ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • English  (1,132)
  • German  (738)
  • Chinese  (2)
  • Finnish
  • Swedish
  • 2015-2019  (16)
  • 2010-2014  (1,864)
  • 1990-1994  (10)
  • 1985-1989  (9)
  • 1975-1979  (8)
  • 2010  (1,864)
Collection
Language
Years
Year
  • 1
    Monograph available for loan
    Monograph available for loan
    Cambridge [u.a.] : Cambridge Univ. Press
    Call number: PIK N 106-16-89934
    Type of Medium: Monograph available for loan
    Pages: XV, 488 S. , Ill., graph. Darst.
    ISBN: 9780521851039 (hbk.)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : VS, Verl. für Sozialwiss.
    Associated volumes
    Call number: IASS 16.90102
    Description / Table of Contents: Das Handbuch Sozialwissenschaftliche Diskursanalyse stellt in Einzelbeiträgen aus unterschiedlichen Disziplinen theoretische und methodologische Grundlagen sowie exemplarische Vorgehensweisen der Diskursforschung vor. Es wendet sich an Studierende und WissenschaftlerInnen, die sich mit der Diskursanalyse vertraut machen wollen. Der erste Teilband präsentiert theoretische Grundlagen und allgemeine methodische Zugänge unterschiedlicher Ansätze der Diskursforschung. Der vorliegende Teilband 2 versammelt in 16 Einzelbeiträgen exemplarische diskursanalytische Studien aus Soziologie, Geschichts- und Politikwissenschaft, Diskursiver Psychologie, Kritischer Diskursanalyse, linguistischer Diskursgeschichte und Korpuslinguistik. Im Vordergrund stehen nicht die jeweiligen Fragestellungen der Einzeluntersuchungen, sondern der Zusammenhang von Fragestellung, empirischem Design, Detailanalyse und Formulierung des Gesamtergebnisses. Die Erläuterung des methodischen Vorgehens an Beispielen eignet sich für den Einsatz in der Lehre wie für die Orientierung in Bezug auf Planung und Durchführung eigener Forschungsprojekte.
    Type of Medium: Monograph available for loan
    Pages: 533 S. , Ill., graph. Darst.
    Edition: 4. Aufl.
    ISBN: 9783531166513 (kart.)
    Series Statement: Interdisziplinäre Diskursforschung
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
    Monograph available for loan
    Monograph available for loan
    Princeton and Oxford : Princeton University Press,
    Call number: M 17.90645
    Description / Table of Contents: Cover; Title; Copyright; Contents; List of Illustrations; Preface; PART ONE: What Has Controlled Earth's Climate?; CHAPTER ONE: Climate and Human History; PART TWO: Nature in Control; CHAPTER TWO: Slow Going for a Few Million Years; CHAPTER THREE: Linking Earth's Orbit to Its Climate; CHAPTER FOUR: Orbital Changes Control Ice-Age Cycles; CHAPTER FIVE: Orbital Changes Control Monsoon Cycles; CHAPTER SIX: Stirrings of Change; PART THREE: Humans Begin to Take Control; CHAPTER SEVEN: Early Agriculture and Civilization; CHAPTER EIGHT: Taking Control of Methane
    Description / Table of Contents: CHAPTER NINE: Taking Control of CO[sub(2)]CHAPTER TEN: Have We Delayed a Glaciation?; CHAPTER ELEVEN: Challenges and Responses; PART FOUR: Disease Enters the Picture; CHAPTER TWELVE: But What about Those CO[sub(2)] "Wiggles"?; CHAPTER THIRTEEN: The Horsemen of the Apocalypse: Which One?; CHAPTER FOURTEEN: Pandemics, CO[sub(2)], and Climate; PART FIVE: Humans in Control; CHAPTER FIFTEEN: Greenhouse Warming: Tortoise and Hare; CHAPTER SIXTEEN: Future Warming: Large or Small?; CHAPTER SEVENTEEN: From the Past into the Distant Future; EPILOGUE; CHAPTER EIGHTEEN: Global-Change Science and Politics
    Description / Table of Contents: CHAPTER NINETEEN: Consuming Earth's GiftsAfterword to the Princeton Science Library Edition; Bibliography; Figure Sources; Index; A; B; C; D; E; F; G; H; I; K; L; M; N; O; P; R; S; T; U; V; W; Y
    Description / Table of Contents: The impact on climate from 200 years of industrial development is an everyday fact of life, but did humankind''s active involvement in climate change really begin with the industrial revolution, as commonly believed? Plows, Plagues, and Petroleum has sparked lively scientific debate since it was first published--arguing that humans have actually been changing the climate for some 8,000 years--as a result of the earlier discovery of agriculture. The ""Ruddiman Hypothesis"" will spark intense debate. We learn that the impact of farming on greenhouse-gas levels, thousands of years before the i
    Type of Medium: Monograph available for loan
    Pages: xiv, 226 Seiten , Illustrationen
    Edition: New Princeton Science Library edition
    ISBN: 9780691173214
    Series Statement: Princeton Science Library
    Classification:
    Meteorology and Climatology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 4
    Monograph available for loan
    Monograph available for loan
    Hoboken, N.J : John Wiley & Sons
    Call number: IASS 16.90733
    Type of Medium: Monograph available for loan
    Pages: XXVI, 262 S. , Ill.
    ISBN: 9780470601785 (pbk) , 9780470901045 (ebk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    Monograph available for loan
    Monograph available for loan
    London [u.a.] : Verso
    Call number: IASS 17.90937
    Type of Medium: Monograph available for loan
    Pages: XVIII, 394 S. , graph. Darst. , 23 cm
    ISBN: 184467617X (pbk) , 9781844676170 (pbk) , 1844676188 (hbk) , 9781844676187 (hbk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    Call number: IASS 16.89630/2
    Type of Medium: Monograph available for loan
    Pages: S. 118 - 235 , Ill. , 28 cm
    Language: German , English
    Note: Text dt. und engl.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Monograph available for loan
    Monograph available for loan
    Dordrecht [u.a.] : Springer
    Associated volumes
    Call number: 11/M 16.89756
    In: Theory and applications of transport in porous media
    Description / Table of Contents: This book presents the basic principles of soil dynamics, and a variety of solutions of practical interest for geotechnical engineering, geophysics and earthquake engineering. Emphasis is on analytical solutions, often including the full derivation of the solution, and giving the main parts of computer programs that can be used to calculate numerical data. Reference is also made to a website from which complete computer programs can be downloaded. Soil behaviour is usually assumed to be linear elastic, but in many cases the effect of viscous damping or hysteretic damping, due to plastic deformations, is also considered. Special features are: the analysis of wave propagation in saturated compressible porous media, approximate analysis of the generation of Rayleigh waves, the analysis of the response of soil layers to earthquakes in the deep rock, with a theoretical foundation of such problems by the propagation of Love waves, and the solution of such basic problems as the response of an elastic half space to point loads, line loads, strip loads and moving loads.
    Type of Medium: Monograph available for loan
    Pages: XIV, 433 S. , 195 schw.-w. Ill., 6 schw.-w. Tab , 1 CD-ROM , 235 mm x 155 mm
    ISBN: 9789048134403 (Book with DVD.) , 9789048134410
    Series Statement: Theory and applications of transport in porous media 24
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Type of Medium: Monograph available for loan
    ISBN: 9783775727723
    Language: German , English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    Call number: IASS 16.90356
    Type of Medium: Monograph available for loan
    Pages: xviii, 1140 Seiten , Illustrationen
    ISBN: 9781849712354
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Monograph available for loan
    Monograph available for loan
    London : Routledge
    Call number: PIK N 454-17-90902
    Type of Medium: Monograph available for loan
    Pages: XI, 452 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9781444104882 , 1444104888
    Language: English
    Note: Contents: 1. A looming crisis Part I Status and challenges 2. Rising demand and dwindling per capita resources 3. Water and poverty 4. Governance and finance 5. Pollution and water-related disease 6. Water, land and wildlife 7. Dams and diversions 8. Trading water - real and virtual 9. Water, war and terrorism 10. The threat of global warming Part II Nature's resources 11. The restless water cycle 12. Shrinking freshwater stores Part III Towards sustainability 13. Cutting demand 14. Increasing supplies 15. Cleaning up and protecting the aquatic environment 16. Using seawater 17. Controlling the weather 18. Improved monitoring and data management 19. Improving prediction and risk assessment 20. Improving management and justice 21. Aid for the developing world Conclusions 22. Is sustainability achievable?
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    Monograph available for loan
    Monograph available for loan
    Berkeley, Calif. [u.a.] : Univ. of California Press
    Call number: IASS 16.90487
    Type of Medium: Monograph available for loan
    Pages: VI, 323 S.
    Edition: 1. paperback ed., [Nachdr.]
    ISBN: 0520021568 , 9780520021563
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
    Call number: IASS 16.89860
    Type of Medium: Monograph available for loan
    Pages: 238 S. , graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9783896917683
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 13
    Monograph available for loan
    Monograph available for loan
    Oslo : University Of Oslo
    Call number: M 17.90798
    Type of Medium: Monograph available for loan
    Pages: 196 S. , Illustrationen, graphische Darstellungen
    ISSN: 1501-7710
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 14
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Monograph available for loan
    Monograph available for loan
    Harlow [u.a.] : Pearson/Prentice Hall
    Call number: PIK M 390-16-89504
    Type of Medium: Monograph available for loan
    Pages: VIII, 184 S. , graph. Darst.
    Edition: 5. ed.
    ISBN: 9780273728894 (pbk.)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    Call number: Z 06.0500
    Type of Medium: Journal available for loan
    Pages: 30 cm
    ISSN: 1824-7741
    Former Title: Vorgänger Geologisch-paläontologische Mitteilungen, Innsbruck
    Language: German , English
    Note: Ersch. unregelmäßig , Beiträge teilweise in Englisch
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
    Call number: IASS 15.89494
    Type of Medium: Monograph available for loan
    Pages: Losebl.-Ausg.
    Edition: Stand: Oktober 2010
    ISBN: 9783768501828
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 18
    Monograph available for loan
    Monograph available for loan
    Basingstroke, Hampshire [u.a.] : Palgrave Macmillan
    Call number: IASS 15.89607
    Type of Medium: Monograph available for loan
    Pages: XXII, 347 S. , graph. Darst.
    ISBN: 9780230277014 , 9781403996282
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 19
    Monograph available for loan
    Monograph available for loan
    [Edgecumbe, N.Z.] : A. Muller
    Call number: M 15.89146
    Description / Table of Contents: An account of the results of the 2 March 1987 earthquake in the eastern Bay of Plenty and the aftermath's effects on the people and places on the Rangitaiki Plains
    Type of Medium: Monograph available for loan
    Pages: 223 S., , Ill.
    Language: English
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 20
    Monograph available for loan
    Monograph available for loan
    Garmisch-Partenkirchen : Institut für atmosphärische Umweltforschung der Fraunhofer- Gesellschaft
    Call number: MOP 44829 / Mitte
    Type of Medium: Monograph available for loan
    Pages: 25 S. , graph. Darst.
    Language: English
    Location: MOP - must be ordered
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 21
    Monograph available for loan
    Monograph available for loan
    Chicago [u.a.] : Univ. of Chicago Press
    Call number: PIK A 190-15-89224
    Type of Medium: Monograph available for loan
    Pages: XI, 152 S. , Ill., graph. Darst
    ISBN: 0226902021 (cloth) , 9780226902029 (cloth) , 0226902048 (pbk.) , 9780226902043 (pbk.)
    Language: English
    Note: Introduction -- Sanctioning models : theories and their scope -- Methodology for a virtual world -- A tale of two methods -- When theories shake hands -- Models of climate : values and uncertainties -- Reliability without truth -- Conclusion..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: AWI G1-14-0041
    Type of Medium: Monograph available for loan
    Pages: xiii, 442 Seiten , Illustrationen, Karten
    Edition: first published
    ISBN: 9780521696715 , 978-0-521-69671-5
    Language: English
    Note: Contents: Preface. - Acknowledgements. - PART 1 INTRODUCTION. - 1 Introduction. - 1.1 Humans and the coastal zone. - 1.2 Approaches to the study of coasts. - 1.3 Information sources. - 1.4 Approach and organisation. - References. - 2. Coastal geomorphology. - 2.1 Definition and scope of coastal geomorphology. - 2.2 The coastal zone: definition and nomenclature. - 2.3 Factors influencing coastal morphology and processes. - References. - PART 2 COASTAL PROCESSES. - 3. Sea level fluctuations and changes. - 3.1 Synopsis. - 3.2 Mean sea level, the geoid, and changes in mean sea level. - 3.3 Changes in mean sea level. - 3.4 Astronomical tides. - 3.5 Short-term dynamic changes in sea level. - 3.6 Climate change and sea level rise. - References. - 4. Wind-generated waves. - 4.1 Synopsis. - 4.2 Definition and characteristics of waves. - 4.3 Measurement and description of waves. - 4.4 Wave generation. - 4.5 Wave prediction. - 4.6 Wave climate. - Further reading. - Preferences. - 5. Waves - wave theory and wave dynamics. - 5.1 Synopsis. - 5.2 Wave theories. - 5.3 Wave shoaling and refraction. - 5.4 Wave breaking. - 5.5 Wave groups and low-frequency energy in the surf and swash zones. - Further reading. - References. - 6. Surf zone circulation. - 6.1 Synopsis. - 6.2 Undertow. - 6.3 Rip cells. - 6.4 Longshore currents. - 6.5 Wind and tidal currents. - Further reading. - References. - 7. Coastal sediment transport. - 7.1 Synopsis. - 7.2 Sediment transport mechanisms, boundary layers and bedforms. - 7.3 On-offshore sand transport. - 7.4 Longshore sand transport. - 7.5 Littoral sediment budget and littoral drift cells. - Further reading. - References. - PART 3 COASTAL SYSTEMS. - 8. Beach and nearshore systems. - 8.1 Synopsis. - 8.2 Beach and nearshore sediments and morphology. - 8.3 Nearshore morphodynamics. - 8.4 Beach morphodynamics. - References. - 9. Coastal sand dunes. - 9.1 Synopsis. - 9.2 Morphological components of coastal dunes and dune fields. - 9.3 Plant communities of coastal dunes. - 9.4 Aeolian processes in coastal dunes. - 9.5 Sand deposition. - 9.6 Beach / dune interaction and foredune evolution. - 9.7 Management of coastal dunes. - References. - 10. Barrier systems. - 10.1 Synopsis. - 10.2 Barrier types and morphology. - 10.3 Barrier dynamics: overwash and inlets. - 10.4 Barrier spit morphodynamics. - 10.5 Barrier islands. - 10.6 Management of barrier systems. - References. - 11. Salt marshes and mangroves. - 11.1 Synopsis. - 11.2 Saltmarsh and mangrove ecosystems. - 11.3 Salt marshes. - 11.4 Mangroves. - 11.5 Conservation and management of saltmarshes and mangroves. - Further reading. - References. - 12. Coral reefs and atolls. - 12.1 Synopsis. - 12.2 Corals and reef formation. - 12.3 Geomorphology and sedimentology of coral reefs. - 12.4 Impacts of disturbance on coral reefs. - Further reading. - References. - 13. Cliffed and rocky coasts. - 13.1 Synopsis. - 13.2 Cliffed coast morphology. - 13.3 Cliffed coast erosion system. - 13.4 Cohesive bluff coasts. - 13.5 Rock coasts. - 13.6 Shore platforms. - 13.7 Management of coastal cliff shorelines. - Further reading. - References. - Index
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
  • 24
    Monograph available for loan
    Monograph available for loan
    Footscray, Vic. : Lonely Planet
    Call number: 1.8/M 10.0336
    Type of Medium: Monograph available for loan
    Pages: 1216 S.
    Edition: 12th ed.
    ISBN: 9781741049886
    Series Statement: Lonely planet
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Monograph available for loan
    Monograph available for loan
    Footscray, VIc. : Lonely Planet
    Call number: 1.8/M 10.0347
    Type of Medium: Monograph available for loan
    Pages: 1216 S.
    Edition: 6th ed.
    ISBN: 9781741792355
    Series Statement: Lonely planet
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    Call number: IASS 15.0023
    Type of Medium: Monograph available for loan
    Pages: 437 S.
    ISBN: 9783593391694
    Uniform Title: Commonwealth
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Call number: AWI NBM-15-0018
    Type of Medium: Non-book medium
    Pages: 1 Film (54 min) : Stereo, HDTV , 12 cm
    Language: German
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    facet.materialart.
    Unknown
    Wien : [Verlag nicht ermittelbar] ; 22.1910/25(1925),3; 23.1914/31(1929/31),2-3; 24.1927,1-2; 25.1939,1; 26.1948,1; 27.1971-Band 76 (2022)
    Call number: S 91.1179
    ISSN: 0375-5797 , 0378-0864
    Parallel Title: 35=2 von European Conodont Symposium (ZDB) Guidebook, abstracts / European Conodont Symposium
    Parallel Title: 41=2 von Workshop on Agglutinated Foraminifera (ZDB) Proceedings / Workshop on Agglutinated Foraminifera. Geologische Bundesanstalt
    Parallel Title: 39=3 von International Nannoplankton Association Proceedings of the ... International Nannoplankton Association conference
    Parallel Title: 60=11 von Deutsche Gesellschaft für Geowissenschaften. Fachsektion GeoTop Internationale Jahrestagung der Fachsektion GeoTop der Deutschen Gesellschaft für Geowissenschaften
    Former Title: Vorg. Geologische Reichsanstalt Abhandlungen der Kaiserlich-Königlichen Geologischen Reichsanstalt, Wien
    Subsequent Title: Fortgesetzt durch Abhandlungen
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
    Monograph available for loan
    Monograph available for loan
    Beijing : Seismological Press
    Call number: M 10.0305
    Type of Medium: Monograph available for loan
    Pages: 87 S.
    ISBN: 9787502836726
    Uniform Title: European Macroseismic Scale 1998
    Classification:
    Seismology
    Language: Chinese
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 30
    Monograph available for loan
    Monograph available for loan
    München : oekom-verl.
    Call number: M 11.0026
    Type of Medium: Monograph available for loan
    Pages: 347 S. , Ill. , 238 mm x 145 mm
    ISBN: 9783865811974
    Series Statement: Stoffgeschichten 6
    Uniform Title: Dirt
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 31
    Monograph available for loan
    Monograph available for loan
    Paris : OECD
    Call number: PIK P 113-10-0202
    Description / Table of Contents: This joint IEA/NEA report on electricity generating costs presents the latest data available for a wide variety of fuels and technologies, including coal and gas (with and without carbon capture), nuclear, hydro, onshore and offshore wind, biomass, solar, wave and tidal as well as combined heat and power (CHP).  It provides levelised costs of electricity (LCOE) per MWh for almost 200 plants, based on data covering 21 countries (including four major non-OECD countries), and several industrial companies and organisations.  For the first time, the report contains an extensive sensitivit
    Type of Medium: Monograph available for loan
    Pages: 215 S. : graph. Darst.
    ISBN: 9789264084308
    Language: English
    Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Series available for loan
    Series available for loan
    Warnemünde : Inst. für Ostseeforschung
    Associated volumes
    Call number: ZS-000(80)
    In: Meereswissenschaftliche Berichte
    Type of Medium: Series available for loan
    Pages: 147 S.
    Series Statement: Meereswissenschaftliche Berichte 80
    Classification:
    Oceanology
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Call number: AWI G3-11-0007
    In: Advances in global change research, 40
    Description / Table of Contents: This book covers a round-up of environmental changes in Siberia with a focus on the terrestrial biosphere but also discussing climate and atmosphere and the hydrolofical cycle. It concludes with a discussion of information system approaches that are being developed to safeguard and make accessible spatial and temporal data for environmental studies.
    Type of Medium: Monograph available for loan
    Pages: xv, 282 Seiten , Illustrationen
    ISBN: 9789048186402
    Series Statement: Advances in global change research 40
    Language: English
    Note: PART I: BIOSPHERE - 1. Forest disturbance assessment using satellite data of moderate and low resolution / M. A. Korets, V. A. Ryzhkova, A. I. Sukhinin, S. A. Bartalev and I. V. Danilova 2. Fire / climate interactions in Siberia / Heiko Balzter, Kevin Tansey, Jorg Kaduk, Charles George, France Gerard, Maria Cuevas Gonzalez, Anatoly Sukhinin and Evgeni Ponomarev 3. Long-term dynamics of mixed fir-aspen forests in West Sayan (Altai-Sayan Ecoregion) / D. M. Ismailova and D. I. Nazimova 4. Evidence of evergreen conifers invasion into larch dominated forests during recent decades / V. I. Kharuk, K. J. Ranson and M. L. Dvinskaya 5. Potential climate-induced vegetation change in Siberia in the 21st century / N. M. Tchebakova , E. I. Parfenova, and A. J. Soja 6. Wildfire dynamics in mid-Siberian larch dominated forests / V. I. Kharuk, K. J. Ranson and M. L. Dvinskaya 7. Dendroclimatological evidence of climate changes across Siberia / Vladimir V. Shishov, Eugene A. Vaganov 8. Siberian pine and larch response to climate warming in the southern Siberian mountain forest: tundra ecotone / V. I. Kharuk, K. J. Ranson, M. L. Dvinskaya and S. T. Im PART II: HYDROSPHERE 9. Remote sensing of spring snowmelt in Siberia / A. Bartsch, W. Wagner and R. Kidd 10. Response of river runoff in the cryolithic zone of Eastern Siberia (Lena River Basin) to future climate warming / A. G. Georgiadi, I. P. Milyukova and E. A. Kashutina PART III: ATMOSPHERE 11. Investigating regional scale processes using remotely sensed atmospheric CO2 column concentrations from SCIAMACHY / M. P. Barkley, A. J. Hewitt and P. S. Monks 12. Climatic and geographic patterns of spatial distribution of precipitation in Siberia / A. Onuchin and T. Burenina PART IV: INFORMATION SYSTEMS 13. Interoperability, data discovery and access: the e-Infrastructures for Earth Sciences resources / Stefano Nativi, Christiana Schmullius, Lorenzo Bigagli and Roman Gerlach 14. Development of a web based information-computational infrastructure for the Siberia Integrated Regional Study / E. P. Gordov, A. Z. Fazliev, V. N. Lykosov, I. G. Okladnikov and A. G. Titov 15. Conclusions / Heiko Balzter. - Appendix. - Index.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Series available for loan
    Series available for loan
    Washington, DC : United States Government Printing Office
    Associated volumes
    Call number: S 90.0002(1386-F) ; AWI G7-11-0050
    In: Satellite image atlas of glaciers of the world, 1386-F
    In: Professional paper, 1386-F
    Description / Table of Contents: This chapter is the ninth to be released in U.S. Geological Survey Professional Paper 1386, Satellite Image Atlas of Glaciers of the World, a series of 11 chapters. In each of the geographic area chapters, remotely sensed images, primarily from the Landsat 1, 2, and 3 series of spacecraft, are used to analyze the specific glacierized region of our planet under consideration and to monitor glacier changes. Landsat images, acquired primarily during the middle to late 1970s and early 1980s, were used by an international team of glaciologists and other scientists to study various geographic regions and (or) to discuss related glaciological topics. In each glacierized geographic region, the present areal distribution of glaciers is compared, wherever possible, with historical information about their past extent. The atlas provides an accurate regional inventory of the areal extent of glacier ice on our planet during the 1970s as part of a growing international scientific effort to measure global environmental change on the Earth's surface.The chapter is divided into seven geographic parts and one topical part: Glaciers of the Former Soviet Union (F-1), Glaciers of China (F-2), Glaciers of Afghanistan (F-3), Glaciers of Pakistan (F-4), Glaciers of India (F-5), Glaciers of Nepal (F-6), Glaciers of Bhutan (F-7), and the Paleoenvironmental Record Preserved in Middle-Latitude, High-Mountain Glaciers (F-8). Each geographic section describes the glacier extent during the 1970s and 1980s, the benchmark time period (1972-1981) of this volume, but has been updated to include more recent information.
    Type of Medium: Series available for loan
    Pages: VIII, F349 S. , Illustrationen
    ISBN: 9781411326095
    Series Statement: Satellite image atlas of glaciers of the world / ed. by Richard S. Williams ... F
    Classification:
    Regional Geology
    Language: English
    Note: Contents: F–1. GLACIERS OF THE FORMER SOVIET UNION / VLADIMIR M. KOTLYAKOV, with contributions from A.M. DYAKOVA (Siberia), V.S. KORYAKIN (Russian Arctic Islands), V.I. KRAVTSOVA (Caucasus, Altay), G.B. OSIPOVA (Tien Shan), G.M. VARNAKOVA (Pamirs and Alai Range), V.N. VINOGRADOV (Kamchatka), O.N. VINOGRADOV (Caucasus), and N.M. ZVERKOVA (Ural Mountains and Taymyr Peninsula) Sections on FLUCTUATIONS OF GLACIERS OF THE CENTRAL CAUCASUS AND GORA EL’BRUS (With a subsection on THE GLACIOLOGICAL DISASTER IN NORTH OSETIYA / VLADIMIR M. KOTLYAKOV, O.V. ROTOTAEVA, and G.A. NOSENKO INVESTIGATIONS OF THE FLUCTUATIONS OF SURGE-TYPE GLACIERS IN THE PAMIRS BASED ON OBSERVATIONS FROM SPACE / VLADIMIR M. KOTLYAKOV, G.B. OSIPOVA, and D.G. TSVETKOV THE GLACIOLOGY OF THE RUSSIAN HIGH ARCTIC FROM LANDSAT IMAGERY / J.A. DOWDESWELL, E.K. DOWDESWELL, M. WILLIAMS, and A.F. GLAZOVSKII F–2. GLACIERS OF CHINA / SHI YAFENG, MI DESHENG, YAO TANDONG, ZENG QUNZHU, and LIU CHAOHAI F–3 GLACIERS OF AFGHANISTAN / JOHN E. SHRODER , JR ., and MICHAEL P. BISHOP F–4 GLACIERS OF PAKISTAN / JOHN E. SHRODER , JR ., and MICHAEL P. BISHOP F–5 GLACIERS OF INDIA / CHANDER P. VOHRA Updated supplement on A STUDY OF SELECTED GLACIERS UNDER THE CHANGING CLIMATE REGIME / SYED IQBAL HASNAIN, RAJESH KUMAR , SAFARAZ AHMAD, and SHRESTH TAYAL F–6 GLACIERS OF NEPAL — GLACIER DISTRIBUTION IN THE NEPAL HIMALAYA WITH COMPARISON TO THE KARAKORAM RANGE / KEIJI HIGUCHI, OKITSUGU WATANABE, HIROJI FUSHIMI, SHUHEI TAKENAKA, and AKIO NAGOSHI, Supplement by YUTAKA AGETA F–7 GLACIERS OF BHUTAN / SHUJI IWATA F–8 THE PALEOENVIRONMENTAL RECORD PRESERVED IN MIDDLE-LATITUDE, HIGH-MOUNTAIN GLACIERS: AN OVERVIEW OF U.S. GEOLOGICAL SURVEY RESEARCH IN CENTRAL ASIA AND THE UNITED STATES / L. DeWAYNE CECIL, DAVID L. NAFTZ, PAUL F. SCHUSTER , DAVID D. SUSONG, and JAROMY R . GREEN
    Location: Lower compact magazine
    Location: AWI Reading room
    Branch Library: GFZ Library
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Monograph available for loan
    Monograph available for loan
    London : Hodder Education
    Call number: AWI G7-11-0061
    Description / Table of Contents: Glaciers & Glaciation is the classic textbook for all students of glaciation. Stimulating and accessible, it has established a reputation as a comprehensive and essential resource. In this new edition, the text, references and illustrations have been thoroughly updated to provide a state-of-the-art overview of the nature, origin and behaviour of glaciers and the geological and geomorphological evidence for their past history on earth. The first part of the book investigates the processes involved in forming glacier ice, the natureof glacier-climate relationships, the mechanisms of glacier flow and the interactions of glaciers with other natural systems such as rivers, lakes and oceans. In the second part, the emphasis moves to landforms and sediment, the interpretation of the earth's glacial legacy and the reconstruction of glacial depositional environments and palaeoglaciology.
    Type of Medium: Monograph available for loan
    Pages: XIV, 802 Seiten , Illustrationen
    Edition: Second edition
    ISBN: 9780340905791
    Language: English
    Note: CONTENTS PREFACE PREFACE TO THE SECOND EDITION ACKNOWLEDGEMENTS PART ONE GLACIERS 1 INTRODUCTION 1.1 Glacier systems 1.1.1 Mass balance 1.1.2 Meltwater 1.1.3 Glacier motion 1.1.4 Glaciers and sea-level change 1.1.5 Erosion and debris transport 1.1.6 Glacial sediments, landforms and landscapes 1.2 Glacier morphology 1.2.1 Ice sheets and ice caps 1.2.2 Glaciers constrained by topography 1.2.3 Ice shelves 1.3 Present distribution of glaciers 1.3.1 Influence of latitude and altitude 1.3.2 Influence of aspect, relief and distance from a moisture source 1.4 Past distribution of glaciers 1.4.1 'Icehouse' and 'greenhouse' worlds 1.4.2 Cenozoic glaciation 2 SNOW, ICE AND CLIMATE 2.1 Introduction 2.2 Surface energy balance 2.2.1 Changes of state and temperature 2.2.2 Shortwave radiation 2.2.3 Longwave radiation 2.2.4 Sensible and latent heat: turbulent fluxes 2.2.5 Energy supplied by rain 2.2.6 Why is glacier ice blue? 2.3 Ice temperature 2.3.1 The melting point of ice 2.3.2 Controls on ice temperature 2.3.3 Thermal structure of glaciers and ice sheets 2.4 Processes of accumulation and ablation 2.4.1 Snow and ice accumulation 2.4.2 Transformation of snow to ice 2.4.3 Melting of snow and ice 2.4.4 Sublimation and evaporation 2.4.5 The influence of debris cover 2.5 Mass balance 2.5.1 Definitions 2.5.2 Measurement of mass balance 2.5.3 Annual mass balance cycles 2.5.4 Mass balance gradients 2.5.5 The equilibrium line 2.5.6 Glaciation levels or glaciation thresholds 2.5.7 Glacier sensitivity to climate change 2.6 Glacier-climate interactions 2.6.1 Effects of glaciers and ice sheets on the atmosphere 2.7 Ice cores 2.7.1 Ice coring programmes 2.7.2 Stable isotopes 2.7.3 Ancient atmospheres: the gas content of glacier ice 2.7.4 Solutes and particulates 3 GLACIER HYDROLOGY 3.1 Introduction 3.2 Basic concepts 3.2.1 Water sources and routing 3.2.2 Hydraulic potential 3.2.3 Resistance to flow 3.2.4 Channel wall processes: melting, freezing and ice deformation 3.3 Supraglacial and englacial drainage 3.3.1 Supraglacial water storage and drainage 3.3.2 Englacial drainage 3.4 Subglacial drainage 3.4.1 Subglacial channels 3.4.2 Water films 3.4.3 Linked cavity systems 3.4.4 Groundwater flow 3.4.5 Water at the ice-sediment interface 3.5 Glacial hydrological systems 3.5.1 Temperate glaciers 3.5.2 Polythermal glaciers 3.5.3 Modelling glacial hydrological systems 3.6 Proglacial runoff 3.6.1 Seasonal and shorter-term cycles 3.6.2 Runoff and climate change 3.7 Glacial lakes and outburst floods 3.7.1 Introduction 3.7.2 Moraine-dammed lakes 3.7.3 Ice-dammed lakes 3.7.4 Icelandic subglacial lakes 3.7.5 Estimating GLOF magnitudes 3.8 Life in glaciers 3.8.1 Supraglacial ecosystems 3.8.2 Subglacial ecosystems 3.9 Glacier hydrochemistry 3.9.1 Overview 3.9.2 Snow chemistry 3.9.3 Chemical weathering processes 3.9.4 Subglacial chemical weathering 3.9.5 Proglacial environments 3.9.6 Rates of chemical erosion 4 PROCESSES OF GLACIER MOTION 4.1 Introduction 4.2 Stress and strain 4.2.1 Stress 4.2.2 Strain 4.2.3 Rheology: stress-strain relationships 4.2.4 Force balance in glaciers 4.3 Deformation of ice 4.3.1 Glen's Flow Law 4.3.2 Crystal fabric, impurities and water content 4.3.3 Ice creep velocities 4.4 Sliding 4.4.1 Frozen beds 4.4.2 Sliding of wet-based ice 4.4.3 Glacier-bed friction 4.4.4 The role of water 4.5 Deformable beds 4.5.1 The Boulton-Hindmarsh model 4.5.2 Laboratory testing of subglacial tills 4.5.3 Direct observations of deformable glacier beds 4.5.4 Rheology of subglacial till 4.6 Rates of basal motion 4.6.1 'Sliding laws' 4.6.2 Local and non-local controls on ice velocity 4.7 Crevasses and other structures: strain made visible 4.7.1 Crevasses 4.7.2 Crevasse patterns 4.7.3 Layering, foliation and related structures 5 GLACIER DYNAMICS 5.1 Introduction 5.2 Understanding glacier dynamics 5.2.1 Balance velocities 5.2.2 Deviations from the balance velocity 5.2.3 Changes in ice thickness: continuity 5.2.4 Thermodynamics 5.3 Glacier models 5.3.1 Overview 5.3.2 Equilibrium glacier profiles 5.3.3 Time-evolving glacier models 5.4 Dynamics of valley glaciers 5.4.1 Intra-annual velocity variations 5.4.2 Multi-annual variations 5.5 Calving glaciers 5.5.1 Flow of calving glaciers 5.5.2 Calving processes 5.5.3 'Calving laws' 5.5.4 Advance and retreat of calving glaciers 5.6 Ice shelves 5.6.1 Mass balance of k e shelves 5.6.2 Flow of ice shelves 5.6.3 Ice shelf break-up 5.7 Glacier surges 5.7.1 Overview 5.7.2 Distribution of surging glaciers 5.7.3 Temperate glacier surges 5.7.4 Polythermal surging glaciers 5.7.5 Surge mechanisms 6 THE GREENLAND AND ANTARCTIC ICE SHEETS 6.1 Introduction 6.2 The Greenland Ice Sheet 6.2.1 Overview 6.2.2 Climate and surface mass balance 6.2.3 Ice sheet flow 6.2.4 Ice streams and outlet glaciers 6.3 The Antarctic Ice Sheet 6.3.1 Overview 6.3.2 Climate and mass balance 6.3.3 Flow of inland ice 6.3.4 Ice streams 6.3.5 Hydrology and subglacial lakes 6.3.6 Ice stream stagnation and reactivation 6.3.7 Stability of the West Antarctic Ice Sheet 7 GLACIERS AND SEA LEVEL CHANGE 7.1 Introduction 7.2 Causes of sea-level change 7.2.1 Overview 7.2.2 Glacio-eustasy and global ice volume 7.2.3 Glacio-isostasy and ice sheet loading 7.3 Sea-level change over glacial-interglacial cycles 7.3.1 Ice sheet fluctuations and eustatic sea-level change 7.3.2 Sea-level histories in glaciated regions 7.4 Glaciers and recent sea-level change 7.4.1 Recorded sea-level change 7.4.2 Global glacier mass balance 7.5 Future sea-level change 7.5.1 IPCC climate and sea-level projections 7.5.2 Predicting the glacial contribution to sea-level change PART TWO GLACIATION 8 EROSIONAL PROCESSES, FORMS AND LANDSCAPES 8.1 Introduction 8.2 Subglacial erosion 8.2.1 Rock fracture: general principles 8.2.2 Abrasion 8.2,3 Quarrying 8.2.4 Erosion beneath cold ice 8.2.5 Erosion of soft beds 8.3 Small-scale erosional forms 8.3.1 Striae and polished surfaces 8.3.2 Rat tails 8.3.3 Chattermarks, gouges and fractures 8.3.4 P-forms 8.4 Intermediate-scale erosional forms 8.4.1 Roches moutonnees 8.4.2 Whalebacks and rock drumlins 8.4.3 Crag and tails 8.4.4 Channels 8.5 Large-scale erosional landforms 8.5.1 Rock basins and overdeepenings 8.5.2 Basins and overdeepenings in soft sediments 8.5.3 Troughs and fjords 8.5.4 Cirques 8.5.5 Strandflats 8.6 Landscapes of glacial erosion 8.6.1 Areal scouring 8.6.2 Selective linear erosion 8.6.3 Landscapes of little or no glacial erosion 8.6.4 Alpine landscapes 8.6.5 Cirque landscapes 8.6.6 Continent-scale patterns of erosion 9 DEBRIS ENTRAPMENT AND TRANSPORT 9.1 Introduction 9.2 Approaches to the study of glacial sediments 9.2.1 The glacial debris cascade 9.2.2 Spatial hierarchies of sediments and landforms 9.3 Glacial debris entrainment 9.3.1 Supraglacial debris entrainment 9.3.2 Incorporation of debris into basal ice 9.4 Debris transport and release 9.4.1 Subglacial transport 9.4.2 High-level debris transport 9.4.3 Glacifluvial transport 9.5 Effects of transport on debris 9.5.1 Granulometry 9.5.2 Clast morphology 9.5.3 Particle micromorphology 10 GLACIGENIC SEDIMENTS AND DEPOSITIONAL PROCESSES 10.1 Introduction 10.2 Sediment description and classification 10.2.1 Sediment description 10.2.2 Deformation structures 10.2.3 Primary and secondary deposits 10.3 Primary glacigenic deposits (till) 10.3.1 Overview 10.3.2 Processes of subglacial till formation 10.3.3 Glacitectonite 10.3.4 Subglacial traction till 10.4 Glacifluvial deposits 10.4.1 Terminology and classification of glacifluvial sediments 10.4.2 Plane bed deposits 10.4.3 Ripple cross-laminated facies 10.4.4 Dunes 10.4.5 Antidunes 10.4.6 Scour and minor channel fills 10.4.7 Gravel sheets 10.4.8 Silt and mud drapes 10.4.9 Hyperconcentrated flow deposits 10.5 Gravitational mass movement deposits and syn-sedimentary deformation structures 10.5.1 Overview 10.5.2 Fall deposits 10.5.3 Slide and slump deposits 10.5.4 Debris (sediment-gravity) flow deposits 10.5.5
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Monograph non-lending collection
    Monograph non-lending collection
    Beijing [u.a.] : O'Reilly
    Call number: AWI S2-11-0015
    Type of Medium: Monograph non-lending collection
    Pages: XVI, 750 S. : Ill., graph. Darst.
    Edition: Dt. Ausg.
    ISBN: 9783897216495
    Series Statement: In a nutshell
    Uniform Title: R in a nutshell
    Language: German
    Note: Cotents: Teil I: R-Grundlagen: 1 Beschaffung und Installation von R. - 2 Die R-Benutzerschnittstelle. - 3 Kurzeinführung in R. - 4 R-Pakete. - Teil II: Die Programmiersprache R: 5 Überblick über die Programmiersprache R. - 6 R-Syntax. - 7 R-Objekte. - 8 Symbole und Umgebungen. - 9 Funktionen. - 10 Objektorientierte Programmierung. - 11 Hochperformantes R. - Teil II: Daten aufbereiten und darstellen: 12 Daten speichern, laden und bearbeiten. - 13 Datenaufbereitung. - 14 Grafik. - 15 Trellis-Grafik mit Lattice. - Teil IV: Statistik mit R: 16 Datenexploration. - 17 Wahrscheinlichkeitsverteilungen. - 18 Statistische Testverfahren. - 19 Poweranalyse. - 20 Regressionsmodelle. - 21 Klassifikationsmodelle. - 22 Maschinelles Lernen. - 23 Zeitreihenanalyse. - 24 Bioconductor. - Anhang A: Funktionsreferenz. - Anhang B: Datensatzreferenz. - Literatur. - Index
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    Monograph available for loan
    Monograph available for loan
    Berlin : Berliner Taschenbuch-Verl.
    Call number: PIK B 160-11-0102
    Type of Medium: Monograph available for loan
    Pages: 431 S.
    Edition: 2. Aufl.
    ISBN: 9783833306327
    Series Statement: BvT 632
    Uniform Title: The craftsman
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
    Monograph available for loan
    Monograph available for loan
    Heidelberg : Spektrum, Akad. Verl.
    Call number: PIK M 310-12-0105
    Description / Table of Contents: Contents: Teil 1 - Zum Auftakt ; Zweifelhafte Zahlen ; Allgemeine Hintergründe ; Teil 2 - Verschiedene Arten verdächtiger Daten ; Pfusch ; Quellen: Wer hat gezählt? Weshalb wurde gezählt? ; Definitionen: Was wurde gezählt? ; Kriterien: Wie wurde gezählt? ; Verpackung: Was wird uns gesagt? ; Debatten: Wenn Statistiken einander widersprechen ; Teil 3 - Allein im Datendschungel. Wie Sie fehlerhafte Statistiken im Alltag entlarven ; Zusammenfassung: Woran Sie verdächtige Daten erkennen ; Bessere Statistiken: Wie sie aussehen sollten ; Nachwort: Wenn Sie keine Ahnung davon hatten, dass die Dinge so schlecht stehen, stehen sie im Allgemeinen auch nicht so schlecht ; Anregungen für alle, die sich selbst detektivisch am Tatort Statistik betätigen wollen
    Type of Medium: Monograph available for loan
    Pages: IX, 157 S. : graph. Darst.
    ISBN: 9783827425232
    Series Statement: Spektrum Akademischer Verlag Sachbuch
    Uniform Title: Stat spotting
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 39
    Monograph available for loan
    Monograph available for loan
    Cambridge [u.a.] : Cambridge Univ. Pr.
    Call number: AWI G6-10-0141
    Description / Table of Contents: The first comprehensive, state-of-the-art introduction to the fast-evolving topic of in-situ produced cosmogenic nuclides, for graduate students and practitioners.
    Type of Medium: Monograph available for loan
    Pages: IX, 187 S. : Ill.
    Edition: 1 ed.
    ISBN: 9780521873802 , 0-521-87380-0
    Language: English
    Note: Contents: Preface. - 1 Cosmic rays. - 1.1 Origin and nature of cosmic rays. - 1.2 Interaction with magnetic fields. - 1.3 Interactions with the Earth's atmosphere. - 1.4 Interactions with the Earth's surface. - 1.5 Production of cosmogenic nuclides. - 1.6 Detection of cosmic rays. - 2 Cosmogenic nuclides. - 2.1 'Useful' cosmogenic nuclides. - 2.2 Stable cosmogenic nuclides. - 2.3 Cosmogenic radionuclides. - 2.4 Sample preparation. - 2.5 Analytical methods. - 3 Production rates and scaling factors. - 3.1 Deriving production rates. - 3.2 Scaling factors. - 3.3 Building scaling factors. - 4 Application of cosmogenic nuclldes to Earth surface sciences. - 4.1 Exposure dating. - 4.2 Burial dating. - 4.3 Erosion/denudation rates. - 4.4 Uplift rates. - 4.5 Soil dynamics. - 4.6 Dealing with uncertainty. - Appendix A: Sampling checklist. - Appendix B: Reporting of cosrnogenic-nudide data for exposure age and erosion rate determinations. - References. - Index.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
    Monograph available for loan
    Monograph available for loan
    Hamburg : Carlsen
    Call number: 4/M 10.0195
    Description / Table of Contents: Wie bringt man 14 Milliarden Jahre Weltgeschichte in ein Buch? Diese Frage hat sich der Berliner Zeichner Jens Harder gestellt und beantwortet: Indem man auf 350 Seiten den Beginn unseres Universums mit dem Urknall, die Entstehung des Planeten Erde und die Evolution der Pflanzen- und Tierwelt in Bildern umsetzt. Mit Texten geht er sparsam um, nur an wenigen Stellen finden sich kurze Passagen. Dafür fädelt er auf diesen historischen Faden Darstellungen aus allerlei Schöpfungsmythen und verquickt so Naturwissenschaft und menschliche Vorstellungswelt. Am Ende des Buches steht der Mensch. Der Band "Alpha - directions" erschien zuerst beim französischen Verlag Actes Sud und ist der Auftakt zu einer mehrere Bände umfassenden Reihe über Entstehung, Geschichte und Zukunft des Menschen.
    Type of Medium: Monograph available for loan
    Pages: 352 S. : überw. Ill.
    ISBN: 9783551789808
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 41
    Monograph available for loan
    Monograph available for loan
    München [u.a.] : Addison-Wesley
    Call number: 18/M 11.0073
    Type of Medium: Monograph available for loan
    Pages: 183 S. , Ill., graph. Darst.
    ISBN: 9783827329745
    Uniform Title: Rocket surgery made easy
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    Monograph available for loan
    Monograph available for loan
    Princeton, NJ : Princeton University Press
    Call number: AWI G6-12-0047
    Description / Table of Contents: The Global Carbon Cycle is a short introduction to this essential geochemical driver of the earth's climate system, written by one of the world's leading climate-science experts. In this one-of-a-kind primer, David Archer engages readers in clear and simple terms about the many ways the global carbon cycle is woven into our climate system. He begins with a concise overview of the subject, and then looks at the carbon cycle on three different time scales, describing how the cycle interacts with climate in very distinct ways in each. On million-year time scales, feedbacks in the carbon cycle stabilize earth's climate and oxygen concentrations. Archer explains how on hundred-thousand-year glacial / interglacial time scales, the carbon cycle in the ocean amplifies climate change, and how, on the human time scale of decades, the carbon cycle has been dampening climate change by absorbing fossil-fuel carbon dioxide into the oceans and land biosphere. A central question of the book is whether the carbon cycle could once again act to amplify climate change in centuries to come, for example through melting permafrost peatlands and methane hydrates. The Global Carbon Cycle features a glossary of terms, suggestions for further reading, and explanations of equations, as well as a forward-looking discussion of open questions about the global carbon cycle.
    Type of Medium: Monograph available for loan
    Pages: 205 Seiten , Illustrationen
    ISBN: 9780691144146
    Series Statement: Princeton Primers in climate
    Language: English
    Note: Contents: 1 Carbon on earth. - 2 The stable geologic carbon cycle. - 3 The unstable ice age carbon cycle. - 4 The present and future carboncycle - stable or unstable?. - 5 Methane.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
    facet.materialart.
    Unknown
    Delft ; 1.1969-76.2010
    Call number: S 90.0083
    ISSN: 0165-1706
    Language: English
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 44
    Monograph available for loan
    Monograph available for loan
    München[u.a.] : Piper
    Call number: M 18.21948
    Type of Medium: Monograph available for loan
    Pages: 330 S. : Ill.
    Edition: 2. Aufl., Ungekürzte Taschenbuchausg.
    ISBN: 9783492253727
    Series Statement: Piper 5372
    Uniform Title: A different universe
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: AWI Bio-11-0010
    Description / Table of Contents: This much revised and expanded edition provides a valuable and detailed summary of the many uses of diatoms in a wide range of applications in the environmental and earth sciences. Particular emphasis is placed on the use of diatoms in analyzing ecological problems related to climate change, acidification, eutrophication, and other pollution issues. The chapters are divided into sections for easy reference, with separate sections covering indicators in different aquatic environments. A final section explores diatom use in other fields of study such as forensics, oil and gas exploration, nanotechnology, and archeology. Sixteen new chapters have been added since the first edition including introductory chapters on diatom biology and the numerical approaches used by diatomists. The extensive glossary has also been expanded and now includes over 1000 detailed entries, which will help non-specialists to use the book effectively
    Type of Medium: Monograph available for loan
    Pages: XVIII, 667 Seiten , Illustrationen
    Edition: Second edition
    ISBN: 9780521509961 , 0-521-50996-3
    Language: English
    Note: Contents: List of Contributors. - Preface. - Part I. Introduction: 1. Applications and uses of diatoms: prologue ; 2. The diatoms: a primer ; 3. Numerical methods for the analysis of diatom assemblage data ; Part II. Diatoms as indicators of environmental change in flowing waters and lakes: 4. Assessing environmental conditions in rivers and streams with diatoms ; 5. Diatoms as indicators of long-term environmental change in rivers, fluvial lakes and impoundments ; 6. Diatoms as indicators of surface-water acidity ; 7. Diatoms as indicators of lake eutrophication ; 8. Diatoms as indicators of environmental change in shallow lakes ; 9. Diatoms as indicators of water-level change in freshwater lakes ; 10. Diatoms as indicators of hydrologic and climatic change in saline lakes ; 11. Diatoms in ancient lakes ; Part III. Diatoms as Indicators in Arctic, Antarctic and alpine lacustrine environments: 12. Diatoms as indicators of environmental change in subarctic and alpine regions ; 13. Freshwater diatoms as indicators of environmental change in the High Arctic ; 14. Diatoms as indicators of environmental change in Antarctic and subantarctic freshwaters ; Part IV. Diatoms as indicators in marine and estuarine environments: 15. Diatoms and environmental change in large brackish-water ecosystems ; 16. Applied diatom studies in estuaries and shallow coastal environments ; 17. Estuarine paleoenvironmental reconstructions using diatoms ; 18. Diatoms on coral reefs and in tropical marine lakes ; 19. Diatoms as indicators of former sea levels, earthquakes, tsunamis and hurricanes ; 20. Marine diatoms as indicators of modern changes in oceanographic conditions ; 21. Holocene marine diatom records of environmental change ; 22. Diatoms as indicators of paleoceanographic events ; 23. Reconsidering the meaning of biogenic silica accumulation rates in the glacial Southern Ocean ; Part V. Other applications: 24. Diatoms of aerial habitats ; 25. Diatoms as indicators of environmental change in wetlands and peatlands ; 26. Tracking fish, seabirds, and wildlife population dynamics with diatoms and other limnological indicators ; 27. Diatoms and archaeology ; 28. Diatoms in oil and gas exploration ; 29. Forensic science and diatoms ; 30. Toxic marine diatoms ; 31. Diatoms as markers of atmospheric transport ; 32. Diatoms as nonnative species ; 33. Diatomite ; 34. Stable isotopes from diatom silica ; 35. Diatoms and nanotechnology: early history and imagined future as seen through patents ; Part IV. Conclusions: 36. Epilogue: a view to the future ; Glossary, acronyms, and abbreviations ; Index.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 46
    Call number: AWI A14-10-0012
    Description / Table of Contents: Demonstrating the breadth and depth of growth in the field since the publication of the popular first edition, Image Analysis, Classification and Change Detection in Remote Sensing, with Algorithms for ENVI/IDL, Second Edition has been updated and expanded to keep pace with the latest versions of the ENVI software environment. Effectively interweaving theory, algorithms, and computer codes, the text supplies an accessible introduction to the techniques used in the processing of remotely sensed imagery.
    Type of Medium: Monograph available for loan
    Pages: XIV, 441Seiten , Illustrationen
    Edition: Second edition
    ISBN: 978-1-4200-8713-0
    Language: English
    Note: Contents Preface to the Second Edition Preface to the First Edition 1. Images, Arrays, and Matrices 1.1 Multispectral Satellite Images 1.2 Algebra of Vectors and Matrices 1.2.1 Elementary Properties 1.2.2 Square Matrices 1.2.3 Singular Matrices 1.2.4 Symmetric, Positive Definite Matrices 1.2.5 Linear Dependence and Vector Spaces 1.3 Eigenvalues and Eigenvectors 1.4 Singular Value Decomposition 1.5 Vector Derivatives 1.6 Finding Minima and Maxima 1.7 Exercises 2. Image Statistics 2.1 Random Variables 2.1.1 Discrete Random Variables 2.1.2 Continuous Random Variables 2.1.3 Normal Distribution 2.2 Random Vectors 2.3 Parameter Estimation 2.3.1 Sampling a Distribution 2.3.2 Interval Estimation 2.3.3 Provisional Means 2.4 Hypothesis Testing and Sample Distribution Functions 2.4.1 Chi-Square Distribution 2.4.2 Student-t Distribution 2.4.3 F-Distribution 2.5 Conditional Probabilities, Bayes' Theorem, and Classification 2.6 Ordinary Linear Regression 2.6.1 One Independent Variable 2.6.2 More Than One Independent Variable 2.6.3 Regularization, Duality, and the Gram Matrix 2.7 Entropy and Information 2.7.1 Kullback-Leibler Divergence 2.7.2 Mutual Information 2.8 Exercises 3. Transformations 3.1 Discrete Fourier Transform 3.2 Discrete Wavelet Transform 3.2.1 Haar Wavelets 3.2.2 Image Compression 3.2.3 Multiresolution Analysis 3.2.3.1 Dilation Equation and Refinement Coefficients 3.2.3.2 Cascade Algorithm 3.2.3.3 Mother Wavelet 3.2.3.4 Daubechies D4 Scaling Function 3.3 Principal Components 3.3.1 Primal Solution 3.3.2 Dual Solution 3.4 Minimum Noise Fraction 3.4.1 Additive Noise 3.4.2 Minimum Noise Fraction Transformation in ENVI 3.5 Spatial Correlation 3.5.1 Maximum Autocorrelation Factor 3.5.2 Noise Estimation 3.6 Exercises 4. Filters, Kernels, and Fields 4.1 Convolution Theorem 4.2 Linear Filters 4.3 Wavelets and Filter Banks 4.3.1 One-Dimensional Arrays 4.3.2 Two-Dimensional Arrays 4.4 Kernel Methods 4.4.1 Valid Kernels 4.4.2 Kernel PCA 4.5 Gibbs-Markov Random Fields 4.6 Exercises 5. Image Enhancement and Correction 5.1 Lookup Tables and Histogram Functions 5.2 Filtering and Feature Extraction 5.2.1 Edge Detection 5.2.2 Invariant Moments 5.3 Panchromatic Sharpening 5.3.1 HSV Fusion 5.3.2 Brovey Fusion 5.3.3 PCA Fusion 5.3.4 DWT Fusion 5.3.5 A Trous Fusion 5.3.6 Quality Index 5.4 Topographic Correction 5.4.1 Rotation, Scaling, and Translation 5.4.2 Imaging Transformations 5.4.3 Camera Models and RFM Approximations 5.4.4 Stereo Imaging and Digital Elevation Models 5.4.5 Slope and Aspect 5.4.6 Illumination Correction 5.5 Image-Image Registration 5.5.1 Frequency-Domain Registration 5.5.2 Feature Matching 5.5.2.1 High-Pass Filtering 5.5.2.2 Closed Contours 5.5.2.3 Chain Codes and Moments 5.5.2.4 Contour Matching 5.5.2.5 Consistency Check 5.5.2.6 Implementation in IDL 5.5.3 Resampling and Warping 5.6 Exercises 6. Supervised Classification: Part 1 6.1 Maximum a Posteriori Probability 6.2 Training Data and Separability 6.3 Maximum Likelihood Classification 6.3.1 ENVI's Maximum Likelihood Classifier 6.3.2 Modified Maximum Likelihood Classifier 6.4 Gaussian Kernel Classification 6.5 Neural Networks 6.5.1 Neural Network Classifier 6.5.2 Cost Functions 6.5.3 Backpropagation 6.5.4 Overfitting and Generalization 6.6 Support Vector Machines 6.6.1 Linearly Separable Classes 6.6.1.1 Primal Formulation 6.6.1.2 Dual Formulation 6.6.1.3 Quadratic Programming and Support Vectors 6.6.2 Overlapping Classes 6.6.3 Solution with Sequential Minimal Optimization 6.6.4 Multiclass SVMs 6.6.5 Kernel Substitution 6.6.6 Modified SVM Classifier 6.7 Exercises 7. Supervised Classification: Part 2 7.1 Postprocessing 7.1.1 Majority Filtering 7.1.2 Probabilistic Label Relaxation 7.2 Evaluation and Comparison of Classification Accuracy 7.2.1 Accuracy Assessment 7.2.2 Model Comparison 7.3 Adaptive Boosting 7.4 Hyperspectral Analysis 7.4.1 Spectral Mixture Modeling 7.4.2 Unconstrained Linear Unmixing 7.4.3 Intrinsic End-Members and Pixel Purity 7.5 Exercises 8. Unsupervised Classification 8.1 Simple Cost Functions 8.2 Algorithms That Minimize the Simple Cost Functions 8.2.1 K-Means Clustering 8.2.2 Kernel K-Means Clustering 8.2.3 Extended K-Means Clustering 8.2.4 Agglomerative Hierarchical Clustering 8.2.5 Fuzzy K-Means Clustering 8.3 Gaussian Mixture Clustering 8.3.1 Expectation Maximization 8.3.2 Simulated Annealing 8.3.3 Partition Density 8.3.4 Implementation Notes 8.4 Including Spatial Information 8.4.1 Multiresolution Clustering 8.4.2 Spatial Clustering 8.5 Benchmark 8.6 Kohonen Self-Organizing Map 8.7 Image Segmentation 8.7.1 Segmenting a Classified Image 8.7.2 Object-Based Classification 8.7.3 Mean Shift 8.8 Exercises 9. Change Detection 9.1 Algebraic Methods 9.2 Postclassification Comparison 9.3 Principal Components Analysis 9.3.1 Iterated PCA 9.3.2 Kernel PCA 9.4 Multivariate Alteration Detection 9.4.1 Canonical Correlation Analysis 9.4.2 Orthogonality Properties 9.4.3 Scale Invariance 9.4.4 Iteratively Reweighted MAD 9.4.5 Correlation with the Original Observations 9.4.6 Regularization 9.4.7 Postprocessing 9.5 Decision Thresholds and Unsupervised Classification of Changes 9.6 Radiometrie Normalization 9.7 Exercises Appendix A: Mathematical Tools A.l Cholesky Decomposition A.2 Vector and Inner Product Spaces A.3 Least Squares Procedures A.3.1 Recursive Linear Regression A.3.2 Orthogonal Linear Regression Appendix B: Efficient Neural Network Training Algorithms B.1 Hessian Matrix B.1.1 R-Operator B.1.1.1 Determination of Rv{n} B.1.1.2 Determination of Rv{δo} B.1.1.3 Determination of Rv{δh} B.1.2 Calculating the Hessian B.2 Scaled Conjugate Gradient Training B.2.1 Conjugate Directions B.2.2 Minimizing a Quadratic Function B.2.3 Algorithm B.3 Kaiman Filter Training B.3.1 Linearization B.3.2 Algorithm B.4 A Neural Network Classifier with Hybrid Training Appendix C: ENVI Extensions in IDL C.1 Installation C.2 Extensions C.2.1 Kernel Principal Components Analysis C.2.2 Discrete Wavelet Transform Fusion C.2.3 A Trous Wavelet Transform Fusion C.2.4 Quality Index C.2.5 Calculating Heights of Man-Made Structures in High-Resolution Imagery C.2.6 Illumination Correction C.2.7 Image Registration C.2.8 Maximum Likelihood Classification C.2.9 Gaussian Kernel Classification C.2.10 Neural Network Classification C.2.11 Support Vector Machine Classification C.2.12 Probabilistic Label Relaxation C.2.13 Classifier Evaluation and Comparison C.2.14 Adaptive Boosting a Neural Network Classifier C.2.15 Kernel K-Means Clustering C.2.16 Agglomerative Hierarchical Clustering C.2.17 Fuzzy K-Means Clustering C.2.18 Gaussian Mixture Clustering C.2.19 Kohonen Self-Organizing Map C.2.20 Classified Image Segmentation C.2.21 Mean Shift Segmentation C.2.22 Multivariate Alteration Detection C.2.23 Viewing Changes C.2.24 Radiometric Normalization Appendix D: Mathematical Notation References Index
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 47
    Call number: ILP/M 10.0206
    In: Tectonophysics
    Type of Medium: Monograph available for loan
    Pages: VI, 238 S. : z.T. farb. Ill., graph. Darst.
    Series Statement: Tectonophysics Vol. 482, Iss. 1-4 : Special issue
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    Monograph available for loan
    Monograph available for loan
    Associated volumes
    Call number: ZSP-125-2009
    In: Antarctic Automatic Weather Station Data for the Calender Year ...
    Type of Medium: Monograph available for loan
    Pages: 44 S. : graph. Darst.
    Language: English
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    Call number: PIK N 076-10-0102
    Type of Medium: Monograph available for loan
    Pages: 289 S. : zahlr. Ill., Kt.
    Edition: Dt. Erstausg.
    ISBN: 9783868732238
    Uniform Title: 100 places to remember before they disappear
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    Series available for loan
    Series available for loan
    Bremerhaven : Alfred-Wegener-Institut für Polar- und Meeresforschung in der Helmholtz-Gemeinschaft
    Associated volumes
    Call number: ZSP-994(2008/2007)
    In: Zweijahresbericht / AWI, Alfred-Wegener-Institut für Polar- und Meeresforschung, 2008/2009
    Type of Medium: Series available for loan
    Pages: 256 Seiten , Illustrationen
    ISSN: 1618-3703
    Series Statement: Zweijahresbericht / AWI, Alfred-Wegener-Institut für Polar- und Meeresforschung 2008/2009
    Language: German , English
    Note: Inhalt = Content 1. Vorwort = Introduction 2. Ausgewählte Forschungsthemen = Selected research topics Methanemission aus dem Permafrost im Lena-Delta = Methane emission from permafrost in the Lena River Delta / Torsten Sachs, Julia Boike Neue Biomarker belegen Schwankungen der arktischen Meereisbedeckung während der letzten 30.000 Jahre = New biomarkers reveal fluctuations in Arctic sea ice cover during the past 30,000 years / Juliane Müller, Rüdiger Stein Die Stabilität des Westantarktischen Eisschildes – Ergebnisse der ANDRILL Tiefbohrungen = The stability of the West Antarctic ice sheet – results of ANDRILL deep drilling operations / Gerhard Kuhn, Frank Niessen Meeresalgen global - detaillierter Blick aus dem All = Detailed view from space – marine algae globally observed / Astrid Bracher, Tilman Dinter, Ilka Peeken, Bettina Schmitt Was verrät der Jahreszyklus über die Klimaentwicklung der letzten Millionen Jahre? = What does the annual cycle tell us about climate change in the last millions of years? / Thomas Laepple, Gerrit Lohmann Der Puls der Atmosphäre: Dekadisches Auf und Ab / The pulse of the tmosphere: The decadal Ups and Downs / Dörthe Handorf, Klaus Dethloff, Sascha Brand, Matthias Läuter Das Eisendüngungsexperiment LOHAFEX = The Iron Fertilization Experiment LOHAFEX / Philipp Assmy, Christine Klaas, Victor Smetacek, Dieter Wolf-Gladrow Ein nützliches genetisches Erbe - Wie alte Gene das Überleben in neuen Lebensräumen ermöglichen = A convenient genetic heritage - How ancestral genes help to survive in new habitats / Doris Abele, Ellen Weihe, Magnus Lucassen, Christoph Held, Kevin Pöhlmann Verursacher von Muschelvergiftungen identifiziert = Cause of Shellfish Poisoning Identified / Urban Tillmann, Malte Elbrächter, Bernd Krock, Uwe John, Allan Cembella Mikrobielle Stoffumsätze im Klimawandel = Climate change and the microbial cycling of organic matter / Anja Engel, Judith Piontek, Mascha Wurst, Nicole Händel, Mirko Lunau, Corinna Borchard 3. Forschung = Research PACES 3.1 TOPIC 1: The changing Arctic and Antarctic 3.2 TOPIC 2: Coastal change 3.3 TOPIC 3: Lehrstunden aus der Erdgeschichte = Lessons from the past 3.4 TOPIC 4: Das Erdsystem aus polarer Perspektive = The Earth System from a Polar Perspective 4. Helmholtz-Nachwuchsgruppen = Helmholtz Young Investigator Groups 5. Entwicklungen in den Fachbereichen = Progresses in the scientific divisions 6. Tiefseeökologie und -technologie (HGF-MPG) = Deep-sea ecology and technology (HGF-MPG) 7. Logistik und Forschungsplattformen = Logistics and research platforms 8. Nationale und internationale Zusammenarbeit = National and international cooperation 9. Wissenschaftliches Rechenzentrum = Scientific data processing centre 10. Bibliothek = Library 11. Technologietransfer = Technology transfer 12. Kommunikation und Medien = Communications and Media 13. Schulprojekt = School project 14. Personeller Aufbau und Haushaltsentwicklung = Personnel structure and budget trends 15. Veröffentlichungen, Patente = Publications, patents Anhang = Annex , In deutscher und englischer Sprache
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
    Monograph available for loan
    Monograph available for loan
    Cambridge : White Horse Press
    Call number: PIK B 160-11-0030
    Description / Table of Contents: Contents: Preface ; I. Energy Systems and Social Evolution ; 1. Palaeolithic Hunter-gatherer Societies ; 2. The Neolithic Revolution and the Problem of Dynamics ; 3. Traditional Agriculture - A Controlled Solar Energy System ; 4. The Structure of the Agrarian Energy System ; 5. The Dynamics of Agrarian Society ; 6. Crisis and Transformation ; 7. The Industrial System and Fossil Energy ; II. Forest and Wood in Preindustrial Germany ; 1. Natural Foundations ; 2. Preindustrial Wood Consumption ; 3. Regulation Problems ; III. England: Coal in the Industrial Revolution ; 1. Substitution of Wood by Coal ; 2. Wood and Coal in Iron Smelting ; 3. Transport and Steam Power ; 4. Significance of Coal in the Industrial Revolution ; IV. Germany in the 18th Century: Wood Crisis and Strategies for Solutions ; 1. Conserving Wood ; 2. Functional Separation of Agriculture and Forestry ; 3. Substitution for Wood ; 4. Was the Wood Crisis an Energy Crisis? ; V. Perceptions of Fossil Energy ; 1. The Finiteness of Fossil Fuels ; 2. Classical Political Economy and the Stationary State ; 3. Jevons and the Contraction of the Industrial System ; 4. Nuclear or Solar Energy ; Bibliography
    Type of Medium: Monograph available for loan
    Pages: X, 230 S. : graph. Darst.
    Edition: 1. pbk. ed.
    ISBN: 9781874267539
    Uniform Title: Der unterirdische Wald
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 52
    Series available for loan
    Series available for loan
    Frankfurt am Main : Verl. des Bundesamtes für Kartographie und Geodäsie
    Associated volumes
    Call number: S 99.0435(45)
    In: Mitteilungen des Bundesamtes für Kartographie und Geodäsie
    Type of Medium: Series available for loan
    Pages: 176 S.
    ISBN: 9783898889575
    Series Statement: Mitteilungen des Bundesamtes für Kartographie und Geodäsie 45
    Classification:
    Cartography, Geographical Information Systems, GIS
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 53
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: 3/S 01.0446(2009)
    In: Jahresbericht
    Type of Medium: Series available for loan
    Pages: 63 S.
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
    Monograph available for loan
    Monograph available for loan
    München : Beck
    Call number: 20-1/M 11.0030
    Type of Medium: Monograph available for loan
    Pages: 319 S. , Kt.
    ISBN: 9783406598982
    Uniform Title: L'avenir de l'eau
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 55
    Call number: PIK B 160-11-0067
    Description / Table of Contents: Contents: Teil I: Vergangenheit als Prolog ; 1. Der große Reset ; 2. Die großen Vorgänger ; 3. Stadtentwicklung als Innovation ; 4. Das Jahrzehnt der größten technischen Fortschritte ; 5. Die Stunde der Vorstadt ; 6. Raumlösungen ; 7. Die Fäden entwirren ; Teil II: Die Umgestaltung der Wirtschaftslandschaft ; 8. Die Hauptstadt des Kapitals ; 9. Ablösung an der Spitze? ; 10. Der FIRE-Sektor ; 11. Der Boom der Behördenstädte ; 12. Leben und Sterben alter Industriestädte ; 13. Nordlicht ; 14. Sonnenuntergang über dem Sunbelt ; Teil III: Eine neue Lebensweise ; 15. Die Reset-Ökonomie ; 16. Eine gute Jobmaschine ; 17. Die neue Normalität ; 18. Die große Umsiedlung ; 19. Groß, schnell und grün ; 20. Die eigene Geschwindigkeit ; 21. Wie ein geölter Blitz ; 22. Ein Traum zur Miete ; 23. Der Zeitpunkt für den Reset
    Type of Medium: Monograph available for loan
    Pages: 248 S.
    ISBN: 9783593391250
    Uniform Title: The great reset
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 56
    Non-book medium
    Non-book medium
    Frankfurt am Main : Bundesamt für Kartographie und Geodäsie
    Call number: PIK CD-11-0124
    Description / Table of Contents: Contents: Topographische Übersichtskarte 1 : 200.000 (160 L/cm) ; Topographische Karte 1 : 500.000 (160 L/cm) ; Topographische Karte 1 : 1.000.000 (160 L/cm) ; Digitales Geländemodell (Auflösung 25m) ; Ortsnamenverzeichnis ; Verwaltungsgrenzen ; Blattschnitte der Topographischen Karten
    Type of Medium: Non-book medium
    Pages: 1 DVD-ROM : farb. ; 12 cm, in Behältnis 25 x 14 x 2 cm + 3D-Brille, Beil. (35 S.)
    Edition: Einzelplatzlizenz, Version 5
    ISBN: 9783898889193
    Series Statement: Amtliche topographische Karten Top 200
    Language: German
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Borntraeger
    Call number: AWI A14-10-0064
    Description / Table of Contents: Measurement Methods in Atmospheric Sciences provides a comprehensive overview of in-situ and remote sensing measurement techniques for probing the Earth's atmosphere. The methods presented in this book span the entire range from classical meteorology via atmospheric chemistry and micrometeorological flux determination to Earth observation from space. Standard instruments for meteorological and air quality monitoring methods, as well as specialized instrumentation predominantly used in scientific experiments, are covered. The presented techniques run from simple mechanical sensors to highly sophisticated electronic devices. Special emphasis is placed on the rapidly evolving field of remote sensing techniques. Here, active ground-based remote sending techniques such as SODAR and LIDAR find a detailed coverage. The book conveys the basic principles of the various observational and monitoring methods, enabling the user to identify the most appropriate method. An introductory chapter covers general principles (e.g. inversion of measured data, available platforms, statistical properties of data, data acquisition). Later chapters each treat methods for measuring a specific property (e.g. humidity, wind speed, wind direction). Long chapters provide an introductory tabular list of the methods treated. More than 100 figures and 400 references, mostly to the recent scientific literature, aid the reader in reading up on the details of the various methods at hand. Recommendations at the end of each major chapter provide additional hints on the use of some instruments in order to facilitate the selection of the proper instrument for a successful measurement. A large number of national and international standards, providing precise guidelines for measuring and acquiring reliable, reproducible and comparable data sets are listed in the appendix. A dedicated index allows easy access to this valuable information. The book is of interest to undergraduate and graduate students in meteorology, physical geography, ecology, environmental sciences and related disciplines as well as to scientists in the process of planning atmospheric measurements in field campaigns or working with data already acquired. Practitioners in environmental agencies and similar institutions will benefit from instrument descriptions and the extended lists in the appendix.
    Type of Medium: Monograph available for loan
    Pages: XIV, 257 Seiten , Illustrationen
    ISBN: 9783443010669 , 3-443-01066-0
    Series Statement: Quantifying the environment
    Language: English
    Note: Contents Preface 1 Introduction 1.1 The necessity for measurements 1.2 Definition of a measurement 1.3 Historical aspects 2 Measurement basics 2.1 Overview of methods 2.1.1 Direct and indirect methods 2.1.2 In-situ and remote sensing methods 2.1.3 Instantaneous and integrating methods 2.1.4 On-line and off-line methods, post-processing 2.1.5 Flux measurements 2.2 Main measurement principles 2.3 Measurements by inversion 2.3.1 Inversion with one variable 2.3.2 Inversion with more than one variable 2.3.3 Well-posed and ill-posed problems 2.4 Measurement instruments 2.4.1 Active and passive instruments 2.4.2 Analogue and digital instruments 2.5 Measurement platforms 2.6 Measurement variables 2.7 General characteristics of measured data 2.8 Data logging 2.9 Quality assurance/quality control 3 In-situ measurements of state variables 3.1 Thermometers 3.1.1 Liquid-in-glass thermometers 3.1.2 Bimetal thermometers 3.1.3 Resistance thermometers, thermistors 3.1.4 Thermocouples, thermopiles 3.1.5 Sonic thermometry 3.1.6 Measurement of infrared radiation 3.1.7 Soil thermometer 3.1.8 Recommendations for temperature measurements 3.2 Measuring moisture 3.2.1 Hygrometer 3.2.2 Psychrometers 3.2.3 Dewpoint determination 3.2.4 Capacitive methods 3.2.5 Recommendations for humidity measurements 3.3 Pressure sensors 3.3.1 Barometers 3.3.2 Hypsometers 3.3.3 Electronic barometers 3.3.4 Microbarometer 3.3.5 Pressure balance 3.3.6 Recommendations for pressure measurements 3.4 Wind measurements 3.4.1 Estimation from visual observations 3.4.2 Wind direction 3.4.3 Cup anemometer 3.4.4 Pressure tube 3.4.5 Hot wire anemometer 3.4.6 Ultrasonic anemometer 3.4.7 Propeller anemometer 3.4.8 Recommendations for wind measurements 4 In-situ methods for observing liquid water and ice 4.1 Precipitation 4.1.1 Rain sensors (Present Weather Sensors) 4.1.2 Rain gauges (totalisators) 4.1.3 Pluviographs 4.1.4 Disdrometer 4.1.5 Special instruments for snow 4.1.6 Recommendations for precipitation measurements 4.2 Soil moisture 4.2.1 Gravimetric methods 4.2.2 Neutron probes 4.2.3 Time domain reflectrometry (TDR) 4.2.4 Tensiometers 4.2.5 Resistance block tensiometer 4.2.6 Recommendations for soil moisture measurements 5 In-situ measurement of trace substances 5.1 Measurement of trace gases 5.1.1 Physical methods 5.1.2 Chemical methods 5.1.3 Recommendations for the measurement of trace gases 5.2 Particle measurements 5.2.1 Determination of the particle mass 5.2.2 Measuring particle size distributions 5.2.3 Measurement of the chemical composition of particles 5.2.4 Measuring the particle structure 5.2.5 Saltiphon 5.2.6 Recommendations for particle measurements 5.3 Olfactometry 5.4 Radioactivity 5.4.1 Counter tubes 5.4.2 Scintillation counters 5.4.3 Recommendations for radioactivity monitoring 6 In-situ flux measurements 6.1 Measuring radiation 6.1.1 Measuring direct solar radiation 6.1.2 Measuring shortwave irradiance 6.1.3 Measuring longwave irradiance 6.1.4 Measuring the total irradiance 6.1.5 Measuring chill 6.1.6 Sunshine recorder 6.1.7 Recommendations for radiation measurements 6.2 Visual range 6.3 Micrometeorological flux measurements 6.3.1 Cuvettes 6.3.2 Surface chambers 6.3.3 Mass balance method 6.3.4 Inferential method 6.3.5 Gradient method 6.3.6 Bowen-ratio method 6.3.7 Flux variance method 6.3.8 Dissipation method 6.3.9 Eddy covariance method 6.3.10 Eddy accumulation methods 6.3.11 Disjunct eddy covariance method 6.3.12 Recommendations for the measurement of turbulent fluxes 6.4 Evaporation Atmometers 6.4.2 Lysimeters 6.4.3 Evaporation pans and tanks 6.4.4 Recommendations for evaporation measurements 6.5 Soil heat flux 6.6 Inverse emission flux modelling 7 Remote sensing methods 7.1 Basics of remote sensing 7.2 Active sounding methods 7.2.1 RADAR 7.2.2 Windprofilers 7.2.3 SODAR 7.2.4 RASS 7.2.5 LIDAR 7.2.6 Further LIDAR techniques 7.3 Active path-averaging methods 7.3.1 Scintillometers 7.3.2 FTIR 7.3.3 DOAS 7.3.4 Quantum cascade laser 7.4 Passive methods 7.4.1 Radiometers 7.4.2 Photometers 7.4.3 Infrared-Interferometer 7.5 Tomography 7.5.1 Simultaneous Iterative Reconstruction Technique 7.5.2 Algebraic Reconstruction Technique (ART) 7.5.3 Smooth Basis Function Minimization (SBFM) 8 Remote sensing of atmospheric state variables 8.1 Temperature 8.1.1 Near-surface temperatures 8.1.2 Temperature profiles 8.2 Gaseous humidity 8.2.1 Integral water vapour content 8.2.2 Vertical profiles 8.2.3 Large-scale humidity distribution 8.3 Wind and turbulence 8.3.1 Small-scale near-surface turbulence 8.3.2 Horizontal wind fields 8.3.3 Vertical wind profiles 8.3.4 Turbulence profiles 8.3.5 Cloud winds 8.3.6 Ionospheric winds 8.4 Mixing-layer heights 8.4.1 LIDAR 8.4.2 SODAR 8.5 Turbulent fluxes 8.6 Ionospheric electron densities 8.7 Recommendations for remote sensing of state variables 9 Remote sensing of water and ice 9.1 Precipitation 9.1.1 RADAR 9.1.2 Precipitation measurements from satellites 9.2 Clouds 9.2.1 Cloud base 9.2.2 Cloud cover 9.2.3 Cloud movement 9.2.4 Water content 9.3 Recommendations for remote sensing of liquid water and ice 10 Remote sensing of trace substances 10.1 Trace gases 10.1.1 Horizontal path-averaging methods 10.1.2 Vertical column densities 10.1.3 Sounding methods 10.2 Aerosols 10.2.1 Aerosol optical depths (AOD) 10.2.2 Sounding methods 10.3 Recommendations for remote sensing of trace substances 11 Remote sensing of surface properties 11.1 Properties of the solid surface 11.1.1 Surface roughness 11.1.2 Land surface temperature 11.1.3 Soil moisture 11.1.4 Vegetation 11.1.5 Snow and ice 11.1.6 Fires 11.2 Properties of the ocean surface 11.2.1 Altitudes of the sea surface 11.2.2 Wave heights 11.2.3 Sea surface temperature 11.2.4 Salinity 11.2.5 Ocean currents 11.2.6 Ice cover, size of ice floes 11.2.7 Algae and suspended sediment concentrations 12 Remote sensing of electrical phenomena 12.1 Spherics 12.1.1 Directional analyses 12.1.2 Distance analyses 12.2 Optical lightning detection 13 Outlook on new developments Literature Subject index Appendix: Technical guidelines and standards Index to the Appendix
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 58
    Monograph available for loan
    Monograph available for loan
    Berlin : Berliner Taschenbuch-Verl.
    Call number: PIK B 160-11-0101
    Type of Medium: Monograph available for loan
    Pages: 223 S.
    Edition: 8. Aufl.
    ISBN: 9783833303425
    Series Statement: BvT 342
    Uniform Title: The corrosion of character
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 59
    Call number: PIK A 130-10-0242
    Type of Medium: Monograph available for loan
    Pages: 131 S. : graph. Darst.
    Edition: Version 30.6.2010
    ISBN: 9783941492288
    Uniform Title: Guide to financial issues relating to indirect actions of the seventh framework programmes
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
    Monograph available for loan
    Monograph available for loan
    Santa Barbara [u.a.] : Praeger
    Call number: PIK P 120-11-0035
    Description / Table of Contents: Contents: Introduction ; Part I - The Fossil Sources ; 1. "King" oil ; 2. The splendor and misery of coal ; 3. All that gas ; 4. The quest to eliminate carbon dioxide ; Part II - The Alternatives ; 5. Nuclear power: renaissance or decline? ; 6. The weight of water ; 7. Biofuels: behind the smoke and mirrors ; 8. Gone with the wind? ; 9. The sun also rises ; 10. Geothermal power: the primitive energy of the earth ; 11. The hype about hydrogen, the hope about electric cars ; 12. Energy efficiency: the invisible source of energy ; Conclusions: how can we escape our energy trap?
    Type of Medium: Monograph available for loan
    Pages: XXXI, 259 S. : Ill.
    ISBN: 9780313381713
    Uniform Title: Con tutta l'energia possibile
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 61
    Call number: M 11.0097
    In: Nova Hedwigia / Beiheft, 136
    Description / Table of Contents: The present volume contains 21 papers presented at the Seventh International Chrysophyte Symposium 2008 spanning a broad range of topics on chrysophytes and related heterokont organisms. The contributions include ones on ecology, taxonomy, floristic works, phylogeny and evolution, molecular biology, physiology and paleolimnology. Of special interest are a group of papers that use geometric morphometric analyses to address taxonomic, biogeographic and phylogenetic questions related to chrysophytes and other microalgae. Ecological and floristic contributions include ones on lakes from the polar Ural Mountains, the Mesopotamia region of South America, the Pine Barrens of southern New Jersey, and the Swiss Alps. Gene sequences are used to study hidden diversity in Synura and differences between two geographically distinct Heterosigma isolates, and production of polyunsaturated aldehydes is examined in Thalassiosira. Other contributions include ones on mixotrophy, biofilm dynamics, the recent invasion of Mallomonas pseudocoronata into lakes in Sweden, use of cysts in climate change research, paleolimnology of eastern North American lakes, an evaluation of the age of the Hueyatlaco early man site in Mexico, a comparison of the architecture of Mallomonas scale coverings between modern and 40 Ma specimens and bloom dynamics. Papers outlining the establishment of a Wiki for chrysophyte cysts, an on-line database for Eocene chrysophyte fossils, and ideas f
    Type of Medium: Monograph available for loan
    Pages: 331 S. , Ill., graph. Darst., Kt.
    ISBN: 9783443510589
    Series Statement: Nova Hedwigia / Beiheft 136
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 62
    Monograph available for loan
    Monograph available for loan
    Köln : O'Reilly
    Call number: 18/M 11.0315
    Type of Medium: Monograph available for loan
    Pages: XI, 338 S. , Ill., graph. Darst.
    ISBN: 9783897219458
    Uniform Title: Version control with Git
    Classification:
    Informatics
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Monograph available for loan
    Monograph available for loan
    Footscray, Vic. : Lonely Planet
    Call number: 1.8/M 11.0071
    Type of Medium: Monograph available for loan
    Pages: 768 S.
    Edition: 8th ed.
    ISBN: 9781741791631
    Series Statement: Lonely Planet
    Classification:
    E.5.
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
    Monograph available for loan
    Monograph available for loan
    Heidelberg [u.a.] : Springer
    Call number: PIK M 390-16-89505
    Type of Medium: Monograph available for loan
    Pages: XVIII, 436 S. , graph. Darst. , 235 mm x 155 mm
    Edition: 4. ed., 2. corr. print.
    ISBN: 9783642142789 (PB.) , 9783642142796
    Series Statement: Graduate texts in mathematics 173
    Language: English
    Note: The basics -- Matching, covering and packing -- Connectivity -- Planar graphs -- Colouring -- Flows -- Extremal graph theory -- Infinite graphs -- Ramsey theory for graphs -- Hamilton cycles -- Random graphs -- Minors, trees, and WQO..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 65
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : VS, Verl. für Sozialwiss.
    Call number: IASS 15.89929
    Type of Medium: Monograph available for loan
    Edition: 3., aktualisierte Aufl.
    ISBN: 9783531166612
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Monograph available for loan
    Monograph available for loan
    Basingstoke, England : Palgrave Macmillan
    Call number: PIK B 160-16-90200
    Description / Table of Contents: This updated and revised edition outlines strategies and models for how to use technology and knowledge to improve performance, create jobs and increase income. It shows what skills will be required to produce, sell and manage performance over time, and how manual jobs can contribute to reduce the consumption of non-renewable resources
    Type of Medium: Monograph available for loan
    Pages: XXIII, 349 Seiten , graph. Darst.
    Edition: 2nd edition
    ISBN: 0230584667 (hbk.) , 9781349369195 (pbk.) , 9780230584662 (hbk.)
    Language: English
    Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    Call number: IASS 16.90470
    Type of Medium: Monograph available for loan
    Pages: V, 279 S.
    ISBN: 047052426X (hbk) , 9780470524268 (hbk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge Univ. Press
    Call number: IASS 16.90469
    Type of Medium: Monograph available for loan
    Pages: XVII, 314 S. , Ill., graph. Darst.
    ISBN: 0521198038 (hbk) , 9780521198035 (hbk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    Monograph available for loan
    Monograph available for loan
    Göttingen : Vandenhoeck & Ruprecht
    Call number: IASS 16.90478
    Type of Medium: Monograph available for loan
    Pages: 176 S.
    ISBN: 9783525367889
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Monograph available for loan
    Monograph available for loan
    University Park, Pa : Pennsylvania State University Press
    Call number: IASS 16.90520
    Description / Table of Contents: "An interdisciplinary study of democratic theory, empirical political science, psychology, and philosophy. Proposes a multidimensional process model of empathy that incorporates both affective and cognitive features to demonstrate the importance of empathy in fulfilling democracy's promise of giving equal consideration to all citizens in collective decisions"--Provided by publisher
    Type of Medium: Monograph available for loan
    Pages: viii, 221 S. , graph. Darst.
    ISBN: 9780271036595 (cloth) , 9780271036601 (pbk)
    Language: English
    Note: The democratic promiseThe deliberative turn in democratic theory -- The elusive concept of empathy -- Empathy in deliberative theory -- Empathy's importance : the empirical evidence -- Deliberative democracy and its critics -- Empathy and democracy..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Monograph available for loan
    Monograph available for loan
    Upper Saddle River, NJ : FT Press
    Call number: PIK N 454-16-89315
    Type of Medium: Monograph available for loan
    Pages: XXIII, 230 S. , Ill., graph. Darst.
    Language: English
    Note: Chapter 1 Not Another Crisis! -- Chapter 2 From Abundance to Scarcity in 25 Years -- Chapter 3 Causes of Water Scarcity -- Chapter 4 Climate Change and Water -- Chapter 5 Agriculture and Water -- Chapter 6 Water, Food, and Poverty -- Chapter 7 Integrating Water Planning and Management -- Chapter 8 Water Governance for People and the Environment -- Chapter 9 Water Rights and Water Costs -- Chapter 10 Solving the World’s Water Problems
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    Call number: IASS 16.89630/1
    Type of Medium: Monograph available for loan
    Pages: 107 S. , zahlr. Ill., graph. Darst. , 1 Bl. Bauanleitung - 1 Bl. Entwurf , 28 cm
    Language: German , English
    Note: Text dt. und engl. - Text in Faltbl. [1] dt.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
    Monograph available for loan
    Monograph available for loan
    Cambridge, Mass. [u.a.] : MIT Press
    Call number: PIK B 020-16-89772
    Type of Medium: Monograph available for loan
    Pages: XXVII, 1064 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 0262232588 (hbk.) , 9780262232586
    Language: English
    Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 74
    Monograph available for loan
    Monograph available for loan
    Newcastle upon Tyne, UK : Cambridge Scholars Publ.
    Call number: IASS 16.90610
    Type of Medium: Monograph available for loan
    Pages: xxviii, 341 p. , Ill., graph. Darst., Kt., Notenbeisp.
    ISBN: 144381959X (hbk.) , 9781443819596 (hbk.)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Monograph available for loan
    Monograph available for loan
    Berlin [u.a.] : Wichmann, VDE-Verl.
    Call number: 7/M 16.89668
    Type of Medium: Monograph available for loan
    Pages: XVIII, 668 S. , Ill., graph. Darst. , 25 cm
    Edition: 3., völlig neu bearb. und erw. Aufl.
    ISBN: 9783879074792 (GB)
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    Monograph available for loan
    Monograph available for loan
    [London] : Penguin Books
    Associated volumes
    Call number: IASS 17.91050
    In: Incerto
    Type of Medium: Monograph available for loan
    Pages: xxxiii, 444 Seiten , Illustrationen, Diagramme
    Edition: revised edition
    ISBN: 9780141034591
    Series Statement: Incerto / Nassim Nicholas Taleb
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Monograph available for loan
    Monograph available for loan
    London : Penguin Books
    Type of Medium: Monograph available for loan
    ISBN: 9780141985206
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    Call number: N 17.91148
    Description / Table of Contents: Viele sozialwissenschaftliche Untersuchungen beruhen auf Rekonstruktionen von Situationen oder Prozessen. Das Lehrbuch vermittelt anhand zweier Beispieluntersuchungen anwendungsbereites Wissen über alle Phasen solcher rekonstruierender Untersuchungen und stellt je eine Erhebungs- und eine Auswertungsmethode ausführlich vor. Die Interviewpartner werden als Experten aufgefasst, die über spezifisches Wissen über die zu rekonstruierenden Sachverhalte verfügen. Die qualitative Inhaltsanalyse ermöglicht eine systematische Extraktion relevanter Informationen aus den Interviews und ist zugleich offen für nicht erwartete Befunde. Mit Lernfragen nach jedem Kapitel und einer übersichtlichen Gliederung eignet sich das Buch als praxisorientierte Einführung.
    Type of Medium: Monograph available for loan
    Pages: 347 Seiten , Illustrationen, Diagramme , 21 cm
    Edition: 4. Auflage
    ISBN: 3531172387 (Pb.) , 9783531172385 (Pb.)
    Series Statement: Lehrbuch
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
    Monograph available for loan
    Monograph available for loan
    Berlin : Suhrkamp
    Call number: IASS 18.91432
    Type of Medium: Monograph available for loan
    Pages: 498 S.
    Edition: 1. Aufl.
    ISBN: 9783518585412 (GB.)
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 80
    Monograph available for loan
    Monograph available for loan
    Minneapolis [u.a.] : Univ. of Minnesota Press
    Call number: IASS 18.91835
    Type of Medium: Monograph available for loan
    Pages: VIII, 299 S. , 22x14x2 cm
    ISBN: 9780816656875 , 9780816656868 , 0816656878
    Series Statement: Posthumanities 9
    Uniform Title: Cosmopolitiques 〈engl.〉
    Language: English
    Note: Aus dem Franz. übers.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Call number: AWI A3-20-93434-2
    In: Meteorologische Abhandlungen / Institut für Meteorologie und Geophysik der Freien Universität Berlin, Band XXXII, Heft 2
    Type of Medium: Series available for loan
    Pages: 218 Seiten , Illustrationen
    Series Statement: Meteorologische Abhandlungen / Institut für Meteorologie und Geophysik der Freien Universität Berlin 32,2
    Language: German
    Note: Zugleich: Dissertation, Freie Unversität Berlin, [ca. 1963] , INHALTSVERZEICHNIS PROBLEMSTELLUNG UND ZIELSETZUNG 1. BEMERKUNGEN ZUM BEOBACHTUNGSGELÄNDE UND ZUM BEOBACHTUNGSMATERIAL 1.1 Das Beobachtungsgelände 1.2 Das Beobachtungsmaterial 2. HOMOGENITÄTSBETRACHTUNGEN 2.1 Temperatur 2.2 Niederschlag 2.3 Wind 2.4 Sonnenschein und Bewölkung 3. TEMPERATURVERHÄLTNISSE 3.1 Monats- und Jahreswerte 3.2 Tageswerte 3.3 Pentadenwerte 3.4 Häufigkeitsbetrachtungen 3.5 Interdiurne Veränderlichkeit 3.6 Der tägliche Gang 3.7 Vorkommen bestimmter Schwellenwerte 3.71 Frost- und Eistage 3.72 Sommer- und Tropentage 4. DER WASSERGEHALT DER LUFT 4.1 Monats- und Jahreswerte 4.2 Tageswerte 4.3 Häufigkeitsbetrachtungen 4.4 Interdiurne Veränderlichkeit 4.5 Der tägliche Gang 5. BEWÖLKUNGSVERHÄLTNISSE 5.1 Monats- und Jahreswerte 5.2 Tageswerte 5.3 Häufigkeitsbetrachtungen 5.4 Der tägliche Gang 5.5 Heitere und trübe Tage 5.6 Nebel 6. SONNENSCHEIN 6.1 Monats- und Jahreswerte 6.2 Tageswerte 6.3 Der tägliche Gang 7. NIEDERSCHLAGSVERHÄLTNISSE 7.1 Monats- und Jahreswerte 7.2 Niederschlagsbereitschaft 7.3 Tageswerte 7.4 Der tägliche Gang 7.5 Häufigkeitsbetrachtungen 7.6 Niederschlags- und Trockenperioden 7.7 Niederschlag und Wind· 7.8 Schneeverhältnisse 7.81 Schneefall und Schneedecke 7.82 Schneehöhe 7.9 Gewitter 8. WINDVERHÄLTNISSE 8.1 Windrichtung 8.2 Windgeschwindigkeit 8.21 Der jährliche Gang 8.22 Häufigkeitsbetrachtungen 8.23 Sturmtage und Windstillen 8.24 Der tägliche Gang 9.ZUSAMMENFASSUNG VERZEICHNIS DER TEXTTABELLEN VERZEICHNIS DER ABBILDUNGEN LITERATURVERZEICHNIS TABELLENANHANG
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Call number: AWI A3-20-93434
    In: Meteorologische Abhandlungen / Institut für Meteorologie und Geophysik der Freien Universität Berlin, Band XXXII, Heft 1
    Type of Medium: Series available for loan
    Pages: 121 Seiten , Illustrationen
    Series Statement: Meteorologische Abhandlungen / Institut für Meteorologie und Geophysik der Freien Universität Berlin 32,1
    Language: German
    Note: Zugleich: Dissertation, Freie Unversität Berlin, [ca. 1963] , INHALTSVERZEICHNIS PROBLEMSTELLUNG UND ZIELSETZUNG 1. BEMERKUNGEN ZUM BEOBACHTUNGSGELÄNDE UND ZUM BEOBACHTUNGSMATERIAL 1.1 Das Beobachtungsgelände 1.2 Das Beobachtungsmaterial 2. HOMOGENITÄTSBETRACHTUNGEN 2.1 Temperatur 2.2 Niederschlag 2.3 Wind 2.4 Sonnenschein und Bewölkung 3. TEMPERATURVERHÄLTNISSE 3.1 Monats- und Jahreswerte 3.2 Tageswerte 3.3 Pentadenwerte 3.4 Häufigkeitsbetrachtungen 3.5 Interdiurne Veränderlichkeit 3.6 Der tägliche Gang 3.7 Vorkommen bestimmter Schwellenwerte 3.71 Frost- und Eistage 3.72 Sommer- und Tropentage 4. DER WASSERGEHALT DER LUFT 4.1 Monats- und Jahreswerte 4.2 Tageswerte 4.3 Häufigkeitsbetrachtungen 4.4 Interdiurne Veränderlichkeit 4.5 Der tägliche Gang 5. BEWÖLKUNGSVERHÄLTNISSE 5.1 Monats- und Jahreswerte 5.2 Tageswerte 5.3 Häufigkeitsbetrachtungen 5.4 Der tägliche Gang 5.5 Heitere und trübe Tage 5.6 Nebel 6. SONNENSCHEIN 6.1 Monats- und Jahreswerte 6.2 Tageswerte 6.3 Der tägliche Gang 7. NIEDERSCHLAGSVERHÄLTNISSE 7.1 Monats- und Jahreswerte 7.2 Niederschlagsbereitschaft 7.3 Tageswerte 7.4 Der tägliche Gang 7.5 Häufigkeitsbetrachtungen 7.6 Niederschlags- und Trockenperioden 7.7 Niederschlag und Wind· 7.8 Schneeverhältnisse 7.81 Schneefall und Schneedecke 7.82 Schneehöhe 7.9 Gewitter 8. WINDVERHÄLTNISSE 8.1 Windrichtung 8.2 Windgeschwindigkeit 8.21 Der jährliche Gang 8.22 Häufigkeitsbetrachtungen 8.23 Sturmtage und Windstillen 8.24 Der tägliche Gang 9.ZUSAMMENFASSUNG VERZEICHNIS DER TEXTTABELLEN VERZEICHNIS DER ABBILDUNGEN LITERATURVERZEICHNIS TABELLENANHANG
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Monograph available for loan
    Monograph available for loan
    Berlin [u.a.] : Springer
    Call number: IASS 20.94047
    Type of Medium: Monograph available for loan
    Pages: XVII, 244 S. , Ill., graph. Darst.
    ISBN: 9783642082412
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Call number: AWI P5-20-94099
    Type of Medium: Monograph available for loan
    Pages: 384 Seiten , Illustrationen , 24 cm
    ISBN: 9783830517504 (kart.)
    Language: English
    Note: Content The Arctic: A Strategic Challenge for the 21st Century / Gunter Gloser Opportunities and Responsibilities in the Arctic Region: The European Union's Perspective / Joe Borg The First Responsibility / Aqqaluk Lynge An Explorer's Perspective / Arved Fuchs New Chances and New Responsibilities in the Arctic Region: An Introduction / Georg Witschel The Arctic in the Context of International Law / Rüdiger Wolfrum Arctic in Change: New Prospects for Resource Exploitation and Maritime Traffic / Kirsten Ullbæk Selvig UArctic - A Most Welcome Tool / Erling Olsen Sustainable Development in the Arctic: New Social Challenges and Responsibilities / Rasmus Ole Rasmussen Managing Towards Sustainability in the Arctic: Some Practical Considerations / Brooks B. Yeager The Environmental and Research Challenges in the Arctic / Reinhard Priebe Towards a Canadian Arctic Strategy / Franklyn Griffiths The Changing Arctic: New Perspectives for the Use of Resources and Transport Routes / Baron Rüdiger von Fritsch An International Governance Framework for the Arctic: Challenges for International Public Law / Peter Taksøe-Jensen The Legal Regime of the Arctic Ocean / Thomas H. Heidar An International Governance Framework for the Arctic: Challenges for International Public Law - A Danish Perspective / Thomas Winkler Strategie and Environmental Impact Assessment in Promoting Sustainable Development in the Changing Arctic / Paula Kankaanpää Research for the Future of the Arctic / Karin Lochte Integrated Arctic Ocean Governance for the Lasting Benefit of All Humanity / Paul Arthur Berkman Resource Exploitation and Navigation in a Changing Arctic / Louwrens Hacquebord Developing International Law Teachings for Preventing Inter-State Disaccords in the Arctic Ocean / Alexander L. Vylegzhanin The Call for Good Governance in the Arctic Ocean - the Legal Framework and the Development of Policies to Meet Rising Challenges and Emerging Opportunities / Rolf Einar Fife International Law and Scientific Research in the Arctic - the Role of Science in Law and the Role of Law in Science / Marie Jacobsson The Challenge of Climate Security in the Arctic Region / Dennis Tänzler Chairman's Conclusions / Georg Witschel Current Endeavors with Respect to the Arctic Ocean: New Challenges for International Law and Politics / Georg Witschel/Ingo Winkelmann Annex Conference Programme List of Participants List of Abbreviations
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Call number: IASS 22.95032
    Type of Medium: Monograph available for loan
    Pages: 352 S. , graph. Darst., Kt.
    ISBN: 9783899981797
    ISSN: 1610-6326
    Series Statement: Berliner Beiträge zur Ökologie 5
    Language: English
    Note: Zugl.: Berlin, TU, Fakultät VII - Wirtschaft und Management, Diss., 2009
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    Call number: IASS 22.95033
    Type of Medium: Monograph available for loan
    Pages: 378 S , 225 mm x 135 mm
    ISBN: 3899421876 , 978-3-89942-187-3
    Series Statement: Edition panta rei
    Language: German
    Note: Zugl.: Marburg (Lahn), Univ., Habil.-Schr., 2004 u.d.T.: Gutmann, Mathias: Die Medialität des Erfahrens
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Call number: IASS 17.91036
    Type of Medium: Monograph available for loan
    Pages: XXIII, 523 S. , Ill., graph. Darst.
    ISBN: 9780970950062 (pbk.)
    Series Statement: Contemporary issues series
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Call number: IASS 16.91047
    Type of Medium: Monograph available for loan
    Pages: XX, 408 S. , graph. Darst , 235 mm x 155 mm
    ISBN: 9789048199044 , 9789048199051 (eBook)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Call number: IASS 17.91169
    Type of Medium: Monograph available for loan
    Pages: XXVI, 246 S. , Ill., graph. Darst., Kt
    Edition: first paperback
    ISBN: 9781138967038 (pbk) , 9781844078486 (hbk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Call number: 5/M 18.91371
    In: Space science series of ISSI
    Type of Medium: Monograph available for loan
    Pages: 664 Seiten , Ill., graph. Darst., Kt. , 235 mm x 155 mm
    ISBN: 9781441959003
    Series Statement: Space Sciences Series of ISSI 33
    Classification:
    Geomagnetism, Geoelectromagnetism
    Language: English
    Note: Planetary magnetism : foreword / A. Balogh ... [et al.] -- Space exploration of planetary magnetism / N.F. Ness -- Planetary magnetic field measurements : missions and instrumentation / A. Balogh -- Current systems in planetary magnetospheres and ionospheres / W. Baumjohann ... [et al.] -- Separation of the magnetic field into external and internal parts / N. Olsen, K.-H. Glassmeir, X. Jia -- The magnetic field of planet Earth / G. Hulot ... [et al.] -- Crustal magnetic fields of terrestrial planets / B. Langlais ... [et al.] -- Magnetic fields of the outer planets / C.T. Russell, M.K. Dougherty -- Magnetic fields of the satellites of Jupiter and Saturn / X. Jia ... [et al.] -- The magnetic field of mercury / B.J. Anderson ... [et al.] -- Paleomagnetic records of meteorites and early planetesimal differentiation / B.P. Weiss ... [et al.] -- Induced magnetic fields in solar system bodies / J. Saur, f.M. Neubauer, K.-H. Glassmeier -- The interior structure, composition, and evolution of giant planets / J.J. Fortney, N. Nettelmann -- Thermal evolution and magnetic field generation in terrestrial planets and satellites / D. Breuer, S. Labrosse, T. Spohn -- Theory and modeling of planetary dynamos / J. Wicht, A. Tilgner -- Laboratory dynamo experiments / G. Verhille ... [et al.] -- Dynamo scaling laws and applications to the planets / U.R. Christensen -- The solar dynamo / C.A. Jones, M.J. Thompson, S.M. Tobias -- Dynamo models for planets other than Earth / S. Stanley, G.A. Glatzmaier -- Planetary magnetic fields : achievements and prospects / D.J. Stevenson..
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Monograph available for loan
    Monograph available for loan
    Cambridge, Mass [u.a.] : MIT Press
    Call number: IASS 17.91244
    Type of Medium: Monograph available for loan
    Pages: XII, 240 S. , Ill., graph. Darst., Kt.
    ISBN: 9780262013482 (hc)
    Series Statement: Inside technology
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    Monograph available for loan
    Monograph available for loan
    Hoboken, NJ : Wiley
    Call number: IASS 17.91255
    Type of Medium: Monograph available for loan
    Pages: XI, 396 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 9780470082898 (cloth)
    Series Statement: Wiley series in probability and statistics
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Monograph available for loan
    Monograph available for loan
    College Station, Tex. : Stata Press
    Call number: IASS 17.91256
    Type of Medium: Monograph available for loan
    Pages: xlii, 706 S. , graph. Darst. , 24 cm
    Edition: Rev. ed.
    ISBN: 1597180734 , 9781597180733
    Series Statement: A Stata Press publication
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Journal available for loan
    Journal available for loan
    München : Altop Verlag ; 2007 -
    Call number: Z 19.92410
    Type of Medium: Journal available for loan
    Pages: 30 cm
    ISSN: 1865-4266
    Former Title: Vorg. Nachhaltiges Wirtschaften in Deutschland
    Language: German
    Note: Ungezählte Beil. ab 2010: Special , Ersch. jährl. 4x
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    Call number: AWI G3-19-92469
    Type of Medium: Monograph available for loan
    Pages: 68 Seiten , Illustrationen
    Language: English , French
    Note: Content Foreword Preface 1 – The PERMAFrance network 1.1 – Objectives 1.2 – Structure and partners 1.3 – Monitoring sites 2 – Permafrost in the French mountains 2.1 – Distribution of permafrost in France 2.2 – Monitoring sites 3 – Weather and climate 3.1 – Climatic trends of the last 4 decades 3.2 – Annual weather summary 2002-2009 3.3 – Summary of nivo-meteorological conditions 4 – Surface temperature on surficial deposits 4.1 – BTS datasets 4.2 – GST datasets 5 – Geodetic measurements and surface dynamics of rock glaciers 5.1 – GPS & total station 5.2 – LIDAR 6 – Rockfalls and evolution of rockfaces 6.1 – LiDAR datasets for rockwalls in the Mont Blanc massif 6.2 – Rockfall inventories in the Mont Blanc massif 7 – References / Bibliographie , In englischer und französischer Sprache
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Monograph available for loan
    Monograph available for loan
    Frankfurt am Main : Suhrkamp
    Associated volumes
    Call number: M 19.92569
    In: Sphären
    Type of Medium: Monograph available for loan
    Pages: 916 Seiten , Illustrationen
    Edition: 7. Auflage
    ISBN: 978-3-518-41466-8
    Series Statement: Sphären 3
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    Call number: AWI A4-19-20532
    Type of Medium: Monograph available for loan
    Pages: 36 Seiten , Illustrationen
    Language: German
    Note: Inhalt Vorwort Einleitung: Unser Klima aus der Polarperspektive Verbessertes Verständnis arktischer Klimaänderungen durch Messungen und Modellierung Physikalische Prozesse in der polaren Atmosphäre Langzeit-Messreihen zeigen: Ozonschicht über der Antarktis konnte sich noch nicht erholen Arktischer Meereisrückgang verursacht Anomalien in Ozean und Atmosphäre HAFOS erfasst längerfristige Veränderungen im Ozean Meereisspiegel im Nordatlantik in nur 15 Jahren um 6 cm gestiegen Eis im Klimawandel Erderwärmung gefährdet die Permafrost-regionen und damit das globale Klimasystem Marine Klimaarchive – Aus der Vergangenheit lernen, um den Blick in die Zukunft zu schärfen Paläoklimamodelle: Zurück in die Zukunft Marines Plankton beeinflusst das globale Klima Die regionalen Auswirkungen des Klimawandels rücken in den Blickpunkt Das World Radiation Monitoring Center am AWI: weltweite Datenzentrale der Erdsystemforschung Klimaberatung: regionalspezifisch, verständlich, solide – das Helmholtz-Klimabüro am AWI Die stationären und mobilen Infrastrukturen des Alfred-Wegener-Instituts in Arktis und Antarktis Ansprechpartner im AWI, Impressum
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Call number: IASS 19.92560
    Type of Medium: Monograph available for loan
    Pages: X, 275 Seiten
    ISBN: 0415439787 , 9780415439787 , 0415574560 , 9780415574563
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Call number: S 01.0495(67,1-2)
    In: Eiszeitalter und Gegenwart
    Type of Medium: Series available for loan
    Pages: 84 Seiten , Illustrationen, Diagramme, Karten , 21 x 29,7 cm
    ISSN: 0424-7116
    Series Statement: Eiszeitalter und Gegenwart Vol 67, No. 1-2
    Language: English
    Note: Editorial E&G Quaternary Science Journal, Vol. 67 (2018) Christopher Lüthgens and Margot Böse E&G Quaternary Sci. J., 67, 85-86, 2019. 〈a href="https://doi.org/10.5194/egqsj-67-85-2019" target="_blank"〉https://doi.org/10.5194/egqsj-67-85-2019〈/a〉 , Middle to Late Holocene mobilization of DOC-bound Pb and Y in the Magellanic moorlands (53° S) as a function of sea spray fertilization, climate variations and volcanic fallout? A preliminary report Björn Klaes, Rolf Kilian, Gerhard Wörner, Sören Thiele-Bruhn, and Helge W. Arz E&G Quaternary Sci. J., 67, 1-6, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-1-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-1-2018〈/a〉 , Capability of U–Pb dating of zircons from Quaternary tephra: Jemez Mountains, NM, and La Sal Mountains, UT, USA Jana Krautz, Mandy Hofmann, Andreas Gärtner, Ulf Linnemann, and Arno Kleber E&G Quaternary Sci. J., 67, 7-16, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-7-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-7-2018〈/a〉 , Reconsidering the origin of the Sedrun fans (Graubünden, Switzerland) Catharina Dieleman, Susan Ivy-Ochs, Kristina Hippe, Olivia Kronig, Florian Kober, and Marcus Christl E&G Quaternary Sci. J., 67, 17-23, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-17-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-17-2018〈/a〉 , Disestablishing “Glacial Lake Speight”, New Zealand? An example for the validity of detailed geomorphological assessment with the study of mountain glaciations Stefan Winkler, David Bell, Maree Hemmingsen, Kate Pedley, and Anna Schoch E&G Quaternary Sci. J., 67, 25-31, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-25-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-25-2018〈/a〉 , Proglacial streams and their chronology in the glacier forefields of the Himalayas Gerrit Tombrink E&G Quaternary Sci. J., 67, 33-36, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-33-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-33-2018〈/a〉 , Glacial history of the upper Drac Blanc catchment (Écrins massif, French Alps) Felix Martin Hofmann E&G Quaternary Sci. J., 67, 37-40, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-37-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-37-2018〈/a〉 , New data from the Middle Palaeolithic Cotencher cave (Swiss Jura): site formation, environment, and chronology Judit Deák, Frank Preusser, Marie-Isabelle Cattin, Jean-Christophe Castel, and François-Xavier Chauvière E&G Quaternary Sci. J., 67, 41-72, 2019. 〈a href="https://doi.org/10.5194/egqsj-67-41-2019" target="_blank"〉https://doi.org/10.5194/egqsj-67-41-2019〈/a〉 , Fortification, mining, and charcoal production: landscape history at the abandoned medieval settlement of Hohenwalde at the Faule Pfütze (Saxony, Eastern Ore Mountains) Johann Friedrich Tolksdorf, Matthias Schubert, Frank Schröder, Libor Petr, Christoph Herbig, Petr Kočár, Mathias Bertuch, and Christiane Hemker E&G Quaternary Sci. J., 67, 73-84, 2019. 〈a href="https://doi.org/10.5194/egqsj-67-73-2019" target="_blank"〉https://doi.org/10.5194/egqsj-67-73-2019〈/a〉
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Call number: IASS 20.93621
    Description / Table of Contents: The Global Redesign Initiative was a global, multistakeholder dialogue on the future of international cooperation. Set up in the midst of the global financial crisis, its purpose was to stimulate thinking and debate about how the international community and its institutions and organizations in their widest sense can be adapted to contemporary challenges. The distillation of this process has helped the Forum's many communities to develop proposals that seek to highlight potential responses to the challenge of adapting to a new global business and social environment.
    Type of Medium: Monograph available for loan
    Pages: 452 Seiten , Illustrationen
    ISBN: 978-92-95044-92-4
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...