ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • 2015-2019  (742,506)
  • 2010-2014  (437,130)
  • 1970-1974  (8)
  • 1940-1944  (3)
  • 2015  (742,506)
  • 2010  (437,129)
Collection
Language
Years
Year
  • 1
    Call number: Z 06.0500
    Type of Medium: Journal available for loan
    Pages: 30 cm
    ISSN: 1824-7741
    Former Title: Vorgänger Geologisch-paläontologische Mitteilungen, Innsbruck
    Language: German , English
    Note: Ersch. unregelmäßig , Beiträge teilweise in Englisch
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
    Call number: M 15.89066
    In: Materialien der GWK
    Type of Medium: Monograph available for loan
    Pages: Getr. Zählung , Ill., graph. Darst., Kt.
    ISBN: 9783942342308
    Series Statement: Materialien der GWK 42
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 4
    Monograph available for loan
    Monograph available for loan
    München : Oekom
    Call number: PIK N 071-15-89129
    Type of Medium: Monograph available for loan
    Pages: 284 S. , Ill. , 24 cm
    ISBN: 9783865817648 , 3865817645
    Series Statement: Hochschulschriften zur Nachhaltigkeit 69
    Language: German
    Note: Zugl.: Marburg, Univ., Diss.
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    Call number: PIK B 404-15-89033
    Type of Medium: Monograph available for loan
    Pages: LXXVII, 3030 S.
    Edition: 16., neu bearb. Aufl.
    ISBN: 978-3-406-67349-8
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    Call number: 9/M 07.0421(419)
    In: Geological Society special publication
    Description / Table of Contents: This Special Publication will be an important tool for geoscientists, aimed at increasing the awareness of their societal role and responsibility in conducting education, research and practice activities.What are the responsibilities of a geoscientist ? And what motivations are needed to push geoscientists to practice the Earth sciences in an ethical way?The major environmental challenges affecting human communities require not only a strictly scientific and technical preparation by the geoscientists, but also a reflection on their broader obligations towards society. It is important that geoscientists consider geoethics as an indispensable framework on which to base their training and activity. The principles of geoethics can guide them to pursue the common good by weighing the benefits and costs of each choice, and identifying eco-friendly and society-friendly solutions that guarantee the respect of the right balance between human life and the dynamics of the Earth.Communication and dissemination of geosciences should become core activities in building a knowledge-based society, which is able better to protect itself and the Earth ecosystems in order to guarantee a life in harmony with our planet for future generations.
    Type of Medium: Monograph available for loan
    Pages: VI, 187 S. , farb. Ill., graph. Darst., Kt.
    ISBN: 9781862397262
    Series Statement: Geological Society special publication 419
    Classification:
    E.7.
    Classification:
    Natural Disasters, Disaster Management
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Monograph available for loan
    Monograph available for loan
    Heidelberg [u.a.] : Rehm
    Associated volumes
    Call number: IASS 15.89564
    In: TVöD - Tarif- und Arbeitsrecht im öffentlichen Dienst
    Type of Medium: Monograph available for loan
    Pages: VIII, 292 S.
    Edition: 14. Aufl., Stand: 1.2.2015
    ISBN: 9783807308869
    Series Statement: Breier, Alfred/TVöD - Tarif- und Arbeitsrecht im öffentlichen Dienst
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Call number: M 15.89581
    In: Geschichte(n) des Wissens : Festschrift für Wolfgang E. J. Weber zum 65. Geburtstag, (2015), p. 413 - 430
    Type of Medium: Monograph available for loan
    Pages: Ill.
    Classification:
    Seismology
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    Call number: 4/N 16.89579
    Description / Table of Contents: "This volume provides an overview of (1) the physical and chemical foundations of dating methods and (2) the applications of dating methods in the geological sciences, biology, and archaeology, in almost 200 articles from over 200 international authors. It will serve as the most comprehensive treatise on widely accepted dating methods in the earth sciences and related fields."--
    Type of Medium: Monograph available for loan
    Pages: XXV, 978 S. , Ill., graph. Darst., Kt. , 29 cm
    ISBN: 9789400763036 (Gb.) , 9789400763067 (Print + eBook) , 9789400763043 (electr.; eBook)
    Series Statement: Encyclopedia of earth sciences series
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Series available for loan
    Series available for loan
    Leiden : Nationaal Natuurhistorisch Nuseum
    Call number: S 93.0422(148)
    Type of Medium: Series available for loan
    Pages: 142 S. , Ill.
    ISBN: 9789065190000
    Series Statement: Scripta geologica 148
    Language: English
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    Monograph available for loan
    Monograph available for loan
    London : Elsevier Science
    Call number: 8/M 16.89584
    Description / Table of Contents: Tsunamis in the European-Mediterranean Region: From Historical Record to Risk Mitigation provides readers with a much needed, reliable, and up-to-date history of the region, including descriptions and parameters of the main events from pre-history to the present that are supported by parametric catalogues, pictorial material, and examples of instrumental records, such as tide-gauge records. The book presents a broader perspective of needed action for local and national governments, and international organizations, and is written by an internationally recognized expert in this field, providing an authoritative account of historical tsunamis in the eastern Mediterranean. It addresses key points of tsunami mitigation, including the systems currently available for tsunami recording, monitoring, and early warning, along with a presentation of the preventative measures that can be applied in all tsunami-vulnerable regions. Details the systems currently available for tsunami recording, monitoring, and early warning, and the technologies that support them. Contains numerical modeling techniques used for the generation, propagation, and inundation of tsunamis. Presents clear examples of tsunamis in the region and their documentation, as well as comparisons with other regions globally
    Type of Medium: Monograph available for loan
    Pages: 290 S.
    ISBN: 9780124202245
    Classification:
    Natural Disasters, Disaster Management
    Language: English
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
    Monograph available for loan
    Monograph available for loan
    Köln : Bundesanzeiger
    Call number: PIK C 329-16-89587
    Type of Medium: Monograph available for loan
    Pages: 472 S , graph. Darst. , 244 mm x 165 mm
    Edition: 3. akt. und überarb. Aufl.
    ISBN: 3846204730 , 9783846204733
    Language: German
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 13
    Call number: ZS-064(214)
    In: Forstliche Forschungsberichte München
    Type of Medium: Series available for loan
    Pages: 147 S. , Ill., graph. Darst., Kt.
    ISBN: 393350645X
    Series Statement: Forstliche Forschungsberichte München 214
    Classification:
    Photogrammetry, Remote Sensing
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 14
    Monograph available for loan
    Monograph available for loan
    Bonn : Deutscher Hochschulverband
    Call number: M 16.89614 ; M 16.89614 (2. Ex.)
    Type of Medium: Monograph available for loan
    Pages: 475 Seiten , 19 cm
    Edition: 1. Auflage
    Edition: Zweite unveränderte Auflage 2016
    ISBN: 9783944941028
    Language: German , English
    Location: Upper compact magazine
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Call number: M 15.89564/1
    Type of Medium: Monograph available for loan
    Pages: 672 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9783942588171
    Series Statement: Edition Krüger-Stiftung
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    Call number: PIK N 071-15-89205
    Description / Table of Contents: This book offers new perspectives of transdisciplinary research, in methodological as well as theoretical respects. It provides insights in the two-fold bio-physical and the socio-cultural global embeddedness of local living conditions on the basis of selected empirical studies from Latin America, Asia, Africa, Australia, and Europe. The theoretical foundations of ecological research and sustainability policies were developed at the end of the nineteenth century. They are largely based on investigations of living spaces, and the evolution and differentiation of varied life forms. This perspective is embedded in the practical and theoretical European problem situations of the past and lacks social and cultural differentiation. The transformation of spatial and natural relations as a result of the globalization process is so radical that new theories are needed to solve 21st century ecological problems. Moreover, in view of the lack of an ontologically sound and promising strategy for transdisciplinary problem solving, as well as an acceptable consideration of the power of cultural schemas relating to natural living’s interpretations, there is a strong need to focus on sustainable social practices, habits, and routines, rather than on predominantly living spaces or eco-topes. This book elaborates on the transdisciplinary approach by reflecting on the theoretical heritage and a global perspective of sustainability, by focusing on the primary role of a social approach in sustainability research, and by putting emphasis on cultural dimension of sustainability. It postulates that global sustainability is grounded in a global understanding of our everyday activities
    Type of Medium: Monograph available for loan
    Pages: XV, 300 S. , Ill., graph. Darst.
    ISBN: 9783319164779 , 9783319164762
    Language: English
    Note: Introduction; Benno WerlenPreface: Speech at TIERS Conference in Jena on 8 June 2012; Matthias Machnig -- PART I: INTEGRATED TRANSDISCIPLINARY RESEARCH -- Chapter 1: Sustainability and Territory: An Approach from the Perspective of the Imaginary in Shaping Development; Enrique Aliste -- Chapter 2: Challenges for Transdisciplinary Research; Joske Bunders -- Chapter 3: Narratives for a Sustainable Future. Vision and Motivation for Collective Action; Ilan Chabay -- PART II: KNOWLEDGE -- Chapter 4: Carving a Niche for the Social Sciences in Trans-disciplinary Research on Climate Change Adaptation and Agriculture in Southern Africa; Chipo Plaxedes Mubaya -- Chapter 5: From Co-Production of Knowledge to Transdisciplinary Research. Lessons from the Quest for Producing Socially Robust Knowledge; Juergen Weichselgartner and Bernhard Truffer -- PART III: INTERFACES SOCIETY NATURE -- Chapter 6: Terrestrial Ecosystems Dynamic in the Senegalese Agro-silvopastoral Center-east in the Second Half of the XXe Century; Aliou Dijouf and Matthew G. Hatvany -- Chapter 7: Integrated Global Change Research in West Africa: Flood Vulnerability Studies; Ibidun Adelekan -- Chapter 8: Integrated Approach in Environment Management: Context Bangladesh; Raquib Ahmed -- Chapter 9: Awareness of and Responses to the 2011 Flood Warnings among Vulnerable Communities in Lagos, Nigeria; Olokesusi, F., Olorunfemi, F.B., Onwuemele A. and Oke, M.O -- PART IV: INTERFACES SCIENCE POLICY -- Chapter 10: Solution-Based Spatial Planning for Disaster Risk Reduction and Adaptation to Climate Change in Taiwan; Yu-Fang Lin -- Chapter 11: Institutions and Planning: A Reflection from the Disaster Management Planning in Indonesia; Hendricus A Simarmata and Raka W Suryandaru -- Chapter 12: Could the Search for Sustainability Reinforce the Socio-ecological Conflict? The Mining Industry in Chile and its Impact at the Local and Regional Level; Fernando Campos-Medina -- Chapter 13: Institutions and Planning: A Reflection from Disaster Management Planning in Indonesia; Hendricus A. Simarmata and Raka W. Suryandaru -- Chapter 14: Could the Search for Sustainability Reinforce the Socio-ecological Conflict? The Mining Industry in Chile and its Impact at the Local and Regional Level; Fernando Campos-Medina -- Chapter 15: Political decision-making and Scientific Insights. A comment form the Political Arena; Matthias Machnig..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
    Monograph available for loan
    Monograph available for loan
    Baltimore, Md. : Johns Hopkins University Pr.
    Call number: AWI E1-15-89213
    Description / Table of Contents: Alfred Wegener aimed to create a revolution in science which would rank with those of Nicolaus Copernicus and Charles Darwin. After completing his doctoral studies in astronomy at the University of Berlin, Wegener found himself drawn not to observatory science but to rugged fieldwork, which allowed him to cross into a variety of disciplines. The author of the theory of continental drift - the direct ancestor of the modern theory of plate tectonics and one of the key scientific concepts of the past century - Wegener also made major contributions to geology, geophysics, astronomy, geodesy, atmospheric physics, meteorology, and glaciology. Remarkably, he completed this pathbreaking work while grappling variously with financial difficulty, war, economic depression, scientific isolation, illness, and injury. He ultimately died of overexertion on a journey to probe the Greenland ice cap and calculate its rate of drift. This landmark biography - the only complete account of the scientist's fascinating life and work - is the culmination of more than twenty years of intensive research. In Alfred Wegener, Mott T. Greene places Wegener's background and theoretical advances in earth science in the context of his brilliantly eclectic career, bringing Wegener to life by analyzing his published scientific work, delving into all of his surviving letters and journals, and tracing both his passionate commitment to science and his thrilling experiences as a polar explorer, a military officer during World War I, and a world record-setting balloonist. In the course of writing this book, Greene traveled to every place that Alfred Wegener lived and worked - to Berlin, rural Brandenburg, Marbug, Hamburg, and Heidelberg in Germany; to Innsbruck and Graz in Austria; and onto the Greenland ice cap. He also pored over archives in Copenhagen, Munich, Marburg, Graz, and Bremerhaven, where the majority of Wegener's surviving papers are found. Written with great immediacy and descriptive power, Alfred Wegener is a powerful portrait of the scientist who pioneered the modern notion of unified earth science. The book should be of interest not only to earth scientists, students of polar travel and exploration, and historians but to all readers who are fascinated by the great minds of science.
    Type of Medium: Monograph available for loan
    Pages: xiv, 675 S. , Ill., Kt.
    ISBN: 9781421417127
    Language: English
    Note: Contents: Preface. - Acknowledgements. - 1. The boy: Berlin and Brandenburg, 1880-1899. - 2. The student: Berlin - Heidelberg - Innsbruck - Berlin, 1899-1901. - 3. The astronomer: Berlin, 1901-1904. - 4. The aerologist: Lindenberg, 1905-1906. - 5. The polar meteorologist: Greenland, 1906. - 6. The Arctic explorer (1): Greenland, 1907-1908. - 7. The atmospheric physicist (1): Berlin und Marburg, 1908-1910. - 8. The atmospheric physicist (2): Marburg, 1910. - 9. At a crossroads: Marburg, 1911. - 10. The theorist of continental drift (1): Marburg, December 1911 - February 1912. - 11. The theorist of continental drift (2): Marburg, February - April 1912. - 12. The Arctic explorer (2): Greenland, 1912-1913. - 13. The soldier: Marburg and "The Field", 1913-1915. - 14. The meteorologist: "In the field", 1916-1918. - 15. The geophysicist: Hamburg, 1919-1920. - 16. From geophysicist to climatologist: Hamburg, 1920-1922. - 17. The paleoclimatologist: Hamburg, 1922-1924. - 18. The professor: Graz, 1924-1928. - 19. Theorist and Arctic explorer: Graz and Greenland, 1928-1929. - 20. The expedition leader: Graz and Greenland, 1929-1930. - Epilogue. - Notes. - Bibliographical essay. - Index.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 18
    Monograph available for loan
    Monograph available for loan
    Berlin : Verlag für Geowissenschaften
    Call number: AWI E1-15-89214
    Description / Table of Contents: Alfred Wegener (1880-1930) war einer der bedeutendsten deutschen Naturwissenschaftler des vergangenen Jahrhunderts. Er untersuchte die Erdatmosphäre mit Drachen und Fesselballonen, erforschte das Wesen der gefürchteten Windhosen, fuhr vier Mal auf wissenschaftliche Expeditionen nach Grönland und stellte einen Weltrekord im bemannten Ballonflug auf. In diesem Buch wird das Leben dieses vielseitigen Forschers erzählt. Daneben wird sein wissenschaftliches Hauptwerk, die Kontinentaldrifttheorie, und seine Theorie zur Entstehung der Mondkrater durch Meteoritenbombardement beleuchtet, an die er Ideen über die Entstehung der Erde selbst knüpfte.
    Type of Medium: Monograph available for loan
    Pages: 208 S. , Ill., Kt.
    Edition: 1. Aufl.
    ISBN: 978-3-9814603-0-8 , 3981460308
    Language: German
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 19
    Monograph available for loan
    Monograph available for loan
    Karlsruhe : Institut für Bodenmechanik und Felsmechanik am Karlsruher Institut für Technologie (KIT)
    Associated volumes
    Call number: M 16.89833
    In: Veröffentlichungen des Institutes für Bodenmechanik und Felsmechanik am Karlsruher Institut für Technologie (KIT), 180
    Type of Medium: Monograph available for loan
    Pages: v, 307 Seiten , Illustrationen, Diagramme
    Series Statement: Veröffentlichungen des Institutes für Bodenmechanik und Felsmechanik am Karlsruher Institut für Technologie (KIT) Heft 180
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 20
    Call number: PIK N 076-15-89280 ; IASS 16.90035 ; PIK N 076-22-89280
    Type of Medium: Monograph available for loan
    Pages: 777 S., [24] Bl. , Ill., graph. Darst. , 215 mm x 135 mm
    Edition: 1. Aufl.
    ISBN: 9783570102626 , 3570102629
    Language: German
    Note: 1. Abschied und Wiederkehr ; Erster Grad: Die Haut 2. Wachstumsstörungen ; 3. Der beschränkte Planet ; 4. Entdeckungsreise zum Klimawandel , 5. Klimapalaver ; 6. Der Faktor Mensch ; 7. Stühlerücken auf der »Titanic« ; 8. Warum eigentlich Klimaschutz? ; 9. Mohamed ohne Land ; 10. Einstein, Gödel, Drake ; Zweiter Grad: Das Fleisch ; 11. Gottes Element ; 12. Zwei Große Transformationen ; 13. Klima als Geschichtsmacht ; 14. Ultrakurzgeschichte der Um-Welt ; 15. Vom Wetter zum Klima ; 16. Ins Feuer? ; 17. Merkel auf dem Philosophenweg ; 18. Klimafolgen: Leib und Leben ; 19. Klimafolgen: Brot und Spiele ; 20. Zwei Grad Celsius ; 21. Kippelemente im Erdgetriebe ; Dritter Grad: Das Mark ; 22. Blendet die Seher! ; 23. Betäubt die Hörer! ; 24. Die Diktatur des Jetzt ; 25. Falsche Ausfahrt: Anpassung ; 26. Falscher Film: Klimamanipulation ; 27. Die Neuerfindung der Moderne ; 28. Klimaschutz als Weltbürgerbewegung ; 29. Flucht und Gewalt ; 30. Arm und Reich ; 31. Wissenschaft, Gewissenschaft ; 32. Geschenk an Michelangelo
    Location: A 18 - must be ordered
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Branch Library: RIFS Library
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 21
    Call number: PIK B 160-16-89752
    Type of Medium: Monograph available for loan
    Pages: 382 Seiten , Illustrationen , 22 cm
    Edition: 1. Auflage
    ISBN: 3868815996 , 9783868815993 , 9783864147487 , 9783864147470
    Uniform Title: Waste to wealth
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    Call number: IASS 16.90356
    Type of Medium: Monograph available for loan
    Pages: xviii, 1140 Seiten , Illustrationen
    ISBN: 9781849712354
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: M 16.89854
    Description / Table of Contents: In a media interview in January 2010, scientist Robert Yeats sounded the alarm on Port-au-Prince, Haiti, as an 'earthquake time bomb', a region at critical risk of major seismic activity. One week later, a catastrophic earthquake struck the city, leaving over 100,000 dead and triggering a humanitarian crisis. In this timely study, Yeats sheds new light on other earthquake hotspots around the world and the communities at risk. He examines these seismic threats in the context of recent cultural history, including economic development, national politics and international conflicts. Descriptions of emerging seismic resilience plans from some cities provide a more hopeful picture. Essential reading for policy-makers, infrastructure and emergency planners, scientists, students and anyone living in the shadow of an earthquake, this book raises the alarm so that we can protect our vulnerable cities before it's too late. Draws comparisons between the capacity of first-world and developing-world countries to prepare for a major earthquake. Combines science with history to present a detailed, informative, and timely study of the world's earthquake time bombs. Explores how the combination of mass migration to megacities coupled with poor building standards is putting ever more people at risk
    Type of Medium: Monograph available for loan
    Pages: XV, 346 pages
    ISBN: 9781107085244 (hardback)
    Language: English
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 24
    Monograph available for loan
    Monograph available for loan
    Oxford : Oxford University Press
    Call number: M 16.89793
    Description / Table of Contents: Plate tectonics caused a revolution in our understanding of the Earth. It has aided our understanding of why earthquakes and volcanoes are found in distinct locations, how oceans form and disappear, and how mountain ranges were built. In this volume, Peter Molnar explores the history and significance of plate tectonics
    Description / Table of Contents: Plate tectonics caused a revolution in our understanding of the Earth. It has aided our understanding of why earthquakes and volcanoes are found in distinct locations, how oceans form and disappear, and how mountain ranges were built. In this volume, Peter Molnar explores the history and significance of plate tectonics. --
    Type of Medium: Monograph available for loan
    Pages: xvii, 136 p , Ill., maps , 18 cm
    Edition: 1st ed
    ISBN: 9780198728269 , 0198728263
    Series Statement: Very short introductions 425
    Language: English
    Note: 1. The basic idea -- 2. Seafloor spreading and magnetic anomalies -- 3. Fracture zones and transform faults -- 4. Subduction of oceanic lithosphere -- 5. Rigid plates of lithosphere -- 6. Tectonics of continents -- 7. From whence to whither?
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Monograph available for loan
    Monograph available for loan
    Boca Raton : CRC Press
    Call number: PIK M 032-16-89466
    Type of Medium: Monograph available for loan
    Pages: xxvii, 295 S. , graph. Darst. , 23 cm
    Edition: 2. ed.
    ISBN: 9781498715379 (pbk.) , 1498715370 (pbk.)
    Series Statement: The R series
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    Monograph available for loan
    Monograph available for loan
    Frankfurt, M. : Fischer Taschenbuch
    Call number: IASS 16.89491
    Type of Medium: Monograph available for loan
    Pages: 429 S. , 19 cm
    Edition: 2. Auflage : September 2015
    ISBN: 3596198100 , 9783596198108
    Series Statement: Fischer 19810
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Call number: PIK N 454-16-89625
    Type of Medium: Monograph available for loan
    Pages: 299 Seiten , Ill., graph. Darst., Kt.
    Series Statement: Warnsignale
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    Non-book medium
    Non-book medium
    Freiburg : Regierungspräsidium, Landesamt für Geologie, Rohstoffe und Bergbau
    Call number: NBM 16.89667
    Type of Medium: Non-book medium
    Pages: 1 DVD-ROM , 12 cm
    Language: German , English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
    Series available for loan
    Series available for loan
    Hannover : Univ.
    Call number: S 99.0139(317)
    Type of Medium: Series available for loan
    Pages: 105 S. , Ill., graph. Darst.
    Series Statement: Wissenschaftliche Arbeiten der Fachrichtung Geodäsie und Geoinformatik der Leibniz Universität Hannover 317
    Language: German
    Note: Univ., Diss.--Hannover, 2015
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 30
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 93.0602(118B)
    In: Annalen des Naturhistorischen Museums in Wien
    Type of Medium: Series available for loan
    Pages: 193 S. : Ill., graph. Darst.
    ISBN: 9783903096042
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 31
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : VS, Verl. für Sozialwiss.
    Associated volumes
    Call number: IASS 16.90102
    Description / Table of Contents: Das Handbuch Sozialwissenschaftliche Diskursanalyse stellt in Einzelbeiträgen aus unterschiedlichen Disziplinen theoretische und methodologische Grundlagen sowie exemplarische Vorgehensweisen der Diskursforschung vor. Es wendet sich an Studierende und WissenschaftlerInnen, die sich mit der Diskursanalyse vertraut machen wollen. Der erste Teilband präsentiert theoretische Grundlagen und allgemeine methodische Zugänge unterschiedlicher Ansätze der Diskursforschung. Der vorliegende Teilband 2 versammelt in 16 Einzelbeiträgen exemplarische diskursanalytische Studien aus Soziologie, Geschichts- und Politikwissenschaft, Diskursiver Psychologie, Kritischer Diskursanalyse, linguistischer Diskursgeschichte und Korpuslinguistik. Im Vordergrund stehen nicht die jeweiligen Fragestellungen der Einzeluntersuchungen, sondern der Zusammenhang von Fragestellung, empirischem Design, Detailanalyse und Formulierung des Gesamtergebnisses. Die Erläuterung des methodischen Vorgehens an Beispielen eignet sich für den Einsatz in der Lehre wie für die Orientierung in Bezug auf Planung und Durchführung eigener Forschungsprojekte.
    Type of Medium: Monograph available for loan
    Pages: 533 S. , Ill., graph. Darst.
    Edition: 4. Aufl.
    ISBN: 9783531166513 (kart.)
    Series Statement: Interdisziplinäre Diskursforschung
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Monograph available for loan
    Monograph available for loan
    Oxford : Oxford University Press
    Call number: IASS 16.90080
    Description / Table of Contents: Exploring the politics of inclusive development : towards a new conceptual approach / Sam Hickey, Kunal Sen, and Badru Bukenya -- The political determinants of economic growth : an analytical review / Kunal Sen -- The politics of what works for the poor in public expenditure and taxation / Paul Mosley -- Governing natural resources for inclusive development / Anthony Bebbington -- The politics of what works in service delivery / Claire Mcloughlin -- Political factors in the growth of social assistance / Armando Barrientos and Sony Pellissery -- The politics and process of rule of law systems in developmental states / Deval Desai and Michael Woolcock -- The gendered politics of securing inclusive development / Sohela Nazneen and Simeen Mahmud -- Ethnicity, state capacity, and development : reconsidering causal connections / Prerna Singh and Matthias vom Hau -- The politics of aid revisited : a review of evidence on state capacity and elite commitment / Arjan de Haan and Ward Warmerdam -- China in Africa : impacts and prospects for accountable development / Giles Mohan
    Type of Medium: Monograph available for loan
    Pages: XX, 396 S. , graph. Darst.
    Edition: 1. ed.
    ISBN: 9780198722564 (hbk.)
    Language: English
    Note: Exploring the politics of inclusive development : towards a new conceptual approach / Sam Hickey, Kunal Sen, and Badru BukenyaThe political determinants of economic growth : an analytical review / Kunal Sen -- The politics of what works for the poor in public expenditure and taxation / Paul Mosley -- Governing natural resources for inclusive development / Anthony Bebbington -- The politics of what works in service delivery / Claire Mcloughlin -- Political factors in the growth of social assistance / Armando Barrientos and Sony Pellissery -- The politics and process of rule of law systems in developmental states / Deval Desai and Michael Woolcock -- The gendered politics of securing inclusive development / Sohela Nazneen and Simeen Mahmud -- Ethnicity, state capacity, and development : reconsidering causal connections / Prerna Singh and Matthias vom Hau -- The politics of aid revisited : a review of evidence on state capacity and elite commitment / Arjan de Haan and Ward Warmerdam -- China in Africa : impacts and prospects for accountable development / Giles Mohan..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Monograph available for loan
    Monograph available for loan
    Boca Raton, Fla. [u.a.] : CRC Press
    Call number: 7/M 16.89782
    Description / Table of Contents: Utilizing top scientists in the wetland classification and mapping field, Remote Sensing of Wetlands: Applications and Advances covers the rapidly changing landscape of wetlands and describes the latest advances in remote sensing that have taken place over the past 30 years for use in mapping wetlands. Factoring in the impact of climate change, as well as a growing demand on wetlands for agriculture, aquaculture, forestry, and development, this text considers the challenges that wetlands pose for remote sensing and provides a thorough introduction on the use of remotely sensed data for wetland detection. Taking advantage of the experiences of more than 50 contributing authors, the book describes a variety of techniques for mapping and classifying wetlands in a multitude of environments ranging from tropical to arctic wetlands including coral reefs and submerged aquatic vegetation. The authors discuss the advantages and disadvantages of using different remote sensing techniques for wetland detection under varied conditions and circumstances. They also analyze commonly available data, reveal cost-effective methods, and offer useful insights into future trends.
    Type of Medium: Monograph available for loan
    Pages: XVII, 555 S. , Ill., graph. Darst. , 26 cm
    ISBN: 9781482237351 , 1482237350
    Language: English
    Note: SECTION 1 - INTRODUCTION TO THE USE OF REMOTE SENSING FOR WETLAND MAPPING: Wetlands: An Overview / Ralph W. Tiner --- Classification of Wetland Types for Mapping and Large-Scale Inventories / Ralph W. Tiner --- Introduction to Wetland Mapping and Its Challenges / Ralph W. Tiner --- Early Applications of Remote Sensing for Mapping Wetlands / Ralph W. Tiner --- Advances in Remotely Sensed Data and Techniques for Wetland Mapping and Monitoring / Megan W. Lang, Laura L. Bourgeau-Chavez, Ralph W. Tiner, and Victor V. Klemas --- SECTION 2 - SUMMARIES OF REMOTE SENSING TECHNOLOGIES AND THEIR APPLICATION FOR MAPPING WETLANDS: Mapping and Monitoring Surface Water and Wetlands with Synthetic Aperture Radar / Brian Brisco --- Wetland InSAR: A Review of the Technique and Applications / Shimon Wdowinski and Sang-Hoon Hong --- Radar and Optical Image Fusion and Mapping of Wetland Resources / Elijah Ramsey III and Amina Rangoonwala --- Theory and Applications of Object-Based Image Analysis and Emerging Methods in Wetland Mapping / Joseph F. Knight, Jennifer M. Corcoran, Lian P. Rampi, and Keith C. Pelletier --- Unmanned Aerial Systems and Structure from Motion Revolutionize Wetlands Mapping / Marguerite Madden, Thomas Jordan, Sergio Bernardes, David L. Cotten, Nancy O’Hare, and Alessandro Pasqua --- SECTION 3 - APPLICATIONS OF REMOTE SENSING FOR MAPPING SPECIFIC WETLAND HABITATS: Remote Sensing of Submerged Aquatic Vegetation and Coral Reefs / Sam Purkis and Chris Roelfsema --- Remote Sensing of Mangroves / Victor V. Klemas --- Tidal Marsh Classification Approaches and Future Marsh Migration Mapping Methods for Long Island Sound, Connecticut and New York / Mark Hoover and Adam Walton Whelchel --- Using Moderate-Resolution Satellite Sensors for Monitoring the Biophysical Parameters and Phenology of Tidal Marshes / Deepak R. Mishra and Shuvankar Ghosh --- Great Lakes Coastal Wetland Mapping / Laura L. Bourgeau-Chavez, Zachary M. Laubach, Anthony J. Landon, Elizabeth C. Banda, Michael J. Battaglia, Sarah L. Endres, Mary Ellen Miller, Robb D. Macleod, and Colin N. Brooks --- Mapping Wetlands and Surface Water in the Prairie Pothole Region of North America / Jennifer Rover and David M. Mushet --- Mapping the State and Dynamics of Boreal Wetlands Using Synthetic Aperture Radar / Daniel Clewley, Jane Whitcomb, Mahta Moghaddam, and Kyle McDonald --- Fusion of Multispectral Imagery and LiDAR Digital Terrain Derivatives for Ecosystem Mapping and Morphological Characterization of a Northern Peatland Complex / Antonio Difebo, Murray Richardson, and Jonathan Price --- Airborne LiDAR-Based Wetland and Permafrost-Feature Mapping on an Arctic Coastal Plain, North Slope, Alaska / Jeffrey G. Paine, John R. Andrews, Kutalmis Saylam, and Thomas A. Tremblay --- Hybrid Mapping of Pantropical Wetlands from Optical Satellite Images, Hydrology, and Geomorphology / Thomas Gumbricht --- Capturing the Dynamics of Amazonian Wetlands Using Synthetic Aperture Radar: Lessons Learned and Future Directions / Thiago Sanna Freire Silva, John Melack, Annia Susin Streher, Jefferson Ferreira-Ferreira, and Luiz Felipe de Almeida Furtado --- Mapping China’s Wetlands and Recent Changes with Remotely Sensed Data / Zhenguo Niu --- Mapping Invasive Wetland Plants / Carol A. Johnston --- Multisatellite Remote Sensing of Global Wetland Extent and Dynamics / Catherine Prigent and Fabrice Papa --- SECTION 4 - PROMISING DEVELOPMENTS AND FUTURE CHALLENGES: Promising Developments and Future Challenges for Remote Sensing of Wetlands / Megan W. Lang, Sam Purkis, Victor V. Klemas, and Ralph W. Tiner
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Call number: PIK B 405-16-90268
    Type of Medium: Monograph available for loan
    Pages: 962 Seiten , 1 CD-ROM
    Edition: 3., überarb. und aktualisierte Aufl.
    ISBN: 3766363069 , 9783766363060
    Series Statement: Formularbuch
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Monograph available for loan
    Monograph available for loan
    Cheltenham, UK [u.a.] : Edward Elgar
    Call number: PIK D 029-16-90327
    Type of Medium: Monograph available for loan
    Pages: XIII, 286 Seiten
    Edition: Paperback edition
    ISBN: 9781783479528 , 9781783479504 (hbk) , 9781783479511 (electronic)
    Series Statement: New horizons in regional science series
    Language: English
    Note: Contents: Preface ; 1. The Backdrop to EU Cohesion Policy Debates: Europe 2020 and the Post-Crisis Economy ; 2. The Regional and Urban Economies of the European Union ; 3. The Logic and Workings of EU Cohesion Policy ; 4. A Reformed EU Cohesion Policy ; 5. Innovation, Regions and the Case for Regional Innovation Policies ; 6. Smart Specialisation and European Regions ; 7. Conclusions on the Reforms to the Regional and Urban Policy in the European Union Bibliography ; Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Monograph available for loan
    Monograph available for loan
    Cheltenham : Edward Elgar Publishing
    Call number: PIK E 719-16-90324
    Description / Table of Contents: Social capital is fundamentally concerned with resources in social relations. This Handbook brings together leading scholars from around the world to address important questions on the determinants, manifestations and consequences of social capital. Various mechanisms of formal and informal social involvement, its relationship with other forms of social exclusion and its role in civic, instrumental and expressive domains of our socio-economic and community lives are explored. This unique Handbook: combines cutting-edge theory with appropriate data and methods; explores the mechanisms of formal and informal social involvement including the role of parental class and cultural influence, and the consequences for our personal and community lives; links social capital with other domains of social inequality such as cultural practice and philanthropic behaviour in an in-depth examination of the social stratification processes; conducts a thorough analysis of formal and informal social involvement, and bonding and bridging social ties on trust, tolerance, community cohesion, educational attainment, labour market position, quality of life and ethnic entrepreneurism; analyses social capital as both an outcome and as a mediating variable at the micro, meso and macro levels. Accessible yet rigorous, this Handbook presents a challenge to both social capital researchers interested in explaining social inequality and to policy-makers with responsibility for designing effective measures for combating social exclusion. It will also be essential reading for students in sociology, political science, developmental economics and management studies
    Description / Table of Contents: Social capital is fundamentally concerned with resources in social relations. This Handbook brings together leading scholars from around the world to address important questions on the determinants, manifestations and consequences of social capital. Various mechanisms of formal and informal social involvement, its relationship with other forms of social exclusion and its role in civic, instrumental and expressive domains of our socio-economic and community lives are explored. This unique Handbook: combines cutting-edge theory with appropriate data and methods; explores the mechanisms of formal and informal social involvement including the role of parental class and cultural influence, and the consequences for our personal and community lives; links social capital with other domains of social inequality such as cultural practice and philanthropic behaviour in an in-depth examination of the social stratification processes; conducts a thorough analysis of formal and informal social involvement, and bonding and bridging social ties on trust, tolerance, community cohesion, educational attainment, labour market position, quality of life and ethnic entrepreneurism; analyses social capital as both an outcome and as a mediating variable at the micro, meso and macro levels. Accessible yet rigorous, this Handbook presents a challenge to both social capital researchers interested in explaining social inequality and to policy-makers with responsibility for designing effective measures for combating social exclusion. It will also be essential reading for students in sociology, political science, developmental economics and management studies
    Type of Medium: Monograph available for loan
    Pages: xi, 409 Seiten , Illustrationen, Diagramme
    ISBN: 9780857935847 (cased) , 0857935844 (cased) , 9780857935854 (electronic; eBook) , 0857935852 (electronic; eBook)
    Series Statement: Handbooks of research methods and applications
    Language: English
    Note: 1. Social capital in sociological research : conceptual rigour and empirical application / Yaojun Li2. Social stratification, social capital and cultural practice in the UK / Yaojun Li, Mike Savage and Alan Warde -- 3. The flow of soul : a sociological study of generosity in England and Wales (2001-2011) / Yaojun Li -- 4. The roots of trust / Eric M. Uslaner -- 5. Social connectedness and generalized trust : a longitudinal perspective / Patrick Sturgis ... [et al.] -- 6. Social capital and ethnic tolerance : the opposing effects of diversity and competition / Rochelle R. Côté, Robert Andersen and Bernie H. Erickson -- 7. Diversity and social capital in the US and UK : the role of bridging friendships / David Cutts and Edward Fieldhouse -- 8. Informal, associational bonding and associational bridging : which ties matter most for minority involvement and integration? / Neli Demireva and Anthony Heath -- 9. The efficacy of neighbourhood attitudes as measures of social capital : returning to norms and values and the centrality of networks / James Laurence -- 10. The position generator approach to social capital research : measurements and results / Pieter-Paul Verhaeghe and Yaojun Li -- 11. Formal and informal social connections in the UK / Yaojun Li, Anthony Heath and Fiona Devine -- 12. Social capital and the social relations of occupational structure / Dave Griffiths and Paul S. Lambert -- 13. Social capital and life satisfaction in Australia / Xianbi Huang and Mark Western -- 14. Social capital, ethnic density and mental health among ethnic minority people in England : a mixed-methods study / Laia Bécares and James Nazroo -- 15. An intervention approach to building social capital : effects on grade retention / Jeremy Fiel, Megan Shoji, and Adam Gamoran -- 16. Social ties, agency, and change : education and social capital in adult life / John Field -- 17. Social capital in inter-organisational partnership research / Jaswinder K Dhillon. , 18. Social capital, social cohesion and cognitive attainment / Jorge Rodríguez Menés and Luisa Donato19. Institution-spanning social capital and its income returns in China / Yanjie Bian ... [et al.] -- 20. Social capital and marketization in the Chinese labour market / Wenhong Zhang and Li Zhang -- 21. Social capital in ethnic enclaves : Indians in Lloret de Mar, and Pakistanis in Barcelona / José Luis Molina ... [et al.].
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge Univ. Press
    Call number: PIK P 122-16-90300
    Description / Table of Contents: In the first decade of the twentieth century, the world witnessed tremendous upheaval in global energy markets. Oil markets were roiled by war and uprisings in the Middle East while economic expansion helped to push prices to near record (real) highs. Natural gas production in the United States was revolutionized with the emergence of new techniques for extracting shale gas. Nuclear power appeared on the verge of a dramatic expansion before its rise was cast into doubt by the tragic disaster at Fukushima. And renewable energy began to grow from a small contributor to world energy supplies into the one of largest sources of new electricity generation in many markets. Those narratives, for the most part, are well known. But one of the most important stories in modern energy markets remains largely untold and unappreciated, even as it is now reshaping the map of global energy use and the pace of climate change. That story is the story of coal's resurgence.
    Description / Table of Contents: "In the first decade of the twentieth century, the world witnessed tremendous upheaval in global energy markets. Oil markets were roiled by war and uprisings in the Middle East while economic expansion helped to push prices to near record (real) highs. Natural gas production in the United States was revolutionized with the emergence of new techniques for extracting shale gas. Nuclear power appeared on the verge of a dramatic expansion before its rise was cast into doubt by the tragic disaster at Fukushima. And renewable energy began to grow from a small contributor to world energy supplies into the one of largest sources of new electricity generation in many markets. Those narratives, for the most part, are well known. But one of the most important stories in modern energy markets remains largely untold and unappreciated, even as it is now reshaping the map of global energy use and the pace of climate change. That story is the story of coal's resurgence"--
    Type of Medium: Monograph available for loan
    Pages: XX, 702 Seiten , Diagramme
    ISBN: 9781107092426 (hardback)
    Language: English
    Note: Contents: Part I. Introduction: 1. The Asia-centric coal era Mark C. Thurber and Richard K. Morse ; Part II. Case Studies of Key Coal Countries: 2. The evolution of China's coal institutions Wuyuan Peng ; 3. Developing large coal-power bases in China Huaichuan Rui, Richard K. Morse and Gang He ; 4. The causes and implications of India's coal production shortfall Jeremy Carl ; 5. Market, investment, and policy challenges for South African coal Anton Eberhard ; 6. Australia's black coal industry: past achievements and future challenges Bart Lucarelli ; 7. Government as creator and destroyer: Indonesia's rapid rise and possible decline as steam coal supplier to Asia Bart Lucarelli ; Part III. Understanding the International Coal Trade: 8. US coal to Asia: examining the role of transportation constraints in energy markets Mark C. Thurber ; 9. The world's greatest coal arbitrage: China's coal import behavior Richard K. Morse and Gang He ; 10. The COALMOD-World model: coal markets until 2030 Franziska Holz, Clemens Haftendorn, Roman Mendelevitch and Christian Von Hirschhausen ; Part IV. The Potential of Technology to Reconcile Coal and Climate: 11. New technologies to the rescue? A review of three game changing coal technologies and their implications for Australia's black coal industry Bart Lucarelli ; 12. The real drivers of carbon capture and storage in China Richard K. Morse, Varun Rai and Gang He ; Part V. Conclusions and Implications: 13. Major factors affecting the production, trade, and environmental impact of coal Mark C. Thurber and Richard K. Morse ; Part VI. Detailed Information on the Coal Value Chain in China: Appendix. A statistical review of coal supply, demand, and transport in China Kevin Jianjun Tu ; Index.
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
    Call number: 18/M17.90454
    In: [Das Komplettpaket LPIC-1 & LPIC-2 : das gesamte Prüfungswissen, [1]
    Type of Medium: Monograph available for loan
    Pages: 547 Seiten , Illustrationen , 1 DVD-ROM , 24 cm
    Edition: 4., aktualisierte Auflage 2015, Korrigierter Nachdruck
    ISBN: 3836235277 (kart.) , 9783836235273 (kart.) , 9783836235297 ((Bundle))
    Series Statement: Rheinwerk computing
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 39
    Monograph available for loan
    Monograph available for loan
    Klein Jasedow : Drachen Verlag
    Call number: IASS 16.90552
    Type of Medium: Monograph available for loan
    Pages: 271 S , 22 cm
    Edition: Neuausgabe
    ISBN: 9783927369931
    Former Title: Vorangegangen ist ISBN:9783927369566
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
    Monograph available for loan
    Monograph available for loan
    Oberursel : Publik-Forum
    Call number: IASS 16.90554
    Type of Medium: Monograph available for loan
    Pages: 110 S.
    ISBN: 9783880952836 (Pb.)
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 41
    Monograph available for loan
    Monograph available for loan
    London : Atlantic Books
    Call number: IASS 16.90556
    Description / Table of Contents: A history that has never been told before: the story of the global search for moral truth.
    Description / Table of Contents: "In this remarkable and groundbreaking book, Kenan Malik explores the history of moral thought as it has developed over three millennia, from Homer's Greece to Mao's China, from ancient India to modern America. It tells the stories of the great philosophers, and breathes life into their ideas, while also challenging many of our most cherished moral beliefs. Engaging and provocative, The Quest for a Moral Compass confronts some of humanity's deepest questions. Where do values come from? Is God necessary for moral guidance? Are there absolute moral truths? It also brings morality down to earth, showing how, throughout history, social needs and political desires have shaped moral thinking. It is a history of the world told through the history of moral thought, and a history of moral thought that casts new light on global history. At a time of great social turbulence and moral uncertainty, there will be few histories more important than this."
    Type of Medium: Monograph available for loan
    Pages: 390 S.
    ISBN: 1848874812 , 9781848874817 , 9781782390305 (electronic)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    Monograph available for loan
    Monograph available for loan
    London [u.a.] : Routledge
    Call number: IASS 16.90560
    Type of Medium: Monograph available for loan
    Pages: viii, 164 S. , graph. Darst., Kt.
    ISBN: 9781138855991 , 1138855995
    Language: English
    Note: Introduction -- Asian Stakes and Arctic Governance -- The Northern Sea Route: Smooth Sailing Ahead? -- The Polar Code and Arctic Navigation -- Arctic: The Next Great Game in Energy Geopolitics? -- Norway's High North Policy and New Asian Stakeholders -- Russia's China Policy in the Arctic -- Russia's Strategic Concerns in the Arctic and Its Impact on Japan-Russia Relations -- The Arctic and India: Strategic Awareness and Scientific Engagement -- The Maritime Tiger: Exploring South Korea's Interests and Role in the Arctic -- The Legal Regime of the Arctic and India's Role and Options -- China's Role in Arctic Affairs in the Context of Global Governance -- Overview of Korea's Arctic Policy Development
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
    Monograph available for loan
    Monograph available for loan
    Basingstoke : Palgrave Macmillan
    Call number: IASS 16.90587
    Description / Table of Contents: "The post-Cold War Arctic has seen a transformation from military tension and a focus on national security to a concern for environmental and human security. As a result of this, the globalized Arctic has a high level of peace and stability, maintained by international cooperation between the Arctic states, northern indigenous peoples, sub-national governments and local actors. There has also been a shift from environmental protection to economic activities and, consequently, states easily trump other interests. Now, in the Arctic, these challenges require fresh thinking on a local and global scale. Regional wars, the 'war on terror', and economic crises have posed new threats to Northern security order. "--
    Type of Medium: Monograph available for loan
    Pages: xv, 141 Seiten , Illustrationen
    ISBN: 9781137468246 (hbk) , 9781137468260 (EPUB) , 9781137468253 (PDF)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 44
    Monograph available for loan
    Monograph available for loan
    London [u.a.] : Routledge
    Call number: IASS 16.90591
    Type of Medium: Monograph available for loan
    Pages: XXV, 291 Seiten , Illustrationen
    Edition: First paperback ed.
    ISBN: 9781138629271 (pbk) , 9781138783263 (hbk) , 9781315768762 (electronic; ebk)
    Series Statement: Routledge studies in environmental policy
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 91.0189 (156/1-4)
    In: Jahrbuch
    Type of Medium: Series available for loan
    Pages: 360Seiten , Illustrationen, Karten
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 46
    Series available for loan
    Series available for loan
    Berlin : EFI
    Associated volumes
    Call number: 3/S 12.0203(2017)
    In: Gutachten zu Forschung, Innovation und technologischer Leistungsfähigkeit Deutschlands
    Type of Medium: Series available for loan
    Pages: 206 Seiten , Illustrationen
    ISBN: 9783000552861
    Series Statement: Gutachten zu Forschung, Innovation und technologischer Leistungsfähigkeit Deutschlands
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 47
    Monograph available for loan
    Monograph available for loan
    Princeton and Oxford : Princeton University Press,
    Call number: M 17.90645
    Description / Table of Contents: Cover; Title; Copyright; Contents; List of Illustrations; Preface; PART ONE: What Has Controlled Earth's Climate?; CHAPTER ONE: Climate and Human History; PART TWO: Nature in Control; CHAPTER TWO: Slow Going for a Few Million Years; CHAPTER THREE: Linking Earth's Orbit to Its Climate; CHAPTER FOUR: Orbital Changes Control Ice-Age Cycles; CHAPTER FIVE: Orbital Changes Control Monsoon Cycles; CHAPTER SIX: Stirrings of Change; PART THREE: Humans Begin to Take Control; CHAPTER SEVEN: Early Agriculture and Civilization; CHAPTER EIGHT: Taking Control of Methane
    Description / Table of Contents: CHAPTER NINE: Taking Control of CO[sub(2)]CHAPTER TEN: Have We Delayed a Glaciation?; CHAPTER ELEVEN: Challenges and Responses; PART FOUR: Disease Enters the Picture; CHAPTER TWELVE: But What about Those CO[sub(2)] "Wiggles"?; CHAPTER THIRTEEN: The Horsemen of the Apocalypse: Which One?; CHAPTER FOURTEEN: Pandemics, CO[sub(2)], and Climate; PART FIVE: Humans in Control; CHAPTER FIFTEEN: Greenhouse Warming: Tortoise and Hare; CHAPTER SIXTEEN: Future Warming: Large or Small?; CHAPTER SEVENTEEN: From the Past into the Distant Future; EPILOGUE; CHAPTER EIGHTEEN: Global-Change Science and Politics
    Description / Table of Contents: CHAPTER NINETEEN: Consuming Earth's GiftsAfterword to the Princeton Science Library Edition; Bibliography; Figure Sources; Index; A; B; C; D; E; F; G; H; I; K; L; M; N; O; P; R; S; T; U; V; W; Y
    Description / Table of Contents: The impact on climate from 200 years of industrial development is an everyday fact of life, but did humankind''s active involvement in climate change really begin with the industrial revolution, as commonly believed? Plows, Plagues, and Petroleum has sparked lively scientific debate since it was first published--arguing that humans have actually been changing the climate for some 8,000 years--as a result of the earlier discovery of agriculture. The ""Ruddiman Hypothesis"" will spark intense debate. We learn that the impact of farming on greenhouse-gas levels, thousands of years before the i
    Type of Medium: Monograph available for loan
    Pages: xiv, 226 Seiten , Illustrationen
    Edition: New Princeton Science Library edition
    ISBN: 9780691173214
    Series Statement: Princeton Science Library
    Classification:
    Meteorology and Climatology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    Monograph available for loan
    Monograph available for loan
    Hoboken, N.J : John Wiley & Sons
    Call number: IASS 16.90733
    Type of Medium: Monograph available for loan
    Pages: XXVI, 262 S. , Ill.
    ISBN: 9780470601785 (pbk) , 9780470901045 (ebk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    Series available for loan
    Series available for loan
    Copenhagen : Geological Survey of Denmark and Greenland, Ministry of energy, utilities and climate
    Call number: S 04.0048(33)
    Type of Medium: Series available for loan
    Pages: 88 Seiten , Illustrationen, Diagrammen, Karten
    ISBN: 9788778714046 , 9788787714053 (electronic)
    Series Statement: Geological Survey of Denmark and Greenland bulletin 33
    Language: English
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    Series available for loan
    Series available for loan
    Copenhagen : Geological Survey of Denmark and Greenland, Ministry of Energy, Utilities and Climate
    Call number: S 04.0048(34)
    Type of Medium: Series available for loan
    Pages: 148 Seiten , Illustrationen, Diagramme, Karten , 28 cm
    ISBN: 9788778714275 , 8778714273 , 9788778714282 (electronic)
    Series Statement: Geological survey of Denmark and Greenland bulletin 34
    Language: English
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
    Call number: IASS 17.90744
    Type of Medium: Monograph available for loan
    Pages: 260 S.
    Edition: 5. Aufl.
    ISBN: 9783878631910
    Series Statement: Schriftenreihe des dbb Bd. 132
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 52
    Monograph available for loan
    Monograph available for loan
    Essen : STAMM Verl.
    Associated volumes
    Call number: 2017/1
    In: Stamm
    Type of Medium: Monograph available for loan
    Edition: 70. Ausgabe
    ISBN: 978-3-87773-053-1
    Series Statement: Stamm
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 53
    Monograph available for loan
    Monograph available for loan
    Frankfurt/Main : Westend
    Call number: PIK B 110-17-90829
    Description / Table of Contents: ... Taschenbuchausgabe des Titels von 2012 (ID-B 47/12) mit einem kurzen aktuellen Vorwort. Die "umfassende, grossenteils anspruchsvolle, ziemlich einmalige Darstellung der erschreckenden Wirklichkeit über ca. 1.200 Milliardäre und ihr unkontrollierbares privates Imperium der Machtausübung" zeigt, wo "überall Gelder verborgen sein können, wie schnell und in welchen Ländern die Zahl der Super-Reichen anwächst, dass auch in Militärdiktaturen und Waffensysteme (sogar zum Selbstschutz) investiert wird, dass Korruption, Kriminalität, Einfluss auf die Politik dazugehören, die Typologie des Kapitalismus ungültig wird und Reformen wenig Chancen haben" (Elke Günther). Mit Register und Anmerkungen. Angesichts der breiten aktuellen Diskussion über wirtschaftliche und soziale Ungleichheit in unserer Welt sollten Bibliotheken diesen Titel spätestens jetzt anbieten. (2)
    Type of Medium: Monograph available for loan
    Pages: 286 Seiten , Illustrationen, Diagramme, Karten , 215 mm x 135 mm
    Edition: Komplett überarbeitete Neuausgabe
    ISBN: 386489090X , 9783864890901
    Language: German
    Note: Contents: Prolog: Eat the rich (1999) ; 1 Ein weites Feld ; 2 Die Aneignung Europas ; 3 Das private Imperium ; 4 Milliardäre ; 5 Varianten des Kapitalismus ; 6 Können Milliardäre das Kapital überwinden? ; Epilog: Avanti Dilettanti (2029)
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
    Call number: PIK B 811-17-90832/1
    In: 2
    Type of Medium: Monograph available for loan
    Pages: 383 Seiten + , Illustrationen, Diagramme , 1 DVD-ROM
    Edition: 1. Auflage, 2. Druck
    ISBN: 9783464461020
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 55
    Monograph available for loan
    Monograph available for loan
    Bonn : Gemeinsame Wissenschaftskonferenz (GWK)
    Call number: PIK A 130-17-90903
    Type of Medium: Monograph available for loan
    Pages: 223 Seiten
    ISBN: 9783942342414
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 56
    Monograph available for loan
    Monograph available for loan
    London : Routledge
    Call number: PIK N 454-17-90902
    Type of Medium: Monograph available for loan
    Pages: XI, 452 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9781444104882 , 1444104888
    Language: English
    Note: Contents: 1. A looming crisis Part I Status and challenges 2. Rising demand and dwindling per capita resources 3. Water and poverty 4. Governance and finance 5. Pollution and water-related disease 6. Water, land and wildlife 7. Dams and diversions 8. Trading water - real and virtual 9. Water, war and terrorism 10. The threat of global warming Part II Nature's resources 11. The restless water cycle 12. Shrinking freshwater stores Part III Towards sustainability 13. Cutting demand 14. Increasing supplies 15. Cleaning up and protecting the aquatic environment 16. Using seawater 17. Controlling the weather 18. Improved monitoring and data management 19. Improving prediction and risk assessment 20. Improving management and justice 21. Aid for the developing world Conclusions 22. Is sustainability achievable?
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
    Monograph available for loan
    Monograph available for loan
    Washington, D. C. : Center for Global Development
    Call number: PIK W 511-17-90845
    Description / Table of Contents: Tropical forests are an undervalued asset in meeting the greatest global challenges of our time-averting climate change and promoting development. Despite their importance, tropical forests and their ecosystems are being destroyed at a high and increasing rate in most forest-rich countries. The good news is that science, economics, and politics are aligned to support a major international effort over the next five years to reverse tropical deforestation. Why Forests? Why Now? synthesizes the latest evidence on the importance of tropical forests in a way that is accessible to anyone interested in climate change and development and to readers already familiar with the problem of deforestation. It makes the case to decision makers in rich countries that rewarding developing countries for protecting their forests is urgent, affordable, and achievable
    Type of Medium: Monograph available for loan
    Pages: XV, 429 Seiten , Illustrationen, Diagramme
    ISBN: 9781933286853 (print)
    Language: English
    Note: Contents: 1. Introduction ; 2. Tropical forests ; 3. Tropical forests and development ; 4. Monitoring tropical forests ; 5. Cheaper, cooler, faster ; 6. Making forests worth more alive than dead ; 7. How to stop deforestation ; 8. Global consumer demand ; 9. The international politics of deforestation and climate change ; 10. Forest politics in developing countries ; 11. The politics of REDD+ in rich countries ; 12. Finance for tropical forests ; 13. Conclusion
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 58
    Monograph available for loan
    Cambridge, United Kingdom : Cambridge University Press
    Call number: AWI A2-17-90931
    Description / Table of Contents: Climate change is one of the greatest threats facing humanity; a definitive manifestation of the well-worn links between progress and devastation. This book explores the complex relationship that the corporate world has with climate change, and examines the central role of corporations in shaping political and social responses to the climate crisis. The book's principal message is that despite the need for dramatic economic and political change, corporate capitalism continues to rely upon the maintenance of 'business as usual'. The authors explore the different processes through which corporations engage with climate change. Key discussion points include climate change as business risk; corporate climate politics; the role of justification and compromise; and managerial identity and emotional reactions to climate change. Written for researchers and graduate students, this book moves beyond descriptive and normative approaches to provide a sociologically and critically informed theory of corporate responses to climate change.
    Type of Medium: Monograph available for loan
    Pages: XIII, 254 Seiten , Diagramm , 23 cm
    Edition: 1st published 2015, Reprinted 2016
    ISBN: 9781107435131 (paperback) , 9781107078222 (hardback)
    URL: Cover
    Language: English
    Note: Contents: List of figures. - List of tables. - Foreword by Clive Hamilton. - Acknowledgements. - 1. Climate change and corporate capitalism. - 2. Creative self-destruction and the incorporation of critique. - 3. Climate change and the corporate construction of risk. - 4. Corporate political activity and climate coalitions. - 5. Justification, compromise, and corruption. - 6. Climate change, managerial identity and narrating the self. - 7. Emotions, corporate environmentalism and climate change. - 8. Political myths and pathways forward. - 9. Imagining alternatives. - Appendix. - References. - Index.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 59
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 93.0602(119B)
    In: Annalen des Naturhistorischen Museums in Wien
    Type of Medium: Series available for loan
    Pages: 260 Seiten , Illustrationen
    ISBN: 9783903096158
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
    Call number: M 17.90685
    Type of Medium: Monograph available for loan
    Pages: 80 Seiten , Illustrationen ; Karten
    Edition: 4. verbesserte Auflage
    ISBN: 9783853160800
    Classification:
    Geology
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 61
    Monograph available for loan
    Monograph available for loan
    New York, NY : Cambridge Univ. Press
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 62
    Monograph available for loan
    Monograph available for loan
    Cheltenham, UK : Edward Elgar Publishing
    Call number: IASS 16.90625
    Type of Medium: Monograph available for loan
    Pages: xxx, 602 Seiten
    ISBN: 9781783470594 ((hbk.) £180.00) , 9781783470600 (ebook)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: IASS 16.90627
    Type of Medium: Monograph available for loan
    Pages: IX, 508 Seiten , Illustrationen
    Edition: 3. Auflage
    ISBN: 353119674X , 9783531196749 , 9783531196756 (electronic)
    Series Statement: Lehrbuch
    Parallel Title: Online-Ausg. Häder, Michael: Empirische Sozialforschung
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
    Call number: S 90.0066(162,1)
    In: Geologisches Jahrbuch / A
    Type of Medium: Series available for loan
    Pages: 261 Seiten , Ill., 1 DVD-ROM (12 cm) und 1 Tafel-Beil. ([2] S.)
    ISBN: 9783510968534
    Series Statement: Geologisches Jahrbuch 162
    Classification:
    Engineering Geophysics
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 65
    Monograph available for loan
    Monograph available for loan
    Cambridge : Benson/B4FA
    Call number: PIK W 100-17-90860
    Type of Medium: Monograph available for loan
    Pages: 144 Seiten , Diagramme
    ISBN: 9780993293238
    Language: English
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Call number: M 17.90783
    Type of Medium: Monograph available for loan
    Pages: 358 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9785020384132
    Language: Russian
    Note: Zusammenfassung, Einführung und Inhaltsverzeichnis auch in engl. Sprache
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    Monograph available for loan
    Monograph available for loan
    Les Ulis Cedex A, France : European Cooperation in Science and Technology ; EDP Sciences ; Tosca
    Call number: M 17.90785
    Type of Medium: Monograph available for loan
    Pages: XIII, 345 Seiten , Illustrationen, Diagramme, Karten , 24 cm
    ISBN: 9782759817337
    Classification:
    Meteorology and Climatology
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Call number: IASS 17.91169
    Type of Medium: Monograph available for loan
    Pages: XXVI, 246 S. , Ill., graph. Darst., Kt
    Edition: first paperback
    ISBN: 9781138967038 (pbk) , 9781844078486 (hbk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    Monograph available for loan
    Tokyo : Springer Japan
    Call number: M 17.90963
    Description / Table of Contents: This book on multiscale seismic tomography, written by one of the leaders in the field, is suitable for undergraduate and graduate students, researchers, and professionals in Earth and planetary sciences who need to broaden their horizons about seismotectonics, volcanism, and interior structure and dynamics of the Earth and Moon. It describes the state-of-the-art in seismic tomography, with emphasis on the new findings obtained by applying tomographic methods in local, regional, and global scales for understanding the generating mechanism of large and great earthquakes such as the 2011 Tohoku-oki earthquake (Mw 9.0), crustal and upper mantle structure, origin of active arc volcanoes and intraplate volcanoes including hotspots, heterogeneous structure of subduction zones, fate of subducting slabs, origin of mantle plumes, mantle convection, and deep Earth dynamics. The first lunar tomography and its implications for the mechanism of deep moonquakes and lunar evolution are also introduced
    Type of Medium: Monograph available for loan
    Pages: XV, 304 p. 146 illus., 117 illus. in color
    ISBN: 9784431553595 , 9784431553601 (ebook)
    Series Statement: Springer Geophysics
    URL: Cover
    Language: English
    Note: IntroductionMethodology of Seismic Tomography -- Subduction Zone Tomography -- Large Earthquakes and Seismotectonics -- Hotspots and Mantle Plumes -- East Asia Structure and Tectonics -- Global Tomography and Deep Earth dynamics -- Seismic Tomography of the Moon..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Call number: 3/S 07.0034(2016)
    In: Annual report
    Type of Medium: Monograph available for loan
    Pages: 51 Seiten
    ISSN: 1865-6439 , 1865-6447
    Parallel Title: Erscheint auch als Annual report ... / Helmholtz Association of German Research Centres
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: PIK P 040-18-91409
    Type of Medium: Monograph available for loan
    Pages: xxv, 782 Seiten , Diagramme
    Edition: 2nd edition
    ISBN: 9781107069978 , 9781107687899
    Language: English
    Note: Contents: Part I. Getting Started: 1. What is 'Markets and Strategies'? ; 2. Firms, consumers and the market ; Part II. Market Power: 3. Static imperfect competition ; 4. Dynamic aspects of imperfect competition ; Part III. Sources of Market Power: 5. Product differentiation ; 6. Advertising and related market strategies ; 7. Consumer inertia ; Part IV. Pricing Strategies and Market Segmentation: 8. Group pricing and personalized pricing ; 9. Menu pricing ; 10. Intertemporal price discrimination ; 11. Bundling ; Part V. Product Quality and Information: 12. Asymmetric information, price and advertising signals ; 13. Marketing tools for experience goods ; Part VI. Theory of Competition Policy: 14. Cartels and tacit collusion ; 15. Horizontal mergers ; 16. Strategic incumbents and entry ; 17. Vertically related markets ; Part VII. R&D and Intellectual Property: 18. Innovation and R&D ; 19. Intellectual property ; Part VIII. Networks, Standards and Systems: 20. Markets with network goods ; 21. Strategies for network goods ; Part IX. Market Intermediation: 22. Markets with intermediated goods ; 23. Information and reputation in intermediated product markets ; Appendix A. Game theory ; Appendix B. Competition policy
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    Series available for loan
    Series available for loan
    Berlin : EFI
    Associated volumes
    Call number: 3/S 12.0203(2018)
    In: Gutachten zu Forschung, Innovation und technologischer Leistungsfähigkeit Deutschlands
    Type of Medium: Series available for loan
    Pages: 163 Seiten , Illustrationen
    ISBN: 9783981946802
    Series Statement: Gutachten zu Forschung, Innovation und technologischer Leistungsfähigkeit Deutschlands
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: IASS 17.91222
    Type of Medium: Monograph available for loan
    Pages: 506 Seiten , Diagramme , 22 cm
    ISBN: 3658059443 (Pb.) , 9783658059446 (Pb.) , 9783658059453 (electronic)
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 74
    Monograph available for loan
    Monograph available for loan
    Redmond, Washington : Microsoft
    Call number: 18/M 18.91559
    Type of Medium: Monograph available for loan
    Pages: XIX, 555 Seiten , Illustrationen, Diagramme (farbig)
    Edition: First Printing
    ISBN: 9780735697805
    Series Statement: Step by step
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Call number: IASS 18.91429
    Type of Medium: Monograph available for loan
    Pages: 264 Seiten , Illustrationen , 23 cm
    ISBN: 3837632989 , 9783837632989 , 9783839432983 (electronic)
    Series Statement: Science Studies
    Parallel Title: Online-Ausg. Die Responsivität der Wissenschaft
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    Call number: AWI P5-18-91710
    Type of Medium: Monograph available for loan
    Pages: 24 S. , Ill.
    Edition: Stand: September 2015
    Language: German
    Note: Inhaltsverzeichnis: Vorwort. - Einleitung. - 1. Strategische Ziele der Arktisforschung. - 2. Die zentralen Fragen der Arktisforschung. - 2.1. Vergangenheit, Gegenwart und Zukunft des Klimawandels in der Arktis. - 2.2. Beitrag des grönländischen Inlandeises zur Meeresspiegelerhöhung. - 2.3. Rückgang des arktischen Meereises. - 2.4. Permafrost und Gashydrate als unbekannte Größen im Klimasystem. - 2.5. Anpassung polarer Organismen an die arktische Umwelt im Wandel. - 2.6. Chancen und Risiken zunehmender wirtschaftlicher Nutzung der Arktis. - 3. Stand der deutschen Polarforschung. - 3.1. Partner der deutschen Arktisforschung. - 3.2. Regionale Schwerpunkte der deutschen Arktisforschung. - 3.3. Positionierung im internationalen Umfeld. - 4. Umsetzung der Arktisforschungsstrategie. - 4.1. Forschung für Nachhaltigkeit. - 4.2. Wissenstransfer in die Gesellschaft. - 4.3. Technologietransfer. - 4.4. Nachwuchsförderung. - Anmerkungen. - Impressum.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Monograph available for loan
    Monograph available for loan
    New York, NY [u.a.] : Palgrave Macmillan
    Call number: PIK N 076-18-91759
    Type of Medium: Monograph available for loan
    Pages: XVI, 197 Seiten , Illustrationen, Diagramme
    ISBN: 9781137485991
    Language: English
    Note: Contents: (Dis)ability and (Dis)aster -- Disability and disaster : an overview -- Inclusive emergency management for people with disabilities facing disaster -- One (mis-)step from (personal) disaster : being blind -- One should remain calm -- Failure and hope : living or not with disability after the 2001 Gujarat earthquake -- Resilience : just for the resilient? -- Educating first responders about Asperger's syndrome -- Fighting to restart -- No matter what happened, I have survived -- Migraines and atmospheric conditions -- Don't let me burn! -- If you people would just prepare! -- Inclusive risk management -- Terrorism and displacement in Kenya -- Maintaining social contact for disaster preparedness -- Disasters for people with disabilities in the Cook Islands -- A disaster-free life - a lot of luck and happiness -- Lightness or darkness? -- The water is rushing in -- Of bodybuilders and wheelchairs -- My sister -- Wheels on the ground : lessons learned and lessons to learn -- Help us to get it right -- Exploring and exchanging (dis)ability and (Dis)aster
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    Monograph available for loan
    Monograph available for loan
    Chicago : The University of Chicago Press
    Call number: IASS 18.91768
    Type of Medium: Monograph available for loan
    Pages: xiv, 217 Seiten
    ISBN: 9780226241364 , 9780226241227 , 9780226241531 (electronic)
    Language: English
    Note: New citizens, new societies: new sciences, new philosophies?Objectivity for sciences from below -- Women, gender, development: maximally objective research? -- Do Micronesian navigators practice science? -- Pluralism, multiplicity, and the disunity of sciences -- Must sciences be secular? -- After Mr. Nowhere: new proper scientific selves..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
    Monograph available for loan
    Monograph available for loan
    Minneapolis [u.a.] : Univ. of Minnesota Press
    Call number: IASS 18.91835
    Type of Medium: Monograph available for loan
    Pages: VIII, 299 S. , 22x14x2 cm
    ISBN: 9780816656875 , 9780816656868 , 0816656878
    Series Statement: Posthumanities 9
    Uniform Title: Cosmopolitiques 〈engl.〉
    Language: English
    Note: Aus dem Franz. übers.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 80
    Monograph available for loan
    Monograph available for loan
    New York ; London : Routledge, Taylor & Francis Group
    Call number: IASS 18.91966
    Type of Medium: Monograph available for loan
    Pages: xii, 239 Seiten
    Edition: First issued in paperback
    ISBN: 9780415991230 , 9780415888356
    Series Statement: Routledge critical studies in discourse 1
    Language: English
    Note: Includes bibliographical references and index
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 93.0602(121B)
    In: Annalen des Naturhistorischen Museums in Wien
    Type of Medium: Series available for loan
    Pages: 312 Seiten , Illustrationen
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Monograph available for loan
    Monograph available for loan
    Berlin : Springer Gabler
    Call number: PIK B 100-19-92106
    Type of Medium: Monograph available for loan
    Pages: XI, 269 Seiten , Diagramme , 24.0 cm x 16.8 cm
    ISBN: 3662441551 , 9783662441558 , 9783662441565 (electronic)
    Series Statement: Lehrbuch
    Language: German
    Note: Contents: 1 Theorie des Allgemeinen Gleichgewichts ; 2 Intertemporale Konsumnachfrage ; 3 Das Ramsey-Modell ; 4 Erweiterungen des Ramsey-Modells ; 5 Wachstum ; 6 Konjunkturelle Schwankungen ; 7 Geld und Inflation im Ramsey-Modell ; 8 Das Neukeynesianische Modell
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : VS, Verlag für Sozialwissenschaften
    Call number: PIK D 029-19-92804
    Type of Medium: Monograph available for loan
    Pages: 561 Seiten , Diagramme
    Edition: 2., überarbeitete und erweiterte Auflage
    ISBN: 9783531172019 (geb.) , 9783531145594 (pbk.)
    Series Statement: Lehrbuch
    Language: German
    Note: Contents: Einleitung ; I Theorie ; 1 Typologie politischer Systeme ; 2 Die Stabilität politischer Systeme ; 3 Transformationsbegriffe ; 4 Transformationstheorien ; 5 Massen und Eliten in der Transformation ; 6 Transformationsphasen ; II Die Demokratisierungswellen des 20. Jahrhunderts ; 1 Die erste Demokratisierungswelle: Die Entstehung von Demokratien ; 2 Die erste autokratische Gegenwelle: Der Zusammenbruch von Demokratien ; 3 Die zweite Demokratisierungswelle: Die Nachkriegsdemokratien in Deutschland, Italien und Japan ; III Die Dritte Demokratisierungswelle: Südeuropa ; 1 Die Demokratisierung in Südeuropa ; IV Die dritte Demokratisierungswelle: Lateinamerika ; 1 Typen autoritärer Regime ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung ; 5 Fazit und Ausblick ; V Die dritte Demokratisierungswelle: Ost- und Südostasien ; 1 Typen autoritärer Regime ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung ; 5 Fazit: Die Konsolidierung im Vergleich ; 6 Gibt es eine "asiatische Form" der Demokratie? ; VI Die dritte Demokratisierungswelle: Osteuropa ; 1 Die besondere Transformationsproblematik in Osteuropa ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung: Ungarn, Polen, Russland und Belarus im Vergleich ; VII Externe Demokratisierung ; 1 Demokratieförderung ; 2 Demokratisierung "durch" Krieg? ; Ausblick: Kehren die Diktaturen zurück? ; 1 Theoretische Paradigmen und empirische Artefakte ; Gegenwartsdiagnose ; Zukunftsprognose
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Monograph available for loan
    Monograph available for loan
    Berlin : VDE Verlag GmbH
    Call number: IASS 19.93028
    Type of Medium: Monograph available for loan
    Pages: XXI, 441 Seiten , graphische Darstellungen , 1 CD-ROM (12 cm) , 24 cm
    Edition: 4., revised edition
    ISBN: 9783800732425 (kart.)
    Uniform Title: OPC 〈engl.〉
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Type of Medium: 12
    Pages: 200 S. , Ill., graph. Darst. , 30 cm
    Edition: Edition 1.0, 2015-02
    ISBN: 9782832222263 (pbk.)
    Series Statement: Wind turbines : international standard = Eoliennes / International Electrotechnical Commission ; Pt. 27-1
    Language: English , French
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    Call number: PIK N 071-20-93404
    Type of Medium: Monograph available for loan
    Pages: XVIII, 290 Seiten , Diagramme
    ISBN: 9781138225909
    Series Statement: Routledge research in global environmental governance
    Language: English
    Note: The argument : how negotiation management alters multilateral cooperation -- The fall and rise of climate negotiations : from copenhagen to Cancún -- Negotiation management during the Danish and Mexican presidencies -- Explanations of climate outcomes beyond negotiation management -- Trade negotiations : the bedevilled launch of the doha development agenda -- Biosafety negotiations : the rocky path to the cartagena protocol -- Conclusion..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Call number: IASS 20.93621
    Description / Table of Contents: The Global Redesign Initiative was a global, multistakeholder dialogue on the future of international cooperation. Set up in the midst of the global financial crisis, its purpose was to stimulate thinking and debate about how the international community and its institutions and organizations in their widest sense can be adapted to contemporary challenges. The distillation of this process has helped the Forum's many communities to develop proposals that seek to highlight potential responses to the challenge of adapting to a new global business and social environment.
    Type of Medium: Monograph available for loan
    Pages: 452 Seiten , Illustrationen
    ISBN: 978-92-95044-92-4
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Call number: AWI G5-20-93987
    Type of Medium: Dissertations
    Pages: XVI, 91 Seiten , Illustrationen
    Language: English
    Note: Dissertation, Universität Potsdam, 2015 , Table of Contents Acknowledgements Abstract Zusammenfassung List of figures and tables List of Abbreviations 1. Introduction 1.1. Preface and thesis organization 1.2. Research motivation and relevance 1.3. Background knowledge 1.3.1. Terrigenous sediments 1.3.2. Hala Lake 1.3.3. The North Pacific 1.3.4. The Bering Sea 1.4. Aims and objectives 1.5. Methodological overview 1.5.1. Fieldwork 1.5.2. Age-depth modeling 1.5.3. Key proxies: grain size and clay minerals 1.5.4. Supplementary methodology: remote sensing, seismic sub-bottom profiling and geochemistry 1.6. Overview and status of the manuscripts 2 Manuscript 1 : Linkages between Quaternary climate change and sedimentary processes in Hala Lake, northern Tibetan Plateau, China Abstract 2.1. Introduction 2.2. Regional setting 2.3. Materials and methods 2.3.1. Remote sensing of the study area 2.3.2. Fieldwork 2.3.3. Radiocarbon dating of recovered sediment cores 2.3.4. Laboratory work 2.3.5. Statistical data treatment 2.4. Results and interpretation 2.4.1. Remote sensing on the spatial heterogeneity of lake ice and length of lake ice-free days 2.4.2. Seismic sub-bottom profiling 2.4.3. Age and sedimentary characteristics of the sediment core record 2.4.4. Grain-size modeling results 2.5. Discussion 2.5.1. Last Glacial Maximum (~24-17 cal. ka BP) 2.5.2. Time-equivalent of Heinrich Event 1 (~17-15.4 cal. ka BP) 2.5.3. Time-equivalent of Bolling-Allerod (~15.4-13 cal. ka BP) 2.5.4. Time-equivalent of Younger Dryas (~12.9-11.6 cal. ka BP) 2.5.5. Holocene (~11.6 cal. ka BP to present) 2.6. Conclusions Acknowledgments 3 Manuscript 2: Modern modes of provenance and dispersal of terrigenous sediments in the North Pacific and the Bering Sea: Implications and perspectives for palaeoenvironmental reconstructions Abstract 3.1. Introduction 3.2. Study area and regional setting 3.3. Material and methods 3.4. Results 3.4.1. Grain size distribution 3.4.2 Bulk mineralogy 3.4.3. Mineralogy of the clay fraction 3.5. Discussion 3.5.1. Sedimentary processes 3.5.2. Sediment provenance 3.5.3 Implications for palaeoenvironmental studies 3.6. Conclusions Acknowledgements 4 Manuscript 3: Provenance and dispersal of terrigenous sediments in the Bering Sea slope: Implications for late glacial land-ocean linkages Abstract 4.1. Introduction 4.2. Regional setting 4.3. Material and methods 4.4. Results and interpretation 4.4.1. Lithology and stratigraphy 4.4.2. Grain size distribution 4.4.3. Clay mineralogy 4.5. Discussion 4.5.1. Processes of terrigenous sediment supply 4.5.2. Detrital sediment sources 4.5.3. Detrital sediment supply and its relation to regionalpalaeoenvironmental changes 4.5.3.1. Time interval 32-15.7 ka BP: Background sedimentation at low sea level 4.5.3.2. Time interval 15.7-14.5 ka BP: Regional Meltwater Pulse 4.5.3.3. Time interval 14.5-12.9 ka BP: First biological bloom event 4.5.3.4. Time interval 12.9-6 ka BP: Cooling episode, rejuvenation of biological productivity and onset ofmodern conditions 4.5.4. Palaeoenvironmental implications 4.6. Conclusions Acknowledgements 5 Synthesis 5.1. The North Hemisphere synchronization of millennial climate oscillations during the last Glacial: teleconnections from Westerlies and thermohaline Circulation 5.2. The regional asynchronization of millennial climate oscillations during the last Glacial: discrepancy and "recording capacity" 5.3. Secondary connections between global climate transmissions: winter cyclone in the North Pacific 5.4. Future perspectives 6 References 7 Appendix Extended results: Core SO202-39-3 from the mid-latitude North Pacific 7.1. Material 7.2. Results 7.3. Oscillation of eolian sediment transport 7.4. Conclusions
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Call number: IASS 15.89494
    Type of Medium: Monograph available for loan
    Pages: Losebl.-Ausg.
    Edition: Stand: Oktober 2010
    ISBN: 9783768501828
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Series available for loan
    Series available for loan
    Freising : Zentrum Wald-Forst-Holz Weihenstephan
    Associated volumes
    Call number: ZS-064(213)
    In: Forstliche Forschungsberichte München
    Description / Table of Contents: Literaturverz. S. 131 - 138
    Type of Medium: Series available for loan
    Pages: 143 S. , graph. Darst., Tab., Kt.
    ISBN: 3933506441
    Series Statement: Forstliche Forschungsberichte München 213
    Classification:
    Soils
    Language: German , English
    Note: Zs.fassung in dt. und engl. Sprache
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Monograph available for loan
    Monograph available for loan
    München : Hanser
    Call number: M 15.89302
    Type of Medium: Monograph available for loan
    Pages: 992 S. , Ill., graph. Darst.
    Edition: 4., überarb. und erw. Aufl.
    ISBN: 9783446443464 , 9783446444041 (electr.; ebk)
    Classification:
    Informatik
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    Monograph available for loan
    Monograph available for loan
    Wallingford [u.a.] : CAB International
    Call number: PIK N 076-16-89478
    Type of Medium: Monograph available for loan
    Pages: XII, 279 S. , Ill., graph. Darst.
    ISBN: 9781780643786 (hbk : alk. paper)
    Series Statement: CABI climate change series 7
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Call number: M 15.89484
    Type of Medium: Monograph available for loan
    Pages: 281 S. , Ill., graph. Darst. Kt. Tab.
    ISBN: 9783941971110
    Series Statement: Forschung und Monitoring Bd. 4
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : VS, Verl. für Sozialwiss.
    Call number: IASS 15.89929
    Type of Medium: Monograph available for loan
    Edition: 3., aktualisierte Aufl.
    ISBN: 9783531166612
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    Monograph available for loan
    Monograph available for loan
    Amsterdam : Elsevier
    Call number: 20-3/M 15.24561
    Description / Table of Contents: provides a summary of Critical Zone research and outcomes from the NSF funded Critical Zone Observatories, providing a process-based description of the Critical Zone in a wide range of environments with a specific focus on the important linkages that exist amongst the processes in each zone.
    Type of Medium: Monograph available for loan
    Pages: xxiii, 649 S. , IIll.
    ISBN: 9780444633699
    Series Statement: Developments in aarth surface processes 19
    Classification:
    Soils
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Monograph available for loan
    Monograph available for loan
    Basingstroke, Hampshire [u.a.] : Palgrave Macmillan
    Call number: IASS 15.89607
    Type of Medium: Monograph available for loan
    Pages: XXII, 347 S. , graph. Darst.
    ISBN: 9780230277014 , 9781403996282
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    Monograph available for loan
    Monograph available for loan
    Paris : OECD
    Call number: PIK W 101-16-89599
    Description / Table of Contents: This annual publication provides information on policy developments and related support to agriculture in OECD countries and selected partner economies, measured with the OECD Producer Support Estimate methodology. Countries covered represent about 80% of the global value added in agriculture. The report includes a general discussion on developments in agricultural policies and specific chapters for each country covered
    Description / Table of Contents: This annual publication provides information on policy developments and related support to agriculture in OECD countries and selected partner economies, measured with the OECD Producer Support Estimate methodology. Countries covered represent about 80% of the global value added in agriculture. The report includes a general discussion on developments in agricultural policies and specific chapters for each country covered.
    Type of Medium: Monograph available for loan
    Pages: 293 S. , graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9789264234529
    Language: English
    Note: Foreword; Acknowledgements; Table of contents; Reader's guide; Definition of OECD indicators of agricultural support; Nominal indicators used in this report; Ratio indicators and percentage indicators; Box 1. Definitions of categories in the PSE classification; Decomposition indicators; Definition of GSSE categories; Sources and definitions of contextual indicators; Table X.1. Contextual indicators; Box 2. Definitions of categories in the GSSE classification; Figure X.2. Main macroeconomic indicators; Figure X.3. Agro-food trade; OECD indicators of support; Currencies. , List of acronyms and abbreviationsExecutive summary; Recommendations; Chapter 1. Developments in agricultural policy and support; Key economic and market developments; Table 1.1. Key economic indicators; Figure 1.1. Commodity world price indices, 2007 to 2014; Main features of agricultural policies; Box 1.1. Agriculture and COP21; Box 1.2. Developments post the 2013 Bali WTO Ministerial; Developments in agricultural support; Countries' importance in global agriculture has changed since the mid-1990s - and so has their role in supporting agriculture. , Figure 1.2. Country shares in total agricultural GDP and in total TSE, 1995-97 and 2012-14Total monetary transfers to the agricultural sector were stable in some countries, but increased significantly in others; Figure 1.3. Evolution of Total Support Estimate, 1995-97 to 2012-14; However the relative cost of agricultural support for the economies has decreased significantly over time in most of the countries; Figure 1.4. Total Support Estimate by country, 1995-97 and 2012-14. , The total agricultural support is dominated by support to agricultural producers, while expenditures on key general services to the sector are relatively smallFigure 1.5. Composition of Total Support Estimate by country, 2012-14; Average support to agricultural producers in OECD countries and emerging economies is converging; Figure 1.6. Evolution of Producer Support Estimate, 1995 to 2014; However short- and long-term changes across individual countries remain very uneven; Figure 1.7. Producer Support Estimate by country, 2013 and 2014. , Box 1.3. What drove changes in the monetary value of producer support in 2014?Figure 1.8. Contribution of various factors to the change in the Producer Support Estimate in 2014; Box 1.3. What drove changes in the monetary value of producer support in 2014? (cont.); Figure 1.9. Evolution of producer support at different stages of economic development, 1986 to 2013; Figure 1.10. Producer Support Estimate by country, 1995-97 and 2012-14; Differences in policy approaches are also reflected in policy instruments; Figure 1.11. Composition of Producer Support Estimate by country, 2012-14. , Figure 1.12. Composition of payments based on area, animal numbers, receipts and income by country, 1995-97 and 2012-14.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Monograph available for loan
    Monograph available for loan
    Cham [u.a.] : Springer
    Call number: PIK N 076-16-89604
    Description / Table of Contents: The book outlines principal milestones in the evolution of the atmosphere, oceans and biosphere during the last 4 million years in relation with the evolution from primates to the genus Homo - which uniquely mastered the ignition and transfer of fire. The advent of land plants since about 420 million years ago ensued in flammable carbon-rich biosphere interfaced with an oxygen-rich atmosphere. Born on a flammable Earth surface, under increasingly unstable climates descending from the warmer Pliocene into the deepest ice ages of the Pleistocene, human survival depended on both-biological adaptations and cultural evolution, mastering fire as a necessity. This allowed the genus to increase entropy in nature by orders of magnitude. Gathered around camp fires during long nights for hundreds of thousandth of years, captivated by the flickering life-like dance of the flames, humans developed imagination, insights, cravings, fears, premonitions of death and thereby aspiration for immortality, omniscience, omnipotence and the concept of god. Inherent in pantheism was the reverence of the Earth, its rocks and its living creatures, contrasted by the subsequent rise of monotheistic sky-god creeds which regard Earth as but a corridor to heaven. Once the climate stabilized in the early Holocene, since about -7000 years-ago production of excess food by Neolithic civilization along the Great River Valleys has allowed human imagination and dreams to express themselves through the construction of monuments to immortality. Further to burning large part of the forests, the discovery of combustion and exhumation of carbon from the Earth's hundreds of millions of years-old fossil biospheres set the stage for an anthropogenic oxidation event, affecting an abrupt shift in state of the atmosphere-ocean-cryosphere system. The consequent ongoing extinction equals the past five great mass extinctions of species-constituting a geological event horizon in the history of planet Earth. Dr Andrew Glikson is an Earth and Paleo-climate Scientist, Visiting Fellow at the Australian National University, Research School of Earth Science, the School of Archaeology and Anthropology, and the Planetary Science Institute, and a member of the ANU Climate Change Institute.
    Type of Medium: Monograph available for loan
    Pages: XVII, 227 S. , Ill., graph. Darst.
    ISBN: 9783319225111
    Series Statement: Modern approaches in solid earth sciences 10
    Language: English
    Note: Foreword; Prologue; Acknowledgements; Contents; Chapter 1: Early Earth Systems; 1.1 Archaean and Proterozoic Atmospheres; 1.2 Early Biospheres; 1.3 Greenhouse States and Glaciations; Chapter 2: Phanerozoic Life and Mass Extinctions of Species; 2.1 Acraman Impact and Acritarchs Radiation; 2.2 Cambrian and Late Ordovician Mass Extinction; 2.3 Late and End-Devonian Mass Extinctions; 2.4 Late Permian and Permian-Triassic Mass Extinctions; 2.5 End-Triassic Mass Extinction; 2.6 Jurassic-Cretaceous Extinction; 2.7 K-T (Cretaceous-Tertiary Boundary) Mass Extinction; 2.8 Paleocene-Eocene Extinction. , 2.9 The End-Eocene FreezeChapter 3: Cenozoic Biological Evolution (by Colin Groves); 3.1 The Evolution of Mammals; 3.2 From Primates to Humans; 3.3 From Genetic Evolution to Cultural Evolution; Chapter 4: Fire and the Biosphere; 4.1 An Incendiary Biosphere; 4.2 The Deep-Time History of Fire; 4.3 Fire and Pre-historic Human Evolution; 4.4 Neolithic Burning and Early Civilizations; Chapter 5: The Anthropocene; 5.1 The Modern Atmosphere; 5.2 Neolithic Burning and Early Global Warming; 5.3 The Great Carbon Oxidation Event; 5.4 The Sixth Mass Extinction of Species; 5.5 The Faustian Bargain. , 5.6 The Post-anthropocene WorldChapter 6: Rare Earth; Chapter 7: Prometheus: An Epilogue; References; About the Book and the Authors; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Monograph available for loan
    Monograph available for loan
    Berlin [u.a.] : Springer
    Call number: 15/M 15.89255
    Description / Table of Contents: This comprehensive textbook presents an overview of petroleum geoscience for geologists active in the petroleum industry, while also offering a useful guide for students interested in environmental geology, engineering geology and other aspects of sedimentary geology. In this second edition, new chapters have been added and others expanded, covering geophysical methods in general and electromagnetic exploration methods in particular, as well as reservoir modeling and production, unconventional resources and practical petroleum exploration
    Type of Medium: Monograph available for loan
    Pages: XIII, 662 S.
    Edition: 2. ed.
    ISBN: 9783642341311
    Classification:
    Petrology, Petrography
    Language: English
    Note: Introduction to Petroleum Geology Introduction to Sedimentology -- Sedimentary Geochemistry -- Sandstones and Sandstone Reservoirs -- Carbonate Sediments -- Mudrocks, Shales, Silica Deposits and Evaporites -- Stratigraphy -- Sequence Stratigraphy, Seismic Stratigraphy -- Heat Transport in Sedimentary Basins -- Subsurface Water and Fluid Flow in Sedimentary Basins -- Introduction to Geomechanics: Stress and Strain in Sedimentary Basins -- The Structure and Hydrocarbon Traps of Sedimentary Basins -- Compaction of Sedimentary Rocks Including Shales, Sandstones and Carbonates -- Source Rocks and Petroleum Geochemistry -- Petroleum Migration -- Well Logging: Principles, Applications and Uncertainties -- Seismic Exploration -- Explorational Rock Physics - The Link Between Geological Processes and Geophysical Observables -- 4D Seismic -- Interpretation of Marine CSEM - and Marine MT Data for Hydrocarbon Prospecting -- Production Geology -- Introduction to Reservoir Modelling -- Unconventional Hydrocarbons. Oil Shales, Heavy Oil, Tar Sand, Shale Gas, Shale Oil and Gas Hydrates -- Carbon Capture and Storage (CCS) -- Geology of the Norwegian Continental Shelf -- Exploration Strategy..
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Monograph available for loan
    Berlin, Heidelberg ;s.l. : Springer Berlin Heidelberg
    Call number: 10/M 15.89254
    Description / Table of Contents: Kohlendioxid ist eine bedeutende Verbindung in unserer Atmosphäre. Mit Wasser ergibt sie Kohlensäure und ist daher in allen Wässern zugegen. In welchem Ausmaß und in welcher Form Kohlendioxid im Wasser vorliegt, kann mit einfachen mathematischen Gleichungen berechnet werden. Wie diese Gleichungen hergeleitet und was damit ausgesagt werden kann, wird in diesem Buch an Hand von 3D-Grafiken ausführlich gezeigt und diskutiert. Die angegebenen Gleichungen können zur Berechnung von wasserchemischen Parametern herangezogen werden. Das Buch richtet sich an Hydrochemiker, Hydrogeologen, Hydrologen, Umweltwissenschaftler, Analytiker und Chemiker, die sich mit Wasserchemie beschäftigen und an fortgeschrittene Studierende, die die theoretischen Grundlagen des Kohlendioxidgleichgewichts vertiefen wollen sowie an alle, die sich für die mathematische Behandlung von chemischen Gleichgewichten interessieren. Der Autor Hofrat Mag. Dr. Gerhard Hobiger diplomierte in Analytischer Chemie und promovierte  über die chemische Bindung im TiO-Festkörper an der Universität Wien. Anschließend war er im Zentrallabor des Umweltbundesamtes tätig und ist jetzt der Leiter der Fachabteilung Geochemie an der Geologischen Bundesanstalt in Wien
    Type of Medium: Monograph available for loan
    Pages: Online-Ressource (XI, 142 S. 94 Abb) , online resource
    Edition: Online edition Springer eBook Collection. Life Science and Basic Disciplines
    ISBN: 9783662454664 , 9783662454657
    URL: Cover
    URL: Cover
    Classification:
    Chemistry
    Parallel Title: Print version: Kohlendioxid in Wasser mit Alkalinität : Berechnung und grafische Darstellung der chemischen Gleichgewichte
    Parallel Title: Druckausg.: Hobiger, Gerhard: Kohlendioxid in Wasser mit Alkalinität
    Language: German
    Note: Vorwort1 Einleitung -- 2 Grundlegende Definitionen -- 3 Das offene System Kohlendioxid in Wasser mit Alkalinität -- 4 Das offene System von Kohlendioxid in reinem Wasser als Spezialfall des allgemeinen Falles mit Alkalinität -- Anhang 1-5..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...