Kosten der Zukunft. Warum? Kurzfristige Interessen der Bürger (sichere Arbeit) ergänzen sich mit kurzfristigen Interessen der Politiker (Wiederwahl). Das politische System trägt Mitschuld. Wie kann man es ändern, um  diese Schwächen zu vermeiden? Lässt es sich demokratisch rechtfertigen, wenn Anwälte zukünftiger Generationen heute schon mitentscheiden? Diese Fragen werden  von Wissenschaftlern, Schriftstellern, Politikern und Unternehmern behandelt, um methodische Analyse, politischen und ökonomischen Sachverstand und kreative Ideen zu kombinieren. Das Buch enthält Beiträge von H. Geißler, H. J. Schellnhuber, I. Trojanow u.a. „Die Demokratie hat viele große Vorzüge und Stärken. Langfristigkeit und Nachhaltigkeit gehören bislang nicht dazu. Dem kann man institutionell abhelfen. Das Buch zeigt, wie.“ (Ernst Ulrich von Weizsäcker, MdB a.D.)   Der Inhalt ·         Problemanalyse und Überblick ·         Neue Institutionen: Zukunftsräte ·         Neue Institutionen: Ombudspersonen ·         Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten ·         Ombudspersonen in Unternehmen?   Die Zielgruppen   ·         PolitikwissenschaftlerInnen ·         PhilosophInnen ·         politisch interessierte Bürger     Der Herausgeber Prof. Dr. Bernward Gesang lehrt Philosophie an der Universität Mannheim
    Type of Medium: Monograph available for loan
    Pages: XII, 150 S.
    ISBN: 9783658048952 , 9783658048945
    Parallel Title: Print version: Kann Demokratie Nachhaltigkeit
    Language: German
    Note: Problemanalyse und ÜberblickNeue Institutionen: Zukunftsräte -- Neue Institutionen: Ombudspersonen -- Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten -- Ombudspersonen in Unternehmen?..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Monograph available for loan
    Berlin, Heidelberg ;s.l. : Springer Berlin Heidelberg
    Call number: 10/M 15.89254
    Description / Table of Contents: Kohlendioxid ist eine bedeutende Verbindung in unserer Atmosphäre. Mit Wasser ergibt sie Kohlensäure und ist daher in allen Wässern zugegen. In welchem Ausmaß und in welcher Form Kohlendioxid im Wasser vorliegt, kann mit einfachen mathematischen Gleichungen berechnet werden. Wie diese Gleichungen hergeleitet und was damit ausgesagt werden kann, wird in diesem Buch an Hand von 3D-Grafiken ausführlich gezeigt und diskutiert. Die angegebenen Gleichungen können zur Berechnung von wasserchemischen Parametern herangezogen werden. Das Buch richtet sich an Hydrochemiker, Hydrogeologen, Hydrologen, Umweltwissenschaftler, Analytiker und Chemiker, die sich mit Wasserchemie beschäftigen und an fortgeschrittene Studierende, die die theoretischen Grundlagen des Kohlendioxidgleichgewichts vertiefen wollen sowie an alle, die sich für die mathematische Behandlung von chemischen Gleichgewichten interessieren. Der Autor Hofrat Mag. Dr. Gerhard Hobiger diplomierte in Analytischer Chemie und promovierte  über die chemische Bindung im TiO-Festkörper an der Universität Wien. Anschließend war er im Zentrallabor des Umweltbundesamtes tätig und ist jetzt der Leiter der Fachabteilung Geochemie an der Geologischen Bundesanstalt in Wien
    Type of Medium: Monograph available for loan
    Pages: Online-Ressource (XI, 142 S. 94 Abb) , online resource
    Edition: Online edition Springer eBook Collection. Life Science and Basic Disciplines
    ISBN: 9783662454664 , 9783662454657
    URL: Cover
    URL: Cover
    Classification:
    Chemistry
    Parallel Title: Print version: Kohlendioxid in Wasser mit Alkalinität : Berechnung und grafische Darstellung der chemischen Gleichgewichte
    Parallel Title: Druckausg.: Hobiger, Gerhard: Kohlendioxid in Wasser mit Alkalinität
    Language: German
    Note: Vorwort1 Einleitung -- 2 Grundlegende Definitionen -- 3 Das offene System Kohlendioxid in Wasser mit Alkalinität -- 4 Das offene System von Kohlendioxid in reinem Wasser als Spezialfall des allgemeinen Falles mit Alkalinität -- Anhang 1-5..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Monograph available for loan
    Monograph available for loan
    Oxford [England] : Pergamon Press, in association with the Open University
    Call number: PIK N 454-16-90160
    Description / Table of Contents: 'Seawater' has been substantially updated in this second edition to take account of recent developments in marine science. Sections dealing with difficult physical and chemical concepts have been developed on the basis of feedback from the first edition, making this an ideal learning tool for oceanography students.Chapter 1 summarizes the special properties of water and the role of the oceans in the hydraulic cycle. The distribution of temperature and salinity in the oceans and how they influence water density and movements is then discussed. Light and sound in seawater are considered next, al
    Type of Medium: Monograph available for loan
    Pages: 168 S. , Ill., graph. Darst.
    Edition: 2nd ed. / rev. for the course team by John Wright and Angela Colling
    ISBN: 0080425186 (flexicover) , 9780750637152
    Language: English
    Note: Front Cover; SEAWATER: ITS COMPOSITION, PROPERTIES AND BEHAVIOUR; Copyright Page; CONTENTS; ABOUT THIS VOLUME; ABOUT THIS SERIES; CHAPTER 1. WATER , AIR AND ICE; 1.1 THE SPECIAL PROPERTIES OF WATER; 1.2 THE HYDROLOGICAL CYCLE; 1.3 SUMMARY OF CHAPTER 1; CHAPTER 2. TEMPERATURE IN THE OCEANS; 2.1 SOLAR RADIATION; 2.2 DISTRIBUTION OF SURFACE TEMPERATURES; 2.3 DISTRIBUTION OF TEMPERATURE WITH DEPTH; 2.4 ENERGY FROM THE THERMOCLINE - A BRIEF DIGRESSION; 2.5 TEMPERATURE DISTRIBUTION AND WATER MOVEMENT; 2.6 SUMMARY OF CHAPTER 2; CHAPTER 3. SALINITY IN THE OCEANS; 3.1 CONSTANCY OF COMPOSITION. , 3.2 VARIATIONS IN SALINITY3.3 THE MEASUREMENT OF SALINITY; 3.4 SUMMARY OF CHAPTER 3; CHAPTER 4. DENSITY AND PRESSURE IN THE OCEAN; 4.1 WATER MASSES; 4.2 DEPTH (PRESSURE), DENSITY AND TEMPERATURE; 4.3 T-S DIAGRAMS; 4.4 MIXING PROCESSES IN THE OCEANS; 4.5 SUMMARY OF CHAPTER4; CHAPTER 5. LIGHT AND SOUND IN SEAWATER; 5.1 UNDERWATER LIGHT; 5.2 UNDERWATER SOUND; 5.3 SUMMARY OF CHAPTER 5; CHAPTER 6. THE SEAWATER SOLUTION; 6.1 THE GROSS CHEMICAL COMPOSITION OF SEAWATER; 6.2 SOURCES AND SINKS, OR WHY THE SEA IS SALT; 6.3 CHEMICAL AND BIOLOGICAL REACTIONS IN SEAWATER; 6.4 SUMMARY OF CHAPTER 6. , CHAPTER 7. SEAWATER AND THE GLOBAL CYCLE7.1 A SHORT HISTORY OF SEAWATER; 7.2 A LOOK AHEAD; 7.3 SUMMARY OF CHAPTER; APPENDIX: CONVERSIONS BETWEEN pH AND [H+]; SUGGESTED AND COMMENTS READING; ANSWERS AND COMMENTS TO QUESTIONS; ACKNOWLEDGEMENTS; INDEX.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Call number: MOP 37350 ; MOP 35247
    Type of Medium: Monograph available for loan
    Pages: 603 S. , zahlr. Ill., + graph. Darst.
    Edition: Online edition Springer eBook Collection. Humanities, Social Science
    ISBN: 9783642866920 , 9783642866937
    Series Statement: Wissenschaftliche Forschungsberichte, Naturwissenschaftliche Reihe 71
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Monograph available for loan
    Monograph available for loan
    Basingstoke, England : Palgrave Macmillan
    Call number: PIK B 160-16-90200
    Description / Table of Contents: This updated and revised edition outlines strategies and models for how to use technology and knowledge to improve performance, create jobs and increase income. It shows what skills will be required to produce, sell and manage performance over time, and how manual jobs can contribute to reduce the consumption of non-renewable resources
    Type of Medium: Monograph available for loan
    Pages: XXIII, 349 Seiten , graph. Darst.
    Edition: 2nd edition
    ISBN: 0230584667 (hbk.) , 9781349369195 (pbk.) , 9780230584662 (hbk.)
    Language: English
    Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    Monograph available for loan
    Monograph available for loan
    Rochester, N.Y. [u.a.] : Camden House
    Call number: IASS 16.90206
    Description / Table of Contents: Provocative and spiced with humor, this book uses a cultural studies approach to examine the fraught relationship in German history between material reality and ideology
    Type of Medium: Monograph available for loan
    Pages: 247 Seiten
    ISBN: 9781571139290
    Series Statement: Studies in German literature, linguistics, and culture v.Volume 160
    Language: English
    Note: Frontcover; Contents; Acknowledgments; Introduction; 1: The Problem(s); 2: A Plethora of Germanies; 3: Culture, Language, and Blood; 4: The Gemeinschaft; 5: Marx, the Proletariat, and the State; 6: Hegel and the State; 7: German Historians and the State; 8: Meinecke and the State; 9: The Lingering Ambiguities of the State; 10: Materialism; 11: Militarism and Death; 12: Providence and Narration; 13: Guilt and Innocence; 14: The Indispensable Jews; 16: The State Today; Notes; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Monograph available for loan
    Monograph available for loan
    Princeton : Princeton University Press
    Call number: IASS 16.90214
    Description / Table of Contents: Cover -- Title -- Copyright -- CONTENTS -- Acknowledgments -- Introduction -- PART I FROM CUNEIFORM TO CLASSICAL CIVILIZATION -- 1 Finance and Writing -- 2 Finance and Urbanism -- 3 Financial Architecture -- 4 Mesopotamian Twilight -- 5 Athenian Finance -- 6 Monetary Revolution -- 7 Roman Finance -- PART II THE FINANCIAL LEGACY OF CHINA -- 8 China's First Financial World -- 9 Unity and Bureaucracy -- 10 Financial Divergence -- PART III THE EUROPEAN CRUCIBLE -- 11 The Temple and Finance -- 12 Venice -- 13 Fibonacci and Finance -- 14 Immortal Bonds
    Description / Table of Contents: 15 The Discovery of Chance -- 16 Efficient Markets -- 17 Europe, Inc. -- 18 Corporations and Exploration -- 19 A Projecting Age -- 20 A Bubble in France -- 21 According to Hoyle -- 22 Securitization and Debt -- PART IV THE EMERGENCE OF GLOBAL MARKETS -- 23 Marx and Markets -- 24 China's Financiers -- 25 The Russian Bear -- 26 Keynes to the Rescue -- 27 The New Financial World -- 28 Re-Engineering the Future -- 29 Post-War Theory -- Conclusion -- Notes -- Bibliography -- Illustration Credits -- Index
    Type of Medium: Monograph available for loan
    Pages: VIII, 584 Seiten : Illustrationen, Diagramme
    ISBN: 0691143781 (print) , 9780691143781 (print) , 1400881307 (ebook) , 9781400881307 (ebook)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Monograph available for loan
    Monograph available for loan
    Cheltenham [u.a.] : Edward Elgar Publishing
    Call number: PIK N 074-16-89998
    Description / Table of Contents: Cover -- Copyright -- Contents -- Contributors -- Introduction -- PART I THE ROLE OF GREEN INFRASTRUCTURE IN THE URBAN ENVIRONMENT -- 1 Green infrastructure and health -- 2 The impacts of green infrastructure on air quality and temperature -- 3 Green infrastructure and urban water management -- 4 Putting economic values on green infrastructure improvements -- 5 Green infrastructure and biodiversity in the city: principles and design -- PART II STRATEGIC PLANNING FOR GREEN INFRASTRUCTURE -- 6 Green infrastructure planning: policy and objectives
    Description / Table of Contents: 7 Planning green infrastructure at a strategic level: experience from The Mersey Forest -- 8 Delivering green infrastructure through strategic development: some reflections from Cambridge, UK and Cambridge, USA -- 9 Planning green infrastructure from a landscape perspective -- 10 Planning for urban green infrastructure in metropolitan landscapes -- 11 Ensuring green infrastructure for all -- PART III DESIGNING GREEN INFRASTRUCTURE FOR ALL -- 12 Multifunctional green infrastructure: a typology -- 13 Towards inclusive green infrastructure
    Description / Table of Contents: 14 The influences of neighbourhood design and quality on residents' use of public open space -- 15 Green grounds for play and learning: an intergenerational model for joint design and use of school and park systems -- 16 The contribution of green infrastructure to a sense of place in historic urban environments -- 17 Landscape, beyond green and grey infrastructure -- PART IV IMPLEMENTATION AND MANAGEMENT OF GREEN INFRASTRUCTURE -- 18 The governance and management of public green spaces -- 19 Community involvement in green infrastructure
    Description / Table of Contents: 20 Implementing green infrastructure through residential development in the UK -- 21 Green infrastructure and regeneration of brownfield land -- 22 Monitoring and evaluation of green infrastructure: a logic model and ecosystem services approach -- PART V LOOKING FORWARD -- 23 The future of green infrastructure -- Index
    Description / Table of Contents: Green infrastructure is widely recognised as a valuable resource in our towns and cities and it is therefore crucial to understand, create, protect and manage this resource. This Handbook sets the context for green infrastructure as a means to make urban environments more resilient, sustainable, liveable and equitable. It then provides a comprehensive and authoritative account for those seeking to achieve sustainable green infrastructure in urban environments of how to plan, design and implement green infrastructure at different spatial scales
    Type of Medium: Monograph available for loan
    Pages: XVII, 474 Seiten , Illustrationen, Diagramme
    ISBN: 1783474009 (print) , 9781783474004 (print) , 9781783473991 (print)
    Parallel Title: Print version Handbook on Green Infrastructure : Planning, Design and Implementation
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    Monograph available for loan
    Monograph available for loan
    New York, NY : Routledge
    Call number: IASS 17.90916
    Description / Table of Contents: Cover -- Half Title -- Title Page -- Copyright Page -- Contents -- List of figures and tables -- Contributors -- Acknowledgements -- List of abbreviations -- 1 Governance of offshore oil and gas in the Arctic: between diversity and coexistence -- PART I: Globalization and supra-nationalism in the Arctic -- 2 Framing the problem in Arctic offshore hydrocarbon exploitation -- 3 Sustainable development in Arctic international environmental cooperation and the governance of hydrocarbon-related activities -- 4 The EU's role as a facilitator in the development of maritime environmental law in the Arctic: with focus on offshore hydrocarbon activities -- 5 Indigenous rights in the marine Arctic -- PART II: National perspectives on offshore regulations -- 6 Alaska and offshore hydrocarbon extraction: a legal and socio-economic review -- 7 Governance of offshore hydrocarbon activities in the Arctic and energy policies: a comparative approach between Norway, Canada and Greenland/Denmark -- 8 The Russian offshore oil and gas regime: when tight control means less order -- 9 The Arctic offshore hydrocarbon hiatus of 2015: an opportunity to revisit regulation around the pole -- PART III: State-based approach, sub-states entities and indigenous peoples -- 10 Offshore development and Inuit rights in Inuit Nunangat -- 11 Securing the coastal Sámi culture and livelihood -- 12 Indigenous modes of ownership: reopening the case for communal rights in Greenland -- PART IV: Regulatory instruments and enforcement -- 13 Impact benefit agreements and economic and environmental risk management in the Arctic -- 14 Impact and benefit a greements in Greenland -- 15 The interplay between environmental research and environmental regulation of offshore oil activities in Greenland -- 16 Towards an integrated and participatory governance of the Arctic marine areas -- Index
    Type of Medium: Monograph available for loan
    Pages: xx, 299 Seiten , Illustrationen
    ISBN: 9781472471505 (hbk) , 9781317125914 (ebk)
    Series Statement: Global Governance
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Monograph available for loan
    Monograph available for loan
    Abingdon, Oxon : Taylor and Francis
    Call number: IASS 16.90031
    Description / Table of Contents: Cover -- Half Title -- Title Page -- Copyright Page -- Contents -- List of figures -- List of contributors -- Acknowledgements -- Foreword -- Climates of history, cultures of climate -- Epistemic climates -- Time, representation, agency -- Enduring bad faith -- Notes -- References -- Part I: Climates of history -- Chapter 1: Voices of endurance: climate and the power of oral history -- Valuing oral history -- Endurance -- Drought 'makes who we are' -- Weathering loss -- Dwelling in uncertainty -- Listening for change -- Living with future drought -- Notes -- References
    Description / Table of Contents: Chapter 2: Rethinking seasons: changing climate, changing time -- Indigenous seasons -- Western seasons: the weather, climate, calendar nexus -- The idea vs history -- Climate change and the seasons -- Notes -- References -- Chapter 3: The terrestrial envelope: Joseph Fourier's geological speculation -- Introduction: poiesis of other worlds -- Science studies and imagination -- Fourier's demonstration -- The scene of imagination -- Infinite cold -- Geological speculation -- Notes -- References -- Chapter 4: Melancholy and the continent of fire -- Forest Gallery, Melbourne
    Description / Table of Contents: Emerging environmental histories -- Moving through time -- Climatic seasonal encounters -- Melancholic environmental memorial -- Conclusion -- Notes -- References -- Chapter 5: The Anthropocene and the long seventeenth century: 1550-1750 -- Early modern poetic and philosophical critique -- The seventeenth century age of crisis -- The Columbian Exchange -- The Anthropocene -- Notes -- References -- Part II: Climates of writing -- Chapter 6: Change beyond belief: fictions of (the) Enlightenment and Simpson's 'climate change suite' -- Enlightenment atmospheres of belief -- Notes -- References
    Description / Table of Contents: Chapter 7: Fuels and humans, bíos and zoe -- Notes -- References -- Chapter 8: The 'foreign grave' motif in Victorian medicine and literature -- The medical debate -- Exchanges between literature and medicine -- The literary life of the foreign grave motif -- Conclusion -- References -- Chapter 9: Climate change and literary history -- What does climate mean? -- Climate, climat, 'climate' -- Wittgenstein's atmospheres -- Climate, clima, clinamen -- Writing climatic culture -- Climate, race, milieu and moment -- For a literary history of climate change -- Notes -- References
    Description / Table of Contents: Part III: Climates of politics -- Chapter 10: Climate change: politics, excess, sovereignty -- Politics -- Excess -- Sovereignty -- Conclusion -- Note -- References -- Chapter 11: Para-religions of climate change: humanity, eco-nihilism, apocalypse -- The Anthropocene as object of (dis)belief -- Is not/il y a -- Gaia revisited -- The last man's party -- Dark temples, sordid churches: 'new religious movements' -- Moral panic, apocalypse and other bourgeois pastimes -- Notes -- References -- Chapter 12: Litigation, activism, and the paradox of lawfulness in an age of climate change
    Description / Table of Contents: Lawfulness and climate change litigation
    Type of Medium: Monograph available for loan
    ISBN: 9781138838161
    Series Statement: Routledge Environmental Humanities
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    Monograph available for loan
    Monograph available for loan
    Dordrecht : Springer Science + Business Media B.V
    Call number: PIK N 456-16-90276
    Description / Table of Contents: This textbook describes various physical, radiative, dynamical and chemical processes involved in the coupling between the Stratosphere and Troposphere. This textbook is intended for graduate students in middle atmosphere stratospheric physics, dynamic and atmospheric science courses and will be useful to all research workers in meteorology, aeronomy, atmospheric physics, atmospheric chemistry and environmental sciences. Current areas of interest, such as Antarctic ozone hole, global warming effects on stratospheric cooling are also addressed. Stratosphere troposphere exchange, transport processes in the upper troposphere and lower stratosphere and the role of stratosphere on tropospheric weather systems are presented. The information provided in the textbook will have broad applicability in other branches of atmospheric science, and will be of interest to those studying such areas as climate change, extreme weather events, and potential for the prediction of tropospheric weather systems.
    Type of Medium: Monograph available for loan
    Pages: XVII, 416 Seiten , Illustrationen, Diagramme
    ISBN: 9781402082160 , 9781402082177
    Language: English
    Note: ""Preface""; ""Acknowledgments""; ""Contents""; ""Chapter 1 Structure and Composition of the Lower and Middle Atmosphere""; ""Chapter 2 Radiative Processes in the Lower and Middle Atmosphere""; ""Chapter 3 Dynamics of the Troposphere and Stratosphere""; ""Chapter 4 Waves in the Troposphere and Stratosphere""; ""Chapter 5 Chemical Processes in the Stratosphere and Troposphere""; ""Chapter 6 Stratospheric Ozone Depletion and Antarctic Ozone Hole""; ""Chapter 7 Transport Processes in the Stratosphere and Troposphere""; ""Chapter 8 Stratosphere�Troposphere Exchange"". , ""Chapter 9 Stratospheric Influence on Tropospheric Weather and Climate""""Acronyms""; ""List of Symbols""; ""Table of Physical Constants""; ""Answers to Selected Problems""; ""Index"".
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Call number: 6/M 17.91060
    Description / Table of Contents: Introduction -- Writing code for Scientific Software -- Using a code toolbox -- Controlling a Laser Ranging System -- Controlling a VLBI system from remote -- Coordination, communication and automation for the GGOS -- A Style Guide for Geodetic Software in C and C++ -- Precise telescope mount model parameters based on the least squares method
    Description / Table of Contents: This book combines elementary theory from computer science with real-world challenges in global geodetic observation, based on examples from the Geodetic Observatory Wettzell, Germany. It starts with a step-by-step introduction to developing stable and safe scientific software to run successful software projects. The use of software toolboxes is another essential aspect that leads to the application of generative programming. An example is a generative network middleware that simplifies communication. One of the book’s main focuses is on explaining a potential strategy involving autonomous production cells for space geodetic techniques. The complete software design of a satellite laser ranging system is taken as an example. Such automated systems are then combined for global interaction using secure communication tunnels for remote access. The network of radio telescopes is used as a reference. Combined observatories form coordinated multi-agent systems and offer solutions for operational aspects of the Global Geodetic Observing System (GGOS) with regard to “Industry 4.0”
    Type of Medium: Monograph available for loan
    Pages: XV, 546 p. 244 illus., 165 illus. in color, online resource
    ISBN: 9783319401379
    Series Statement: Springer Textbooks in Earth Sciences, Geography and Environment
    Classification:
    Geodesy
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Monograph available for loan
    Monograph available for loan
    Cham : Springer
    Call number: M 17.91132
    Description / Table of Contents: The third edition of this classic text presents a complete introduction to plasma physics and controlled fusion, written by one of the pioneering scientists in this expanding field.  It offers both a simple and intuitive discussion of the basic concepts of the subject matter and an insight into the challenging problems of current research. This outstanding text offers students a painless introduction to this important field; for teachers, a large collection of problems; and for researchers, a concise review of the fundamentals as well as original treatments of a number of topics never before explained so clearly.  In a wholly lucid manner the second edition covered charged-particle motions, plasmas as fluids, kinetic theory, and nonlinear effects.  For the third edition, two new chapters have been added to incorporate discussion of more recent advances in the field.  The new chapter 9 on Special Plasmas covers non-neutral plasmas, pure electron plasmas, solid and ultra-cold plasmas, pair-ion plasmas, dusty plasmas, helicon plasmas, atmospheric-pressure plasmas, sheath-bounded plasmas, reconnection and turbulence.  Following this, chapter 10 describes Plasma Applications such as magnetic fusion (pinches, mirrors, FRCs, stellarators, tokamaks, spheromaks), plasma accelerators and FELs, ine rtial fusion, semiconductor etching, and spacecraft propulsion. This new revised edition remains an essential text for those new to the field and an invaluable reference source for established researchers
    Type of Medium: Monograph available for loan
    Pages: xii, 490 Seiten , Illustrationen, Diagramme
    Edition: Third edition
    ISBN: 978331922308 , 9783319223094
    Language: English
    Note: IntroductionSingle-particle motions -- Plasmas as fluids -- Waves in plasmas -- Diffusion and resistivity -- Equilibrium and stability -- Kinetic theory -- Nonlinear effects -- Special plasmas -- Plasma applications..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Type of Medium: 12
    Pages: 80 S. , Ill., graph. Darst.
    Series Statement: IHP-VII Technical Documents in Hydrology 83
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...