ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

X
feed icon rss

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • Books  (74)
  • English  (47)
  • German  (29)
  • Polish
  • Swedish
  • 2020-2024
  • 2010-2014  (74)
  • 2005-2009
  • 1950-1954
  • 2014  (47)
  • 2010  (27)
  • 1988
  • A 18 - must be ordered  (64)
  • Lower compact magazine  (10)
Collection
  • Books  (74)
Source
Publisher
Language
  • English  (47)
  • German  (29)
  • Polish
  • Swedish
  • Spanish  (1)
Years
  • 2020-2024
  • 2010-2014  (74)
  • 2005-2009
  • 1950-1954
  • 1985-1989  (468)
Year
Classification
Branch Library
Reading Room Location
  • 1
    Monograph available for loan
    Monograph available for loan
    The empire of value : a new foundation for economics (2014)
    Cambridge [u.a.] : MIT Press
    Details Availability
    Call number: PIK B 140-14-0148
    Description / Table of Contents: Contents: Introduction ; Part 1 Critique of Political Economy ; 1 Substance value ; 2 Market objectivity ; 3 Scarcity and status ; Part 2 The Institution of Value ; 4 Money ; 5 A new approach to value ; Part 3 Market Finance ; 6 Financial valuation ; 7 Liquidity and speculation ; Part IV Self-referential Finance and the Subprime Crisis ; 8 Euphoria: 2003 to 2007 ; 9 The crisis: 2007 to 2008 ; Conclusion
    Type of Medium: Monograph available for loan
    ISBN: 9780262026970
    Uniform Title: Empire de la valeur.
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 2
    Monograph available for loan
    Monograph available for loan
    Warnsignal Klima : die Polarregionen ; [Gebiete höchster Empfindlichkeit mit weltweiter Wirkung] ; [Wissenschaftliche Fakten] (2014)
    Hamburg : Wissschaftliche Auswertungen
    Details Availability
    Call number: AWI P1-14-0015 ; PIK N 454-14-0080
    Description / Table of Contents: Contents: - 1 Land, Leute und Bodenschätze. - 1.1 Die Arktis und ihre Grenzen: eine physisch-geographische Einführung. - 1.2 Geologische Entwicklung und tektonischer Bau der Antarktis. - 1.3 Geschichte der antarktischen Entdeckungen. - 1.4 Abriss der Geschichte der Entdeckung der Arktis. - 1.5 Die indigenen Völker im Norden: frühere und gegenwärtige Entwicklungen. - 1.6 Die mittelalterliche Besiedlung Westgrönlands durch die Wikinger - ein fehlgeschlagenes Experiment?. - 1.7 Permafrost - ein weit verbreitetes Klimaphänomen der Arktis und Subarktis. - 1.8 Die Geologie der Arktis, ihre Bodenschätze und ihr rechtlicher Status. - 2 Meeresströmung, Stürme und Eis. - 2.1 Struktur, Dynamik und Bedeutung des antarktischen Wasserringes. - 2.2 Wassermassenänderungen im Arktischen Ozean. - 2.3 Änderungen in der Nordatlantischen Tiefenwasserbildung und ihre Auswirkungen auf das Europäische Klima. - 2.4 Roaring Forties und Riesenwellen - Gefahren im Südpolarmeer. - 2.5 Polare Mesozyklonen: Die Hurrikane der Polargebiete. - 2.6 Die Wechselwirkung zwischen antarktischen Schelfeisgebieten und dem Ozean und der Beitrag zur ozeanischen Wassermassenbildung. - 2.7 Die Massenbilanzen des antarktischen und grönländischen Inlandeises und der Charakter ihrer Veränderungen. - 2.8 Veränderung der Dicke und Ausdehnung des Polarmeereises. - 3 Flora, Fauna und Ökosysteme. - 3.1 Flora und Vegetation des terrestrischen Bereichs. - 3.2 Ökophysiologie und Wachstum arktischer Pflanzen im Klimawandel. - 3.3 Das Meereis als Lebensraum. - 3.4 Einfluss von Fischerei und Klima auf die Bestände des antarktischen Krill. - 3.5 Klimabedingte ökologische Veränderungen in den Bodenfaunen polarer Schelfmeere. - 3.6 Die Fische des Nord- und Südpolarmeeres. - 3.7 Vogelwelt der Polarregionen und ihre Gefährdung. - 3.8 Robben und Robbenschlag in der Antarktis. - 3.9 Arktische Robben und Eisbären - Auswirkungen von Klimaerwärmung und Ressourcennutzung. - 3.10 Warnsignale Walfang. - 3.11 Marine Biodiversität in den Polarregionen nach der Volkszählung der Meere. - 4 Das Weltklima und die Polarregionen. - 4.1 Wechselwirkungen zwischen arktischem Meereis und der atmosphärischen Zirkulation. - 4.2 Niederschläge in den Polarregionen und ihre Erfassung. - 4.3 Atmosphärische Messungen an der AWIPEV Station Spitzbergen. - 4.4 Das Polarlicht. - 4.5 Erwärmung der Polarregionen in den letzten 50 Jahren: Ursachen und Folgen. - 4.6 Verhalltes Warnsignal: Die Erwärmung ds Nordpolargebietes während der ersten Hälfte des 20. Jahrhunderts. - 4.7 Die Rolle ozeanischer Wärmetransporte für das Klima der Arktis im letzten Jahrtausend. - 4.8 Polareiskerne - Archive globaler Klima- und Umweltveränderungen. - 4.9 Die polaren Meeressedimente als Archiv des Weltklimas. - 4.10 Der katabatische Wind über den polaren Eisschilden. - 4.11 Meeresspiegelanstieg - Eisschilde, Gletscher und thermische Ausdehnung: eine kurze Übersicht. - 4.12 Anmerkungen über Veränderungen in den Eisströmen der Eisschilde. - 4.13 Permafrostbeeinflusste Böden (Kryosole) im Klimawandel. - 4.14 Methanhydrate in arktischen Sedimenten - Einfluss auf Klima und Stabilität der Kontinentalränder. - 5 Forschung, Gefährdung und Schutz. - 5.1 Über die deutschen Forschungsaktivitäten in den Polarregionen. - 5.2 Rückgang des Ozons in der Stratosphäre der Polarregionen. - 5.3 Ausbreitung von Schadstoffen in die Polarregionen. - 5.4 Anreicherung und Effekte von organischen Schadstoffen in der polaren Umwelt. - 5.5 Tourismus und seine Auswirkungen. - 5.6 Globale Gefahren durch intensive Nutzung der Taiga-Wälder. - 5.7 Die Nutzung von Öl- und Gasvorkommen in einer nahezu eisfreien Arktis. - 5.8 Antarktis im Spannungsfeld zwischen Forschung, Tourismus und Umweltschutz. - 5.9 Meeresschutzgebiete in der Antarktis: Lassen sich Schutz- und Fischerei-Interessen verbinden?. - 5.10 Gebietsstreitigkeiten in der Arktis - Ist eine friedliche Beilegung mittels Abgrenzung erreichbar?. - 5.11 Umweltschutz in einer Arktis im Wandel. - 6 Sachregister.
    Description / Table of Contents: Die Polarregionen üben trotz ihrer abgelegenen Lage einen erheblichen Einfluss auf das Weltklima aus. Dies hängt besonders mit den bedeutenden Kopplungsprozessen zwischen dem Eis (Eisschilde, Meereis, Schnee und Permafrost) und der atmosphärischen sowie ozeanischen Zirkulation zusammen. Das Abschmelzen aller polaren Eisschilde würde beispielsweise einen globalen Anstieg des Meeresspiegels um etwa 70 m bewirken. Aber auch schon geringe Schwankungen im polaren Eisvolumen führen zu merklichen Veränderungen des Meeresspiegels. Die Klima-Prognosen der letzen Jahre haben sich weitgehend bestätigt. Die heutigen Messungen zeigen sogar, dass sich das Klima eher schneller ändert als erwartet. Die beobachtete Erderwärmung während des 20. Jahrhunderts hat sich in diesem Jahrhundert fortgesetzt; zurzeit beträgt die mittlere globale Erwärmung über den Kontinenten bereit 0,9°C. Diese Entwicklung wird sich fortsetzen, wenn die Anreicherung der Atmosphäre mit Treibhausgasen (vor allem CO2) anhält. Besorgniserregend ist die Tatsache, dass die heute emittierten CO2-Mengen Jahrhunderte in der Atmosphäre verbleiben. Die Folgen des Klimawandels sind vielfältig. Der Meeresspiegelanstieg stieg von 1,7 mm/Jahr in den 1970/80er Jahren auf jetzt 3 mm/Jahr. Der 5. Sachstandsbericht des IPCC (2013) gibt für den Zeitraum 1993 - 2010 einen globalen mittleren Meeresspiegelanstieg von 3,2 mm/Jahr an. Viele Inselstaaten und tief gelegene Küstenländer, die am wenigsten zur Erderwärmung beitragen, werden am härtesten von den Folgen betroffen sein. Sie sind nicht in der Lage, sich mit Dämmen zu schützen. Die Erwärmung ist am stärksten in der nördlichen Polarregion. Die eisbedeckte Fläche hat sich dort fast halbiert. Auch der Westantarktische Eisschild schrumpft; dort gehen 180 km3 Eis jährlich verlären. Zahlreiche polare Arten, zum Beispiel der Eisbär, drohen ihre Lebensräume zu verlieren. Wir befinden uns bereits jetzt in einem Klimawandel, der bei ungenügendem Klimaschutz zu Temperaturen führen kann, die die Erde seit mindestens einer Million Jahre nicht mehr erlebt hat. Studien zeigen, dass der Mensch maßgeblich für den jetzigen Klimawandel verantwortlich ist. Mit diesen und anderen Themen befassen sich rund 100 Experten im vorliegenden Buch. Die Beiträge sind leicht verständlich geschrieben.
    Type of Medium: Monograph available for loan
    Pages: 375 Seiten , Illustrationen
    ISBN: 9783980966863
    URL: https://www.klima-warnsignale.uni-hamburg.de/polarregionen/
    Language: German
    Location: AWI Reading room
    Location: A 18 - must be ordered
    Branch Library: AWI Library
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 3
    Monograph available for loan
    Monograph available for loan
    King Cotton : eine Globalgeschichte des Kapitalismus (2014)
    München : Beck
    Details Availability
    Call number: PIK B 200-14-0176
    Description / Table of Contents: Contents: Kapitel 1 Aufstieg eines globalen Rohstoffs ; Kapitel 2 Der Aufbau des Kriegskapitalismus ; Kapitel 3 Der Lohn des Kriegskapitalismus ; Kapitel 4 Jagd nach Arbeitern und Eroberung von Land ; Kapitel 5 Die Sklaverei auf dem Vormarsch ; Kapitel 6 Der Industriekapitalismus im Aufwind ; Kapitel 7 Die Mobilisierung von Fabrikarbeitern ; Kapitel 8 Die Bildung globaler Netzwerke ; Kapitel 9 Ein Krieg und sein weltweiter Widerhall ; Kapitel 10 Der Umbau des Baumwollimperiums ; Kapitel 11 Kreative Zerstörungen ; Kapitel 12 Unter nationaler Flagge: der neue Baumwollimperialismus ; Kapitel 13 Rückkehr in den globalen Süden ; Kapitel 14 Kette und Schuss. Ein Epilog
    Type of Medium: Monograph available for loan
    Pages: 525 S. : Ill., graph. Darst., Kt.
    ISBN: 9783406659218
    Uniform Title: Empire of cotton
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 4
    Monograph available for loan
    Monograph available for loan
    Multivariate analysis of ecological data using Canoco 5 (2014)
    Cambridge [u.a.] : Cambridge Univ. Press
    Details Availability
    Call number: AWI S2-14-0042 ; M 15.0198
    Description / Table of Contents: This revised and updated edition focuses on constrained ordination (RDA, CCA), variation partitioning and the use of permutation tests of statistical hypotheses about multivariate data. Both classification and modern regression methods (GLM, GAM, loess) are reviewes and species functional traits and spatial structures are analysed. Nine case studies of varying difficulty help to illustrate the suggestes analytical methods, using the latest version of Canoco 5. All studies utilise descriptive and manipulative approaches, and are supported by data sets and project files available from the book website: http://regent.prf.jcu.cz/maed2/. Written primarily for community ecologists needing to analyse data resulting from field observations and experiments, this book is a valuable resource for students and researchers dealing with both simple and complex ecological problems, such as the variation of biotic communities with environmental conditions or their response to experimental manipulation.
    Type of Medium: Monograph available for loan
    Pages: XII, 362 S. : Ill., graph. Darst.
    Edition: 2. ed.
    ISBN: 9781107694408 , 1-107-69440-X
    URL: http://regent.prf.jcu.cz/maed2/
    Language: English
    Note: Contents: Preface. - 1 Introduction and datatypes. - 1.1 Why ordination?. - 1.2 Datatypes. - 1.3 Data transformation and standardisation. - 1.4 Missing values. - 1.5 Types of analyses. - 2 Using Canoco 5. - 2.1 Philosophy of Canoco 5. - 2.2 Data import and editing. - 2.3 Defining analyses. - 2.4 Visualising results. - 2.5 Beware, CANOCO 4.x users!. - 3 Experimental design. - 3.1 Completely randomised design. - 3.2 Randomised complete blocks. - 3.3 Latin square design. - 3.4 Pseudo replicates. - 3.5 Combining more than one factor. - 3.6 Following the development of objects in time: repeated observations. - 3.7 Experimental and observational data. - 4 Basics of gradient analysis. - 4.1 Techniques of gradient analysis. - 4.2 Models of response to gradients. - 4.3 Estimating species optima by weighted averaging. - 4.4 Calibration. - 4.5 Unconstrained ordination. - 4.6 Constrained ordination. - 4.7 Basic ordination techniques. - 4.8 Ordination axes as optimal predictors. - 4.9 Ordination diagrams. - 4.10 Two approaches. - 4.11 Testing significance of the relation with explanatory variables. - 4.12 Monte Carlo permutation tests for the significance of regression. - 4.13 Relating two biotic communities. - 4.14 Community composition as a cause: using reverse analysis. - 5.1 Permutation tests: the philosophy. - 5.2 Pseudo-F statistics and significance. - 5.3 Testing individual constrained axes. - 5.4 Tests with spatial or temporal constraints. - 5.5 Tests with hierarchical constraints. - 5.6 Simple versus conditional effects and stepwises election. - 5.7 Variation partitioning. - 5.8 Significance adjustment for multiple tests. - 6 Similarity measures and distance-based methods. - 6.1 Similarity measures for presence-absence data. - 6.2 Similarity measures for quantitative data. - 6.3 Similarity of cases versus similarity of communities. - 6.4 Similarity between species in trait values. - 6.5 Principal coordinates analysis. - 6.6 Constrained principal coordinates analysis (db-RDA). - 6.7 Non-metric multidimensional scaling. - 6.8 Mantel test. - 7.1 Example data set properties. - 7.2 Non-hierarchical classification (K-means clustering). - 7.3 Hierarchical classification. - 7.4 TWINSPAN. - 8 Regression methods. - 8.1 Regression models in general. - 8.2 General linear model: terms. - 8.3 Generalized linear models (GLM). - 8.4 Loess smoother. - 8.5 Generalized additive models (GAM). - 8.6 Mixed-effect models (LMM, GLMM and GAMM). - 8.7 Classification and regression trees (CART). - 8.8 Modelling species response curves with Canoco. - 9 Interpreting community composition with functional traits. - 9.1 Required data. - 9.2 Two approaches in traits - environment studies. - 9.3 Community-based approach. - 9.4 Species-based approach. - 10 Advanced use of ordination. - 10.1 Principal response curves (PRC). - 10.2 Separating spatial variation. - 10.3 Linear discriminant analysis. - 10.4 Hierarchical analysis of community variation. - 10.5 Partitioning diversity indices into alpha and beta components. - 10.6 Predicting community composition. - 11 Visualising multivariate data. - 11.1 Reading ordination diagrams of linear methods. - 11.2 Reading ordination diagrams of unimodal methods. - 11.3 Attribute plots. - 11.4 Visualising classification, groups, and sequences. - 11.5 T-value biplot. - 12 Case study 1: Variation in forest bird assemblages. - 12.1 Unconstrained ordination: portraying variation in bird community. - 12.2 Simple constrained ordination: the effect of altitude on bird community. - 12.3 Partial constrained ordination: additional effect of other habitat characteristics. - 12.4 Separating and testing alpha and beta diversity. - 13 Case study 2: Search for community composition patterns and their environmental correlates: vegetation of spring meadows. - 13.1 Unconstrained ordination. - 13.2 Constrained ordination. - 13.3 Classification. - 13.4 Suggestions for additional analyses. - 13.5 Comparing two communities. - 14 Case study 3: Separating the effects of explanatory variables. - 14.1 Introduction. - 14.2 Data. - 14.3 Changes in species richness and composition. - 14.4 Changes in species traits. - 15 Case study 4: Evaluation of experiments in randomised complete blocks. - 15.1 Introduction. - 15.2 Data. - 15.3 Analysis. - 15.4 Calculating ANOVA using constrained ordination. - 16 Case study 5: Analysis of repeated observations of species composition from a factorial experiment. - 16.1 Introduction. - 16.2 Experimental design. - 16.3 Data coding and use. - 16.4 Univariate analyses. - 16.5 Constrained ordinations. - 16.6 Principal response curves. - 16.7 Temporal changes across treatments. - 16.8 Changes in composition of functional traits. - 17 Case study 6: Hierarchical analysis of crayfish community variation. - 17.1 Data and design. - 17.2 Differences among sampling locations. - 17.3 Hierarchical decomposition of community variation. - 18 Case study 7: Analysis of taxonomic data with discriminant analysis and distance-based ordination. - 18.1 Data. - 18.2 Summarising morphological data with PCA. - 18.3 Linear discriminant analysis of morphological data. - 18.4 Principal coordinates analysis of AFLP data. - 18.5 Testing taxon differences in AFLP data using db-RDA. - 18.6 Taking populations into account. - 19 Case study 8: Separating effects of space and environment on oribatid community with PCNM. - 19.1 Ignoring the space. - 19.2 Detecting spatial trends. - 19.3 All-scale spatial variation of community and environment. - 19.4 Variation partitioning with spatial predictors. - 19.5 Visualising spatial variation. - 20 Case study 9: Performing linear regression with redundancy analysis. - 20.1 Data. - 20.2 Linear regression using program R. - 20.3 Linear regression with redundancy analysis. - 20.4 Fitting generalized linear models in Canoco. - Appendix A Glossary. - Appendix B Sample data sets and projects. - Appendix C Access to Canoco and overview of other software. - Appendix D Working with R. - References. - Index to useful tasks in Canoco 5. - Subject index.
    Location: Lower compact magazine
    Branch Library: AWI Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 5
    Monograph available for loan
    Monograph available for loan
    Contributions towards a sustainable world : in dialogue with Klaus Töpfer (2014)
    München : Oekom
    Details Availability
    Call number: IASS 14.0070 ; PIK N 071-14-0220
    Type of Medium: Monograph available for loan
    Pages: 317 S , Ill., graph. Darst., Kt
    ISBN: 9783865814791
    URL: Inhaltsverzeichnis
    Parallel Title: Online-Ausg. Contributions Towards a Sustainable World
    Language: English
    Location: A 18 - must be ordered
    Branch Library: RIFS Library
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 6
    Monograph available for loan
    Transnational climate change governance (2014)
    New York : Cambridge Univ. Press
    Details Availability
    Call number: PIK N 071-14-0189 ; IASS 17.91115
    Description / Table of Contents: "It is increasingly clear that the world of climate politics is no longer confined to the activities of national governments and international negotiations. Critical to this transformation of the politics of climate change has been the emergence of new forms of transnational governance that cut across traditional state-based jurisdictions and operate across public and private divides. This book provides the first comprehensive, cutting-edge account of the world of transnational climate change governance. Co-authored by a team of the world's leading experts in the field and based on a survey of sixty case studies, the book traces the emergence, nature and consequences of this phenomenon, and assesses the implications for the field of global environmental politics. It will prove invaluable for researchers, graduate students and policy makers in climate change, political science, international relations, human geography, sociology and ecological economics"--
    Type of Medium: Monograph available for loan
    Pages: XII, 212 S. , graph. Darst. , 26 cm
    Edition: 1. publ.
    ISBN: 9781107068698 , 9781107676312 (paperback)
    URL: Cover
    URL: http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027468543&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA
    Language: English
    Note: Contents: 1. Introducing transnational climate change governance ; 2. Mapping the world of transnational climate change governance 3. Theoretical perspectives on transnational governance ; 4. Origins, agency and the forms of transnational climate change governance ; 5. Constructing transnational climate change governance issues and producing governance spaces ; 6. The uneven geography of transnational climate change governance ; 7. Understanding authority and legitimacy in transnational climate change governance ; 8. Making a difference? Tracing the effects and effectiveness of transnational climate change governance ; 9. Conclusions - looking beyond transnational climate governance
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 7
    Monograph available for loan
    Monograph available for loan
    Pro Git (2014)
    Berkeley, CA : Apress
    Details Availability
    Call number: PIK M 034-17-90826
    Description / Table of Contents: Pro Git (Second Edition) is your fully-updated guide to Git and its usage in the modern world. Git has come a long way since it was first developed by Linus Torvalds for Linux kernel development. It has taken the open source world by storm since its inception in 2005, and this book teaches you how to use it like a pro. Effective and well-implemented version control is a necessity for successful web projects, whether large or small. With this book you’ll learn how to master the world of distributed version workflow, use the distributed features of Git to the full, and extend Git to meet your every need. Written by Git pros Scott Chacon and Ben Straub, Pro Git (Second Edition) builds on the hugely successful first edition, and is now fully updated for Git version 2.0, as well as including an indispensable chapter on GitHub. It’s the best book for all your Git needs
    Type of Medium: Monograph available for loan
    Pages: XXV, 426 Seiten , Illustrationen, Diagramme
    Edition: Second Edition
    ISBN: 9781484200766 , 9781484200773 (print)
    Language: English
    Note: Contents: Getting Started ; Git Basics ; Git Branching ; Git on the Server ; Distributed Git ; Github ; Git Tools ; Customizing Git ; Git and Other Systems ; Git Internals ; Git in Other Environments ; Embedded Git in Your Applications ; Git Commands
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 8
    Monograph available for loan
    Monograph available for loan
    A theory of intergenerational justice (2014)
    London : Earthscan
    Details Availability
    Call number: PIK D 024-18-91634
    Type of Medium: Monograph available for loan
    Pages: XII, 264 Seiten , graph. Darst., Kt.
    ISBN: 9780415845786 (pbk.) , 9781844078264 (hbk.)
    URL: http://www.gbv.de/dms/zbw/773904042.pdf
    Language: English
    Note: Teilw. zugl.: Düsseldorf, Heinrich-Heine-Univ., Diss., 2008 , Contents: Introduction -- Criteria-based definitions of scientific terms -- Comparisons between generations -- Objections to theories of generational justice -- What to sustain? : capital or well being as an axiological goal -- How much to sustain? : the demands of justice in the intergenerational context -- Conclusion
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 9
    Monograph available for loan
    Monograph available for loan
    Strategisches Management in Bildungseinrichtungen (2014)
    Münster [u.a] : Waxmann
    Details Availability
    Call number: PIK A 190-19-92723
    Type of Medium: Monograph available for loan
    Pages: 177 Seiten , Diagramme , 24 cm
    ISBN: 3830918593 , 9783830918592 , 9783830968597 (electronic; eBook)
    Series Statement: Studienreihe Bildungs- und Wissenschaftsmanagement 15
    URL: Inhaltsverzeichnis
    URL: Inhaltstext
    Language: German
    Note: Contents: Einführung ; 1 Strategisches Management von Bildungseinrichtungen?! ; 2 Grundlagen strategischen Managements ; 3 Anwendungen ; 4 Zum (strategischen) Management von Bildungseinrichtungen ; 5 Zu den Möglichkeiten strategischen Managements von Bildungseinrichtungen
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 10
    Monograph available for loan
    Monograph available for loan
    Ecology and religion (2014)
    Washington, DC [u.a.] : Island Press
    Details Availability
    Call number: PIK N 073-19-92859
    Description / Table of Contents: Introduction. Our journey into religion and ecology -- Problems and promise of religions : limiting and liberating -- The nature of religious ecology : orienting, grounding, nurturing, transforming -- Religious ecology and views of nature in the West -- Ecology, conservation, and ethics -- Emergence of the field of religion and ecology -- Christianity as orienting to the cosmos -- Confucianism as grounding in community -- Indigenous traditions and the nurturing powers of nature -- Hinduism and the transforming affect of devotion -- Building on interreligious dialogue : toward a global ethics -- Epilogue. Challenges ahead : creating ecological cultures
    Type of Medium: Monograph available for loan
    Pages: X, 265 Seiten , Illustrationen , 23 cm
    ISBN: 9781597267076 , 1597267074 , 9781597267083 , 1597267082
    Series Statement: Foundations of contemporary environmental studies
    URL: Inhaltsverzeichnis
    URL: Klappentext
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 11
    Monograph available for loan
    Monograph available for loan
    Be Partners - Büromanagement; 1, [Fachkunde]: Lernfelder 1 - 4 (2014)
    Berlin : Cornelsen Schulverl.
    Associated volumes
    Details Availability
    Call number: PIK B 811-19-92830/2
    Type of Medium: Monograph available for loan
    Pages: 357 S. , zahlr. Ill. und graph. Darst., Tab. , 1 DVD-ROM , 260 mm x 190 mm
    Edition: [Allg. Ausg.], 1. Aufl.
    ISBN: 3464461017 , 9783464461013 , 9783064509375 (electronic)
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 12
    Monograph available for loan
    Monograph available for loan
    A capitalism for the people : recapturing the lost genius of American prosperity (2014)
    New York : Basic Books
    Details Availability
    Call number: PIK B 110-20-93585
    Type of Medium: Monograph available for loan
    Pages: xxxii, 304 Seiten , 21 cm
    Edition: Paperback first published in 2014
    ISBN: 9780465085958 , 9780465029471
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 13
    Monograph available for loan
    Monograph available for loan
    Chaos and fractals : an elementary introduction (2014)
    Oxford [u.a.] : Oxford University Press
    Details Availability
    Call number: PIK M 490-21-94153
    Type of Medium: Monograph available for loan
    Pages: XXI, 408 Seiten , Illustrationen, Diagramme
    Edition: Reprinted with corr.
    ISBN: 9780199566433 (hbk) , 9780199566440 (pbk)
    URL: http://www.gbv.de/dms/ilmenau/toc/789775204.PDF
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 14
    Monograph available for loan
    Monograph available for loan
    Modelling Norms (2014)
    Dordrecht : Springer
    Details
    Call number: PIK B 020-22-94723
    Description / Table of Contents: The book focusses on questions of individual and collective action, the emergence and dynamics of social norms and the feedback between individual behaviour and social phenomena. It discusses traditional modelling approaches to social norms and shows the usefulness of agent-based modelling for the study of these micro-macro interactions. Existing agent-based models of social norms are discussed and it is shown that so far too much priority has been given to parsimonious models and questions of the emergence of norms, with many aspects of social norms, such as norm-change, not being modelled.  Juvenile delinquency, group radicalisation and moral decision making are used as case studies for agent-based models of collective action extending existing models by providing an embedding into social networks, social influence via argumentation and a causal action theory of moral decision making. The major contribution of the book is to highlight the multifaceted nature of the dynamics of social norms, consisting not only of emergence, and the importance of embedding of agent-based models into existing theory. 
    Type of Medium: Monograph available for loan
    Pages: 215 Seiten
    Edition: Online edition Springer eBook Collection. Humanities, Social Sciences and Law
    ISBN: 978-94-017-8514-3
    Language: English
    Note: IntroductionTheorising Norms -- Theorising Crime -- Agent-based Modelling -- The Environment and Social Norms -- Punishment and Social Norms -- Imitation and Social Norms -- Socially Situated Social Norms -- Internalisation and Social Norms -- Modelling Norms -- Delinquent Networks -- Social Construction of Knowledge -- Morality -- We-Intentionality -- Conclusion -- Index..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 15
    Monograph available for loan
    Monograph available for loan
    Kooperationsmanagement in der Praxis : Gesellschaftliche Veränderungen gestalten mit Capacity WORKS (2014)
    Wiesbaden : Springer
    Details Availability
    Call number: PIK D 025-16-89602
    Type of Medium: Monograph available for loan
    Pages: IX, 283 S. , graph. Darst. , 240 mm x 168 mm
    ISBN: 3658062754 , 9783658062750 , 9783658062767
    URL: Inhaltstext
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 16
    Monograph available for loan
    Monograph available for loan
    Der Briefwechsel Richard Dedekind - Heinrich Weber (2014)
    Berlin [u.a.] : De Gruyter
    Details Availability
    Call number: PIK M 900-16-89750
    Description / Table of Contents: Main description: Der Briefwechsel zwischen den Mathematikern Richard Dedekind und Heinrich Weber liegt nun erstmals in transkribierter Form vor. Es handelt sich um einen der wichtigsten Briefwechsel von Mathematikern im 19. Jahrhundert, da nahezu jedes Teilgebiet der Mathematik angesprochen wird und damals beginnende Entwicklungen intensiv diskutiert wurden. Personen- und Werkverzeichnisse erleichtern den Überblick über die in den Briefen diskutierten Themen.
    Description / Table of Contents: Main description: This volume provides the very first transcription of correspondence between Richard Dedekind and Heinrich Weber, one of the most important instances of written dialog between mathematicians in the 19th century. Nearly every subarea of mathematics is addressed in the letters, which intensively discuss nascent developments in the field. A register of persons and index of works ease access to the topics discussed in the letters.
    Type of Medium: Monograph available for loan
    Pages: XX, 490 S. , Ill. , 24 cm
    ISBN: 3110373661 (Gb.) , 9783110373660 (Gb.) , 9783110368048 (electr.; PDF) , 9783110398656 (electr.; ePub)
    Series Statement: Abhandlungen der Akademie der Wissenschaften in Hamburg 5
    URL: http://www.degruyter.com/view/product/431805
    URL: Inhaltstext
    URL: http://www.gbv.de/dms/tib-ub-hannover/797412298.pdf
    Language: German
    Note: Techn. Univ., Diss. u.d.T.: Scheel, Katrin: Der Briefwechsel von Richard Dedekind mit Heinrich Weber--Braunschweig, 2015 , Frontmatter -- Grußwort Geleitwort Vorwort des Herausgebers Danksagung Editionskriterien Abkürzungsverzeichnis Inhalt: 1. Einleitung 2. Richard Dedekind 3. Heinrich Weber 4. Briefwechsel Dedekind - Weber 5. Elise Riemann 6. Verlag B. G. Teubner 7. Karl Hattendorff 8. Hermann Amandus Schwarz 9. Friedrich Wöhler A. Verlagsverträge B.G.Teubner-Verlag B. Chronologisches Dokumentenverzeichnis C. Verzeichnis der Fundstellen D. Literaturverzeichnis zum Briefwechsel E. Kurzbiographien Literatur Personenindex..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 17
    Monograph available for loan
    Monograph available for loan
    Wassermanagement im Klimawandel : Möglichkeiten und Grenzen von Anpassungsmaßnahmen (2014)
    München : oekom-Verl.
    Details Availability
    Call number: PIK N 454-16-89758
    Type of Medium: Monograph available for loan
    Pages: 521 S. , Ill., graph. Darst., Kt. , 235 mm x 165 mm
    ISBN: 3865814808 (Pb.) , 9783865814807 (Pb.)
    Series Statement: Klimawandel in Regionen zukunftsfähig gestalten - KLIMZUG 3
    URL: http://www.oekom.de/buecher/buchreihen/klimzug/buch/wassermanagement-im-klimawandel.html
    URL: Inhaltsverzeichnis
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 18
    Monograph available for loan
    Monograph available for loan
    BetrVG : Kommentar (2014)
    Köln : Luchterhand
    Details Availability
    Call number: PIK B 405-17-90623
    Type of Medium: Monograph available for loan
    Pages: XXXIV, 2474 S.
    Edition: 9. Aufl.
    ISBN: 9783472084273
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 19
    Monograph available for loan
    Monograph available for loan
    Justice for future generations : climate change and international law (2014)
    Cheltenham, UK : Edward Elgar
    Details Availability
    Call number: PIK N 073-16-89994
    Type of Medium: Monograph available for loan
    Pages: XXIII, 227 Seiten , 25 cm
    ISBN: 9780857934154 (hbk.) , 0857934155 (hbk.)
    Language: English
    Note: Contents: 1. Introduction: The Climate Change Problem and Solutions Part 1: Theory 2. The Basis of an Obligation Towards Future Generations in Justice and Ethics in the Context of Climate Change 3. Content of Justice-based Obligations Towards Future Generations in the Context of Climate Change Part II: International Law and Politics 4. Current International Law, Intergenerational Justice and Climate Change 5. International Human Rights Law, Intergenerational Justice and Climate Change 6. Climate Change Discources and Intergenerational Justice Part III: The Way Forward and Conclusion 7. The Way Forward – Incorporating Intergenerational Justice Principles into International Climate Law 8. Conclusion Bibliography Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 20
    Monograph available for loan
    Monograph available for loan
    Paying the polluter : environmentally harmful subsidies and their reform (2014)
    Cheltenham [u.a.] : Elgar
    Details Availability
    Call number: PIK B 160-16-89999
    Description / Table of Contents: 'The financial means embedded in subsidies for unsustainable systems of production and consumption are increasingly well studied and reported. This has led to policy recommendations (e.g. OECD, EU) on how to reform subsidy systems in support of the necessary transitions to a low carbon and ecosystem resilient society based on a strong resource efficient economy. The authors in this book contribute to the debate based on recent, high quality and policy relevant research. It is a timely contribution to a pressing financial issue in environmental policy.'--Hans Bruyninckx , Executive Director of the European Environment Agency. 'Recently the IPCC finished their 5th Assessment report and we see that while emissions continue unabated - and in some areas even increase, relatively little is done in terms of policy making. Instead of sound policies to deal with climate issues, we are still faced with perverse incentives that promote fossil fuels. This book sets itself a very important agenda of trying to find a workable path towards abolishing such subsidies. This is vital reading for all policy makers.'--Thomas Sterner, Visiting Chief Economist, Environmental Defense Fund Professor of environmental economics, University of Gothenburg. 'EU countries increasingly receive recommendations through the European Semester and OECD Environmental Performance Reviews to assess and progressively phase out environmentally harmful subsidies. It is not only a matter of avoiding damage to the environment, it is also a question of transparency, equity, and of eliminating unjustified privileges. Subsidy reform can help reduce public deficits, restore fair market conditions and eliminate distortions in competition. This book is a precious tool for Governments and experts.'--Aldo Ravazzi Douvan, Italian Ministry of Environment, Professor of Sustainable Development at University Roma Luiss. 'Tax spending and public subsidies harmful to the environment have attracted high level attention at the Rio and Johannesburg Sustainable Development Conferences, in the context of the Kyoto Protocol and of the Convention on Biological Diversity, in OECD and EU recommendations, and are now firmly on the public agenda. They are often also poorly designed, do not reach their goals, are costly, not transparent and can be inefficient. With the present public budget crises in many countries, rarely has the timing been more favorable to lower such harmful support. The book is thus timely and shows throu ...
    Type of Medium: Monograph available for loan
    Pages: XIII, 348 S. , graph. Darst.
    ISBN: 9781782545309
    URL: Inhaltsverzeichnis
    Language: English
    Note: 1. Introduction : high hopes and down-to-earth realism / Frans Oosterhuis and Patrick ten Brink2. A global survey of potentially environmentally harmful subsidies / Ronald Steenblik -- 3. Hidden subsidies : the invisible part of the EHS iceberg / Sirini Withana ... [et al.] -- 4. Can we recognise an environmentally harmful subsidy if we see one? / Jan Pieters -- 5. Quantifying the impacts of environmentally harmful subsidies / Cees van Beers and Jeroen van den Bergh -- 6. Energy subsidies / Frans Oosterhuis and Katharina Umpfenbach -- 7. Environmentally harmful subsidies in the transport sector / Laurent Franckx and Inge Mayeres -- 8. Agriculture, food and water / Frans Oosterhuis and Kris Bachus -- 9. Environmentally harmful subsidies and biodiversity / Patrick ten Brink ... [et al.] -- 10. Reforming EHS in Europe : success stories, failures and agenda setting / Jacqueline Cottrell -- 11. Phasing out environmentally harmful subsidies worldwide / Anja von Moltke -- 12. Reform of environmentally harmful subsidies : distributional issues / Annegrete Bruvoll and Haakon Vennemo -- 13. The way forward : reforming EHS in the transition to a green economy / Patrick ten Brink, Sirini Withana and Frans Oosterhuis..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 21
    Monograph available for loan
    Monograph available for loan
    Kann Demokratie Nachhaltigkeit? (2014)
    Wiesbaden : Springer VS
    Details
    Call number: IASS 16.90372 ; PIK D 022-19-89867
    Description / Table of Contents: Wir leben auf Kosten der Zukunft. Warum? Kurzfristige Interessen der Bürger (sichere Arbeit) ergänzen sich mit kurzfristigen Interessen der Politiker (Wiederwahl). Das politische System trägt Mitschuld. Wie kann man es ändern, um  diese Schwächen zu vermeiden? Lässt es sich demokratisch rechtfertigen, wenn Anwälte zukünftiger Generationen heute schon mitentscheiden? Diese Fragen werden  von Wissenschaftlern, Schriftstellern, Politikern und Unternehmern behandelt, um methodische Analyse, politischen und ökonomischen Sachverstand und kreative Ideen zu kombinieren. Das Buch enthält Beiträge von H. Geißler, H. J. Schellnhuber, I. Trojanow u.a. „Die Demokratie hat viele große Vorzüge und Stärken. Langfristigkeit und Nachhaltigkeit gehören bislang nicht dazu. Dem kann man institutionell abhelfen. Das Buch zeigt, wie.“ (Ernst Ulrich von Weizsäcker, MdB a.D.)   Der Inhalt ·         Problemanalyse und Überblick ·         Neue Institutionen: Zukunftsräte ·         Neue Institutionen: Ombudspersonen ·         Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten ·         Ombudspersonen in Unternehmen?   Die Zielgruppen   ·         PolitikwissenschaftlerInnen ·         PhilosophInnen ·         politisch interessierte Bürger     Der Herausgeber Prof. Dr. Bernward Gesang lehrt Philosophie an der Universität Mannheim
    Type of Medium: Monograph available for loan
    Pages: XII, 150 S.
    ISBN: 9783658048952 , 9783658048945
    DOI: 10.1007/978-3-658-04895-2
    Parallel Title: Print version: Kann Demokratie Nachhaltigkeit
    Language: German
    Note: Problemanalyse und ÜberblickNeue Institutionen: Zukunftsräte -- Neue Institutionen: Ombudspersonen -- Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten -- Ombudspersonen in Unternehmen?..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 22
    Monograph available for loan
    Monograph available for loan
    Global environmental governance, technology and politics : the anthropocene gap (2014)
    Cheltenham [u.a.] : Elgar
    Details Availability
    Call number: PIK N 071-16-90003
    Type of Medium: Monograph available for loan
    Pages: XIV, 189 S. , graph. Darst., Kt.
    ISBN: 1781955549 ((cased)) , 9781781955543 ((cased)) , 9781783478910 , 9781781955550 (electronic)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 23
    Series available for loan
    Series available for loan
    Beiträge zur Paläozoologie der Trias und des Tertiärs : Arnold Müller zum 65. Geburtstag (2014)
    Dresden : Senckenberg Naturhistorische Sammlungen
    Details Availability
    Call number: S 92.0551(61, 1)
    Type of Medium: Series available for loan
    Pages: 103 Seiten , Illustrationen, Diagramme , 30 cm
    ISBN: 9783910006546
    Series Statement: Geologica Saxonica 61,1
    Language: German
    Note: Beiträge teilweise in deutscher, teilweise in englischer Sprache
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 24
    Monograph available for loan
    Monograph available for loan
    The national origins of policy ideas : knowledge regimes in the United States, France, Germany, and Denmark (2014)
    Princeton, NJ [u.a.] : Princeton Univ. Press
    Details Availability
    Call number: PIK D 029-17-90802
    Description / Table of Contents: Examines how knowledge regimes are organized, operate, and have changed over the last thirty years in the United States, France, Germany, and Denmark. They show how there are persistent national differences in how policy ideas are produced. Some countries do so in contentious, politically partisan ways, while others are cooperative and consensus oriented. They find that while knowledge regimes have adopted some common practices since the 1970s, tendencies toward convergence have been limited and outcomes have been heavily shaped by national contexts.
    Type of Medium: Monograph available for loan
    Pages: XVIII, 401 Seiten , graph. Darst.
    ISBN: 9780691161167 (pbk) , 9780691150314 (cloth)
    URL: Inhaltsverzeichnis
    Language: English
    Note: Contents: Preface ; Chapter 1: Knowledge Regimes and the National Origins of Policy Ideas ; Part I: The Political Economy of Knowledge Regimes ; Chapter 2: The Paradox of Partisanship in the United States ; Chapter 3: The Decline of Dirigisme in France ; Chapter 4: Coordination and Compromise in Germany ; Chapter 5: The Nature of Negotiation in Denmark ; Reprise: Initial Reflections on the National Cases ; Part II: Issues of Similarity and Impact ; Chapter 6: Limits of Convergence ; Chapter 7: Questions of Influence ; Part III: Conclusions ; Chapter 8: Summing Up and Normative Implications ; Postscript: An Agenda for Future Research ; Appendix: Research Design and Methods
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 25
    Monograph available for loan
    Monograph available for loan
    Complexity and the art of public policy : solving society's problems from the bottom up (2014)
    Princeton : Princeton University Press
    Details
    Call number: PIK D 020-15-0143 ; IASS 15.89713
    Description / Table of Contents: Complexity science-made possible by modern analytical and computational advances-is changing the way we think about social systems and social theory. Unfortunately, economists' policy models have not kept up and are stuck in either a market fundamentalist or government control narrative. While these standard narratives are useful in some cases, they are damaging in others, directing thinking away from creative, innovative policy solutions. Complexity and the Art of Public Policy outlines a new, more flexible policy narrative, which envisions society as a complex evolving system that is uncont
    Type of Medium: Monograph available for loan
    Pages: VIII, 310 S.
    ISBN: 9780691152097
    URL: http://www.gbv.de/dms/bowker/toc/9780691152097.pdf
    Language: English
    Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; PART I. THE COMPLEXITY FRAME FOR POLICY; Chapter 1. Twin Peaks; Chapter 2. Government With, Not Versus, the Market; Chapter 3. I Pencil Revisited: Beyond Market Fundamentalism; Chapter 4. The Complexity Policy Frame; PART II. EXPLORING THE FOUNDATIONS; Chapter 5. How Economics Lost the Complexity Vision; Chapter 6. How Macroeconomics Lost the Complexity Vision; Chapter 7. Complexity: A New Kind of Science?; Chapter 8: A New Kind of Complexity Economics?; Chapter 9. Nudging toward a Complexity Policy Frame. , PART III. LAISSEZ-FAIRE ACTIVISM IN PRACTICEChapter 10. The Economics of Influence; Chapter 11. Implementing Influence Policy; Chapter 12. Laissez-Faire Activism; Chapter 13. Getting the Ecostructure of Government Right; PART IV. THE LOST AGENDA; Chapter 14. Getting the Ecostructure of Social Science Education Right; Chapter 15. The Lost Agenda; Notes; Bibliography; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 26
    Monograph available for loan
    Monograph available for loan
    Rethinking private authority : agents and entrepreneurs in global environmental governance (2014)
    Princeton, NJ [u.a.] : Princeton Univ. Press
    Details Availability
    Call number: PIK D 020-15-0141
    Description / Table of Contents: "Rethinking Private Authority examines the role of non-state actors in global environmental politics, arguing that a fuller understanding of their role requires a new way of conceptualizing private authority. Jessica Green identifies two distinct forms of private authority--one in which states delegate authority to private actors, and another in which entrepreneurial actors generate their own rules, persuading others to adopt them.Drawing on a wealth of empirical evidence spanning a century of environmental rule making, Green shows how the delegation of authority to private actors has played a small but consistent role in multilateral environmental agreements over the past fifty years, largely in the area of treaty implementation. This contrasts with entrepreneurial authority, where most private environmental rules have been created in the past two decades. Green traces how this dynamic and fast-growing form of private authority is becoming increasingly common in areas ranging from organic food to green building practices to sustainable tourism. She persuasively argues that the configuration of state preferences and the existing institutional landscape are paramount to explaining why private authority emerges and assumes the form that it does. In-depth cases on climate change provide evidence for her arguments.Groundbreaking in scope, Rethinking Private Authority demonstrates that authority in world politics is diffused across multiple levels and diverse actors, and it offers a more complete picture of how private actors are helping to shape our response to today's most pressing environmental problems"--
    Description / Table of Contents: Rethinking Private Authority examines the role of non-state actors in global environmental politics, arguing that a fuller understanding of their role requires a new way of conceptualizing private authority. Jessica Green identifies two distinct forms of private authority--one in which states delegate authority to private actors, and another in which entrepreneurial actors generate their own rules, persuading others to adopt them.Drawing on a wealth of empirical evidence spanning a century of environmental rule making, Green shows how the delegation of authority to private actors has played a small but consistent role in multilateral environmental agreements over the past fifty years, largely in the area of treaty implementation. This contrasts with entrepreneurial authority, where most private environmental rules have been created in the past two decades. Green traces how this dynamic and fast-growing form of private authority is becoming increasingly common in areas ranging from organic food to green building practices to sustainable tourism. She persuasively argues that the configuration of state preferences and the existing institutional landscape are paramount to explaining why private authority emerges and assumes the form that it does. In-depth cases on climate change provide evidence for her arguments.Groundbreaking in scope, Rethinking Private Authority demonstrates that authority in world politics is diffused across multiple levels and diverse actors, and it offers a more complete picture of how private actors are helping to shape our response to today's most pressing environmental problems.
    Type of Medium: Monograph available for loan
    Pages: XII, 215 S. , graph. Darst.
    ISBN: 9780691157580 (hardback) , 9780691157597 (paperback)
    URL: http://www.gbv.de/dms/zbw/757505562.pdf
    Language: English
    Note: A theory of private authorityAgents of the state : a century of delegation in international environmental lawGovernors of the market : the evolution of entrepreneurial authorityAtmospheric police : delegated authority in the clean development mechanismAtmospheric accountants : entrepreneurial authority and the greenhouse gas protocol..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 27
    Monograph available for loan
    Monograph available for loan
    Multilevel environmental governance : managing water and climate change in Europe and North America (2014)
    Cheltenham [u.a.] : Elgar
    Details Availability
    Call number: PIK N 071-15-89232
    Type of Medium: Monograph available for loan
    Pages: XII, 277 S , Ill. , 24 cm
    ISBN: 0857939246 (hbk.) , 9780857939241 (hbk.) , 9781783472840 (pbk.)
    URL: Inhaltsverzeichnis
    Language: English
    Note: PART I: THEORETICAL PERSPECTIVES ON MULTILEVEL GOVERNANCE ; 1. Introduction ; 2. Too Many Levels or Just About Right? Multilevel Governance and Environmental Performance ; PART II: MULTILEVEL GOVERNANCE OF WATER RESOURCES ; 3. Subsidiarity as a ‘Scaling Device’ in Environmental Governance: The Case of the European Union ; 4. Multilevel Governance and the Politics of Environmental Water Recoveries ; 5. Playing a Zero Sum Game: Sharing Water between Jurisdictions in Federations ; PART III: MULTILEVEL GOVERNANCE OF CLIMATE CHANGE MITIGATION ; 6. Climate Governance in the European Union Multi-level System: The Role of the Cities ; 7. Bottom-up versus Top-down: The Evolving American Climate Policy Odyssey ; 8. Institutional Strength, Intergovernmental Relations, and National Climate Policy Coordination: Australia and Canada Compared ; 9. Allocating Greenhouse Gas Emission Reductions Amongst Sectors and Jurisdictions in Federated Systems: The European Union, Germany and Canada ; PART IV: FINDINGS ON EFFECTIVENESS AND GOVERNANCE PATTERNS ; 10. Ensuring the Effectiveness of European Union Environmental Law: From Supranational Lawmaking to Multilevel Enforcement ; 11. What is Multilevel Environmental Governance? When Does It Work?
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 28
    Monograph available for loan
    Monograph available for loan
    Reliability modeling and analysis of smart power systems (2014)
    New Delhi [u.a.] : Springer
    Details Availability
    Call number: PIK P 120-16-89507
    Type of Medium: Monograph available for loan
    Pages: XIV, 202 S. , graph. Darst.
    ISBN: 9788132217978
    Series Statement: Reliable and sustainable electric power and energy systems management
    URL: Publisher description
    URL: Inhaltsverzeichnis
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 29
    Monograph available for loan
    Monograph available for loan
    Energiewende : Wege zu einer bezahlbaren Energieversorgung (2014)
    Wiesbaden : Springer VS
    Details
    Call number: PIK P 120-16-89806
    Description / Table of Contents: Deutschland wird seine bisher weitgehend auf fossilen Brennstoffen basierende Energieversorgung bis zum Jahr 2050 auf großtenteils regenerative Energien umstellen. Die Burgerinnen und Burger dieses Landes kennen dieses weltweit einzigartige Projekt unter dem Namen Energiewende. Von ihren gesellschaftlichen Wurzeln, dem Beginn ihrer Umsetzung und ihrer rasanten Entwicklung in den letzten Jahren berichtet Klaus-Dieter Maubach. Er beschreibt, wie das deutsche Energiesystem der Zukunft aussehen muss, und schlagt einen kurzfristigen Aktionsplan vor, der die volkswirtschaftlichen Kosten eindammt und
    Type of Medium: Monograph available for loan
    Pages: XX, 293 Seiten
    Edition: 2. Auflage
    ISBN: 3658054735 , 9783658054731
    Language: German
    Note: Vorwort zur zweiten Auflage; Vorwort; Inhalt; Abkürzungen; Einführung; Teil I; Eine kurze Geschichte der Energiewende; Fukushima und Ausstieg (2011); Fundamente der Energiewende (1980 - 1998); EnWG und EEG (1998 - 2003); Emissionshandel und Energiepreise (2003 - 2008); Netzregulierung und EEG (2004 - 2008); Krise in Europa (2009 - 2012); Teil II; Die Zukunft der Energiewende; Standortbestimmung (2013); 2050: Energiewende; Fossile Primärenergien; Die Regenerativen; Energiesystem der Zukunft; Politik für die Energiewende; 1 Braunkohle und Erdgas; 2 Auslaufbetrieb der Kernenergie ; 3 Energieeffizienz ; 4 Emissionshandel ; 5 EEG Reform ; 6 Regulierung der Stromnetze ; 7 Strommarktgestaltung ; 8 Koordinierung der Energiewende ; Zusammenfassung.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 30
    Series available for loan
    Series available for loan
    Proceedings of the 5th Symposium on Mesozoic Cenozoic Decapod Crustaceans, Krakow, Poland, 2013 : a tribute to Pál Mihály Müller (2014)
    Leiden : Naturalis Biodiversity Center
    Details Availability
    Call number: S 93.0422(147)
    Type of Medium: Series available for loan
    Pages: 329 S. , Ill., Kt.
    Series Statement: Scripta geologica 147
    Language: English
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 31
    Monograph available for loan
    Monograph available for loan
    Kreide-Fossilien in Sachsen : = Cretaceous fossils of Saxony; Teil 1: [...] (2014)
    Dresden : Senckenberg Naturhistorische Sammlungen
    Associated volumes
    Details Availability
    Call number: S 92.0551(60, 1)
    In: Geologica Saxonica
    Type of Medium: Monograph available for loan
    Pages: 254 S. , Ill., graph. Darst., Kt.
    ISBN: 9783910006522
    Series Statement: Geologica Saxonica 60,1
    Language: German , German , English
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 32
    Monograph available for loan
    Monograph available for loan
    Handbuch Methoden der empirischen Sozialforschung (2014)
    Wiesbaden : Springer VS
    Details Availability
    Call number: PIK E 703-18-91445
    Description / Table of Contents: Das Handbuch ist das erste im deutschen Sprachraum, in dem qualitative und quantitative Methoden gleichberechtigt dargestellt werden und in dem systematisch nach Gemeinsamkeiten und Unterschieden hinsichtlich Problemen, Prinzipien, Vorgehensweisen, Standards und Gütekriterien für beide Forschungstraditionen gefragt wird. Um diese Fragen zu beantworten, diskutieren ausgewiesene Experten in 88 Beiträgen den aktuellen Stand der Forschung und bieten Forschenden, Lehrenden und Studierenden einen detaillierten Überblick über die verschiedenen Methoden der empirischen Sozialforschung. Ein besonderer Schwerpunkt liegt dabei auf der Datenerhebung, also auf standardisierten und offenen Befragungen, aber es werden auch viele weitere aktuell verwendete Datentypen vorgestellt
    Description / Table of Contents: Das Handbuch ist das erste im deutschen Sprachraum, in dem qualitative und quantitative Methoden gleichberechtigt dargestellt werden und in dem systematisch nach Gemeinsamkeiten und Unterschieden hinsichtlich Problemen, Prinzipien, Vorgehensweisen, Standards und Gütekriterien für beide Forschungstraditionen gefragt wird. Um diese Fragen zu beantworten, diskutieren ausgewiesene Experten in 88 Beiträgen den aktuellen Stand der Forschung und bieten Forschenden, Lehrenden und Studierenden einen detaillierten Überblick über die verschiedenen Methoden der empirischen Sozialforschung. Ein besonderer Schwerpunkt liegt dabei auf der Datenerhebung, also auf standardisierten und offenen Befragungen, aber es werden auch viele weitere aktuell verwendete Datentypen vorgestellt.
    Type of Medium: Monograph available for loan
    Pages: 1126 Seiten , Diagramme, Karten , 25 cm
    ISBN: 3531178091 , 9783531178097
    Series Statement: Handbuch
    Language: German
    Note: Contents: 1. Methoden der empirischen Sozialforschung - Ein Überblick ; Teil 1 Grundlagen der empirischen Sozialforschung ; 2. Empirische Sozialforschung und soziologische Theorie ; 3. Forschungsethik ; 4. Informationelle Selbstbestimmung ; 5. Informationsquellen und Informationsaustausch ; 6. Forschungsdesigns für die qualitative Sozialforschung ; 7. Forschungsdesigns für die quantitative Sozialforschung ; 8. Mixed Methods ; 9. Evaluationsforschung ; 10. Marktforschung ; 11. Experiment ; 12. Simulation ; 13. Qualitative Daten für die Sekundäranalyse ; 14. Quantitative Daten für die Sekundäranalyse ; 15. Ergebnispräsentation in der qualitativen Forschung ; 16. Ergebnispräsentation in der quantitativen Forschung ; Teil 2 Stichproben, Datenaufbereitung und Güte ; 17. Stichprobenziehung in der qualitativen Sozialforschung ; 18. Stichprobenziehung in der quantitativen Sozialforschung ; 19. Pretest ; 20. Einstellungen zu Befragungen ; 21. Interviewereffekte ; 22. Fälschungen von Interviews ; 23. Unit- und Item-Nonresponse ; 24. Gewichtung ; 25. Paradaten ; 26. Data Fusion, Record Linkage und Data Mining ; 27. Datenaufbereitung und Datenbereinigung in der qualitativen Sozialforschung ; 28. Datenaufbereitung und Datenbereinigung in der quantitativen Sozialforschung ; 29. Gütekriterien qualitativer Sozialforschung ; 30. Gütekriterien quantitativer Sozialforschung ; 31. Total Survey Error ; Teil 3 Forschungsparadigmen in der qualitativen Sozialforschung ; 32. Grounded Theory und Theoretical Sampling ; 33. Sozialwissenschaftliche Hermeneutik und hermeneutische Wissenssoziologie ; 34. Diskursanalyse ; 35. Biographieforschung ; 36. Ethnographie ; 37. Einzelfallanalyse ; 38. Qualitative Inhaltsanalyse ; Teil 4 Offene Befragung ; 39. Leitfaden- und Experteninterviews ; 40. Narratives Interview ; 41. Gruppendiskussion ; 42. DELPHI-Befragung ; 43. Journalistisches Interview ; Teil 5 Standardisierte Befragung ; 44. Grundlagen der standardisierten Befragung ; 45. Persönlich-mündliche Befragung ; 46. Telefonische Befragung ; 47. Schriftlich-postalische Befragung ; 48. Online-Befragung ; 49. Gesamtgestaltung des Fragebogens ; 50. Frageformulierung ; 51. Antwortskalen in standardisierten Befragungen ; 52. Offene Fragen ; 53. Vignetten ; 54. Soziodemographische Standards ; 55. Skalen und Indizes ; 56. Interkulturell vergleichende Umfragen ; 57. Mitarbeiterbefragungen ; 58. Befragungen von Kindern und Jugendlichen ; 59. Befragungen von älteren und alten Menschen ; 60. Befragung von Migranten ; 61. Befragung von speziellen Populationen ; Teil 6 Weitere Datentypen ; 62. Natürliche Daten: Dokumente ; 63. Literarische Quellen und persönliche Dokumente ; 64. Zeitungsartikel ; 65. Web Server Logs und Logfiles ; 66. Beobachtung ; 67. Unbewegte Bilder: Fotografien und Kunstgegenstände ; 68. Videographie ; 69. Filme ; 70. Gebrauchsgegenstände und technische Artefakte ; 71. Verwaltungsdaten und Daten der amtlichen Statistik ; 72. Aggregatdaten ; 73. Paneldaten für die Sozialforschung ; 74. Netzwerkdaten ; 75. Organisationsdaten ; 76. Räumliche Daten ; 77. Geodaten ; 78. Neurowissenschaftliche Daten ; Teil 7 Datenauswertung in der quantitativen Sozialforschung ; 79. Multivariate Datenanalyse ; 80. Kausalität ; 81. Indikatoren ; 82. Messung von sozialer Ungleichheit ; 83. Skalierungsverfahren ; 84. Zeitreihenanalyse ; 85. Längsschnittanalyse ; 86. Verlaufsdatenanalyse ; 87. Mehrebenenanalyse ; 88. Meta-Analyse
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 33
    Monograph available for loan
    Monograph available for loan
    The age of migration : international population movements in the modern world (2014)
    Basingstoke : Palgrave Macmillan
    Details Availability
    Call number: PIK B 060-19-92146
    Type of Medium: Monograph available for loan
    Pages: XVII, 401 Seiten , Diagramme, Karten , 24cm
    Edition: Fifth edition
    ISBN: 9780230355774 , 9780230355767
    Language: English
    Note: Contents: 1 Introduction ; 2 Theories of Migration ; 3 How Migration Transforms Societies ; 4 International Migration before 1945 ; 5 Migration in Europe since 1945 ; 6 Migration in the Americas ; 7 Migration in the Asia-Pacific Region ; 8 Migration in Africa and the Middle East ;9 Migration, Security and the Debate on Climate Change ; 10 The State and International Migration: The Quest for Control ; 11 Migrants and Minorities in the Labour Force ; 12 New Ethnic Minorities and Society ; 13 Immigrants and Politics ; 14 Conclusion: Migration in the Twenty-First Century
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 34
    Monograph available for loan
    Monograph available for loan
    Demographic developments in China (2014)
    London [u.a.] : Routledge
    Details Availability
    Call number: PIK B 333-19-93046
    Type of Medium: Monograph available for loan
    Pages: XXIII, 250 S. , Diagramme
    ISBN: 9781138017788 (hardback) , 9781315780191 (electronic)
    Series Statement: Routledge studies on the Chinese economy 55
    URL: http://www.routledge.com/books/details/9781138017788/
    URL: http://www.gbv.de/dms/zbw/77472272X.pdf
    Language: English
    Note: Contents: 1 The Chinese population at a historic turning point ; 2 Socioeconomic development as a determinant of demographic transitions ; 3 Socioeconomic impacts of demographic transition ; 4 A steady approach to adjusting the family planning policy ; 5 Investing in health ; 6 Improving education ; 7 Child development in rural areas ; 8 An overall planning approach to the issue of population mobility in the future development of urban and rural areas ; 9 Promoting gender equality ; 10 Stimulating development potential in an aging society ; 11 Capacity building for family development ; Policy proposals
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 35
    Series available for loan
    Series available for loan
    Saale-Unstrut-Triasland : : ein geologischer Reisebegleiter; Teil 1: Geologischer Überblick (2014)
    Dresden : Senckenberg Naturhistorische Sammlungen, Fachbibliothek Mineralogie und Geologie
    Associated volumes
    Details Availability
    Call number: S 00.0053(19a)
    Type of Medium: Series available for loan
    Pages: 127 Seiten , Illustrationen, Diagramme
    ISBN: 9783910006508
    Series Statement: Schriften des Museums für Mineralogie und Geologie Dresden 19a
    Classification:
    Regional Geology
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 36
    Monograph available for loan
    Monograph available for loan
    Straining : eine subtile Art von Mobbing (2014)
    Göttingen : Vandenhoeck & Ruprecht
    Details Availability
    Call number: PIK B 690-18-91678
    Type of Medium: Monograph available for loan
    Pages: 190 Seiten , Diagramme
    ISBN: 3525403658 (kart.) , 9783525403655 (kart.)
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 37
    Monograph available for loan
    Monograph available for loan
    Asset management : a systematic approach to factor investing (2014)
    Oxford : Oxford University Press
    Details Availability
    Call number: PIK B 130-19-92108
    Type of Medium: Monograph available for loan
    Pages: xii, 704 Seiten , Illustrationen, Diagramme
    ISBN: 9780199959327
    Series Statement: Survey and synthesis series / Financial Management Association
    Language: English
    Note: Contents: Preface: Asset Management ; Part I: The Asset Owner ; Chapter 1: Asset Owners ; Chapter 2: Preferences ; Chapter 3: Mean-Variance Investing ; Chapter 4: Investing for the Long Run ; Chapter 5: Investing Over the Life Cycle ; Part II: Factor Risk Premiums ; Chapter 6: Factor Theory ; Chapter 7: Factors ; Chapter 8: Equities ; Chapter 9: Bonds ; Chapter 10: Alpha (and the Low Risk Anomaly) ; Chapter 11: "Real " Assets ; Chapter 12: Tax-Efficient Investing ; Chapter 13: Illiquid Assets ; Chapter 14: Factor Investing ; Part III: Delegated Portfolio Management ; Chapter 15: Delegated Investing ; Chapter 16: Mutual Funds and Other 40-Act Funds ; Chapter 17: Hedge Funds ; Chapter 18: Private Equity ; Afterword: Factor Management ; Appendix: Returns ; Acknowledgements ; Bibliography ; Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 38
    Monograph available for loan
    Monograph available for loan
    Urban economics and urban policy : challenging conventional policy wisdom (2014)
    Cheltenham [u.a.] : Elgar
    Details Availability
    Call number: PIK B 010-16-90321
    Description / Table of Contents: "Urban Economics and Urban Policy" pulls together cutting-edge developments in urban and regional economics and draws out their implications for urban policy. This new urban economics goes beyond simple comparative advantage and cost competitiveness of cities, and beyond simple views of capital and labor. It develops a much more complex and realistic view of what constitutes local advantage, due to the spatial sorting of different types of people and different types of firms, giving rise to a lumpy landscape of people, activities, and incomes. By taking seriously the new ways we understand the forces shaping the geography of economic development, the authors suggest fresh new ways to work with the grain of markets, but without letting them rip. It is a tour de force.'--Michael Storper, London School of Economics, UK. In this bold, exciting and readable volume, Paul Cheshire, Max Nathan and Henry Overman illustrate the insights that recent economic research brings to our understanding of cities, and the lessons for urban policy-making. The authors present new evidence on the fundamental importance of cities to economic wellbeing and to the enrichment of our lives. They also argue that many policies have been trying to push water uphill and have done little to achieve their stated aims; or, worse, have had unintended and counterproductive consequences. It is remarkable that our cities have been so successful despite the many shortcomings of urban policies and governance. These shortcomings appear in both rich and poor countries. Many powerful policies intended to influence urban development and spatial differences have been developed since the late 1940s, but they have been subject to little rigorous economic evaluation. The authors help us to understand why economic growth has emerged so unevenly across space and why this pattern persists. The failure to understand the forces leading to uneven development underlies the ineffectiveness of many current urban policies. The authors conclude that future urban policies need to take better account of the forces that drive unevenness and that their success should be judged by their impact on people, not on places - or buildings. This groundbreaking book will prove to be an invaluable resource and a rewarding read for academics, practitioners and policymakers interested in the economics of urban policy, urban planning and development, as well as international studies and innovation.
    Type of Medium: Monograph available for loan
    Pages: XII, 238 Seiten , Diagramme, Karten
    Edition: Paperback edition reprint
    ISBN: 9781783475254 , 9781781952511 ((hdb.)) , 9781781952528 (electronic)
    URL: http://www.gbv.de/dms/zbw/772855390.pdf
    Language: English
    Note: Contents: Contents: Foreword by Ed Glaeser ; 1. Introduction ; 2. Urban Economic Performance ; 3. Residential Segregation and People Sorting Within Cities ; 4. Planning for a Housing Crisis: Or the Alchemy by Which We Turn Houses into Gold ; 5. Planning and Economic Performance ; 6. Planning: Reforms that Might Work and Ones that Won’t ; 7. Devolution, City Governance and Economic Performance ; 8. Urban Policies ; 9. Conclusions ; Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 39
    Monograph available for loan
    Monograph available for loan
    Capital in the twenty-first century (2014)
    Cambridge, Mass. [u.a.] : The Belknap Press of Harvard Univ. Press
    Details Availability
    Call number: PIK B 130-14-0107 ; IASS 14.0031
    Description / Table of Contents: Contents: Introduction ; I. Income and Capital ; 1. Income and Output ; 2. Growth: Illusions and Realities ; II. The Dynamics of the Capital/Income Ratio ; 3. The Metamorphoses of Capital ; 4. From Old Europe to the New World ; 5. The Capital/Income Ratio over the Long Run ; 6. The Capital-Labor Split in the Twenty-First Century ; III. The Structure of Inequality ; 7. Inequality and Concentration: Preliminary Bearings ; 8. Two Worlds ; 9. Inequality of Labor Income ; 10. Inequality of Capital Ownership ; 11. Merit and Inheritance in the Long Run ; 12. Global Inequality of Wealth in the Twenty-First Century ; IV. Regulating Capital in the Twenty-First Century ; 13. A Social State for the Twenty-First Century ; 14. Rethinking the Progressive Income Tax ; 15. A Global Tax on Capital ; 16. The Question of the Public Debt ; Conclusion
    Type of Medium: Monograph available for loan
    Pages: VIII, 685 S. : graph. Darst.
    ISBN: 9780674430006
    Uniform Title: Capital au XXIe siècle
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 40
    Monograph available for loan
    Monograph available for loan
    Streitfall Klimawandel : warum es für die größte Herausforderung keine einfachen Lösungen gibt (2014)
    München : Oekom-Verl.
    Details Availability
    Call number: PIK N 071-14-0089
    Description / Table of Contents: Contents: Einführung ; 1 Was verstehen wir unter Klima? ; 2 Die Entdeckung von Klimawandel ; 3 Was leistet Wissenschaft? ; 4 Welchen Wert haben Werte? ; 5 Woran wir glauben ; 6 Wovor wir uns fürchten ; 7 Wie kommunizieren wir Risiken? ; 8 Was ist Fortschritt? ; 9 Wer regiert das Klima? ; 10 Jenseits von Klimawandel
    Type of Medium: Monograph available for loan
    Pages: 381 S. : Ill., graph. Darst.
    Edition: Dt. Erstausg.
    ISBN: 9783865814593
    Uniform Title: Why we disagree about climat change
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 41
    Monograph available for loan
    Monograph available for loan
    Dynamics and control of trajectory tubes : theory and computation (2014)
    Cham [u.a.] : Springer
    Details Availability
    Call number: PIK M 370-15-89030
    Type of Medium: Monograph available for loan
    Pages: XVIII, 445 S. , graph. Darst.
    ISBN: 978-3-319-10276-4
    Series Statement: Systems & Control: Foundations & Applications
    Language: English
    Note: Contents: Linear Control Systems ; The Dynamic Programming Approach ; Ellipsoidal Techniques: Reachability and Control Synthesis ; Solution Examples on Ellipsoidal Methods: Computation in High Dimensions ; The Comparison Principle: Nonlinearity and Nonconvexity ; Impulse Controls and Double Constraints ; Dynamics and Control Under State Constraints ; Trajectory Tubes State-Constrained Feedback Control ; Guaranteed State Estimation ; Uncertain Systems: Output Feedback Control ; Verification: Hybrid Systems
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 42
    Monograph available for loan
    Monograph available for loan
    International trade (2014)
    New York, N.Y. : Worth Publ.
    Details Availability
    Call number: PIK B 730-16-89469
    Type of Medium: Monograph available for loan
    Pages: XXXII, 410 S.
    Edition: 3. ed.
    ISBN: 9781429278447 (pbk.)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 43
    Monograph available for loan
    Monograph available for loan
    3. Internationales Hanns-Bruno-Geinitz-Symposium : 16. - 18.10.2014, Dresden = 3rd International Hanns Bruno Geinitz Symposium (2014)
    Dresden : Senckenberg Naturhistorische Sammlungen
    Associated volumes
    Details Availability
    Call number: S 92.0551(60, 2)
    In: Gologica Saxonica
    Type of Medium: Monograph available for loan
    Pages: S. 258 - 374 , Ill., graph. Darst., Kt.
    ISBN: 9783910006539
    Series Statement: Geologica Saxonica 60,2
    Language: German , English
    Note: Beitr. teilw. dt., teilw. engl.
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 44
    Monograph available for loan
    Monograph available for loan
    Ecology and the environment (2014)
    New York : Springer
    Details Availability
    Call number: PIK N 531-19-92656
    Description / Table of Contents: In this book, plant biology is considered from the perspective of plants and their surrounding environment, including both biotic and abiotic interactions. The intended audience is undergraduate students in the middle or final phases of their programs of study. Topics are developed to provide a rudimentary understanding of how plant-environment interactions span multiple spatiotemporal scales, and how this rudimentary knowledge can be applied to understand the causes of ecosystem vulnerabilities in the face of global climate change and expansion of natural resource use by human societies. In all chapters connections are made from smaller to larger scales of ecological organization, providing a foundation for understanding plant ecology. Where relevant, environmental threats to ecological systems are identified and future research needs are discussed. As future generations take on the responsibility for managing ecosystem goods and services, one of the most effective resources that can be passed on is accumulated knowledge of how organisms, populations, species, communities and ecosystems function and interact across scales of organization. This book is intended to provide some of that knowledge, and hopefully provide those generations with the ability to avoid some of the catastrophic environmental mistakes that prior generations have made.--
    Type of Medium: Monograph available for loan
    Pages: XXIII, 659 Seiten , Illustrationen, Diagramme, Tabellen , 24 cm
    ISBN: 9781461475002
    Series Statement: The plant sciences 8
    Language: English
    Note: Contents: Plant-environment interactions across multiple scales -- Plant biodiversity and population dynamics -- Assembly of plant communities -- Plant pollination and dispersal -- Plant phenotypic expression in variable environments -- Evolutionary ecology of chemically mediated plant-insect interactions -- Plant-microbe interactions -- Patterns and controls of terrestrial primary production in a changing world -- Ecology of tropical rain forests -- Ecology of temperate forests -- Plants in deserts -- Plants in alpine environmnets -- Plants in arctic environments -- Grassland ecology -- Coastal wetland ecology and challenges for environmental management -- Near-coastal seagrass ecosystem -- Ecology of marine phytoplankton -- Plants in changing environmental conditions of the anthropocene -- Plant influences on atmospheric chemistry -- Biofuel development from cellulosic sources -- Plant ecology and sustainability science
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 45
    Monograph available for loan
    Monograph available for loan
    Qualitative text analysis : a guide to methods, practice & using software (2014)
    Los Angeles : Sage
    Details Availability
    Call number: PIK E 703-19-92900
    Description / Table of Contents: Providing students and researchers with a guide to systematic analysis, with an emphasis on using software, this is a hands-on introduction to the central steps involved with qualitative analysis.--
    Type of Medium: Monograph available for loan
    Pages: xvii, 173 Seiten , Illustrationen, Diagramme
    ISBN: 9781446267752 , 9781446267745
    Uniform Title: Qualitative Inhaltsanalyse
    URL: Inhaltsverzeichnis
    Language: English
    Note: Analysing qualitative data-but how? -- The building blocks of systematic qualitative text analysis -- Basic concepts and the process of qualitative text analysis -- Three basic methods of qualitative twxt analysis -- Qualitative text analysis using computer assistance -- Quality standards, research report, and documentation -- Concluding remarks
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 46
    Monograph available for loan
    Natural disasters and climate change : an economic perspective (2014)
    Cham : Springer
    Details Availability
    Call number: PIK B 160-19-93126
    Type of Medium: Monograph available for loan
    Pages: XXII, 194 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9783319089324
    URL: Cover
    Language: German
    Note: Contents: Introduction and Summary ; What Is a Disaster? An Economic Point of View ; Disaster Risks: Evidence and Theory ; Trends in Hazards and the Role of Climate Change ; Climate Change Impact on Natural Disaster Losses ; Methodologies for Disaster Risk Management in a Changing Environment ; Decision Making for Disaster Risk Management in a Changing Climate
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 47
    Monograph available for loan
    Monograph available for loan
    Quantum computation and quantum information (2010)
    Cambridge : Cambridge University Press
    Details Availability
    Call number: PIK N 185-18-91538
    Type of Medium: Monograph available for loan
    Pages: xxxi, 676 Seiten , Diagramme
    Edition: 10th anniversary edition
    ISBN: 9781107002173
    URL: http://www.gbv.de/dms/weimar/toc/637190246_toc.pdf
    Language: English
    Note: Fundamental Concepts -- Introduction and overview -- Introduction to quantum mechanics -- Introduction to computer science -- Quantum Computation -- Quantum circuits -- The quantum Fourier transform and its applications -- Quantum search algorithms -- Quantum computers: physical realisation -- Quantum Information -- Quantum noise, open quantum systems, and quantum operations -- Distance measurement for quantum information -- Quantum error-correction -- Entropy and information -- Quantum information theory -- Notes on basic probability theory -- Group theory -- Approximating quantum gates: the Solovay-Kitaev theorem -- Number theory -- Public-key cryptography and the RSA cryptosystem -- Proof of Lieb's theorem.
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 48
    Monograph available for loan
    Monograph available for loan
    Justice, political liberalism, and utilitarianism : themes from Harsanyi and Rawls (2010)
    Cambridge : Cambridge University Press
    Details Availability
    Call number: PIK D 029-20-93403
    Type of Medium: Monograph available for loan
    Pages: XII, 460 Seiten , Illustrationen, Diagramme
    Edition: 1. paperback ed.
    ISBN: 9780521184298
    Language: English
    Note: Contents: 1. An introduction to justice, political liberalism, and utilitarianism Marc Fleurbaey, Maurice Salles and John A. Weymark ; Part I. Themes from Rawls: 2. John Rawls's theory of justice: some critical comments John C. Harsanyi ; 3. Rawls, responsibility, and distributive justice Richard Arneson ; 4. Improving our ethical beliefs James Griffin ; Part II. Harsanyi's Impartial Observer and Social Aggregation Theorems: 5. Harsanyi's impartial observer is not a utilitarian John E. Roemer ; 6. Social aggregation and the expected utility hypothesis Charles Blackorby, David Donaldson and John A. Weymark ; 7. A welfarist version of Harsanyi's aggregation theorem Claude d'Aspremont and Philippe Mongin ; 8. Preference aggregation after Harsanyi Matthias Hild, Richard Jeffrey and Mathias Risse ; Part III. Goodness and Well-Being: 9. Can there be a preference-based utilitarianism? John Broome ; 10. Harsanyi, Rawls and the search for a common currency of advantage Robert Sugden ; 11. Utilitarianism versus fairness in welfare economics Marc Fleurbaey and François Maniquet ; 12. Rationality and want-satisfaction Brian Barry ; Part IV. Sharing the Gains from Social Cooperation ; 13. Naturalizing Harsanyi and Rawls Ken Binmore ; 14. The social contract naturalized Brian Skyrms ; 15. An alternative model of rational cooperation Edward F. McClennen ; Part V. Rights and Liberties: 16. Republican political theory Philip Pettit ; 17. Rule utilitarianism and liberal priorities Jonathan Riley.
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 49
    Monograph available for loan
    Monograph available for loan
    Systemtransformation : eine Einführung in die Theorie und Empirie der Transformationsforschung (2010)
    Wiesbaden : VS, Verlag für Sozialwissenschaften
    Details Availability
    Call number: PIK D 029-19-92804
    Type of Medium: Monograph available for loan
    Pages: 561 Seiten , Diagramme
    Edition: 2., überarbeitete und erweiterte Auflage
    ISBN: 9783531172019 (geb.) , 9783531145594 (pbk.)
    Series Statement: Lehrbuch
    URL: Inhaltsverzeichnis
    URL: Inhaltsverzeichnis
    Language: German
    Note: Contents: Einleitung ; I Theorie ; 1 Typologie politischer Systeme ; 2 Die Stabilität politischer Systeme ; 3 Transformationsbegriffe ; 4 Transformationstheorien ; 5 Massen und Eliten in der Transformation ; 6 Transformationsphasen ; II Die Demokratisierungswellen des 20. Jahrhunderts ; 1 Die erste Demokratisierungswelle: Die Entstehung von Demokratien ; 2 Die erste autokratische Gegenwelle: Der Zusammenbruch von Demokratien ; 3 Die zweite Demokratisierungswelle: Die Nachkriegsdemokratien in Deutschland, Italien und Japan ; III Die Dritte Demokratisierungswelle: Südeuropa ; 1 Die Demokratisierung in Südeuropa ; IV Die dritte Demokratisierungswelle: Lateinamerika ; 1 Typen autoritärer Regime ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung ; 5 Fazit und Ausblick ; V Die dritte Demokratisierungswelle: Ost- und Südostasien ; 1 Typen autoritärer Regime ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung ; 5 Fazit: Die Konsolidierung im Vergleich ; 6 Gibt es eine "asiatische Form" der Demokratie? ; VI Die dritte Demokratisierungswelle: Osteuropa ; 1 Die besondere Transformationsproblematik in Osteuropa ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung: Ungarn, Polen, Russland und Belarus im Vergleich ; VII Externe Demokratisierung ; 1 Demokratieförderung ; 2 Demokratisierung "durch" Krieg? ; Ausblick: Kehren die Diktaturen zurück? ; 1 Theoretische Paradigmen und empirische Artefakte ; Gegenwartsdiagnose ; Zukunftsprognose
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 50
    Monograph available for loan
    Monograph available for loan
    Mathematical bioeconomics : the mathematics of conservation (2010)
    Hoboken, NJ : Wiley
    Details Availability
    Call number: PIK M 370-21-94524
    Type of Medium: Monograph available for loan
    Pages: XV, 368 Seiten , graph. Darst.
    Edition: 3. ed.
    ISBN: 978-0-470-37299-9
    Series Statement: Pure and applied mathematics
    URL: Inhaltsverzeichnis
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 51
    Monograph available for loan
    Monograph available for loan
    A kinetic view of statistical physics (2010)
    Cambridge [u.a.] : Cambridge Univ. Press
    Details Availability
    Call number: PIK N 106-16-89934
    Type of Medium: Monograph available for loan
    Pages: XV, 488 S. , Ill., graph. Darst.
    ISBN: 9780521851039 (hbk.)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 52
    Monograph available for loan
    Monograph available for loan
    Water sustainability : a global perspective (2010)
    London : Routledge
    Details Availability
    Call number: PIK N 454-17-90902
    Type of Medium: Monograph available for loan
    Pages: XI, 452 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9781444104882 , 1444104888
    Language: English
    Note: Contents: 1. A looming crisis Part I Status and challenges 2. Rising demand and dwindling per capita resources 3. Water and poverty 4. Governance and finance 5. Pollution and water-related disease 6. Water, land and wildlife 7. Dams and diversions 8. Trading water - real and virtual 9. Water, war and terrorism 10. The threat of global warming Part II Nature's resources 11. The restless water cycle 12. Shrinking freshwater stores Part III Towards sustainability 13. Cutting demand 14. Increasing supplies 15. Cleaning up and protecting the aquatic environment 16. Using seawater 17. Controlling the weather 18. Improved monitoring and data management 19. Improving prediction and risk assessment 20. Improving management and justice 21. Aid for the developing world Conclusions 22. Is sustainability achievable?
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 53
    Monograph available for loan
    Monograph available for loan
    Grundriss der Wirtschaftsethik : von der Stammesmoral zur Ethik der Globalisierung (2010)
    Stuttgart : Kohlhammer
    Details
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    URL: Inhaltsverzeichnis
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 54
    Monograph available for loan
    Monograph available for loan
    Introduction to graph theory (2010)
    Harlow [u.a.] : Pearson/Prentice Hall
    Details Availability
    Call number: PIK M 390-16-89504
    Type of Medium: Monograph available for loan
    Pages: VIII, 184 S. , graph. Darst.
    Edition: 5. ed.
    ISBN: 9780273728894 (pbk.)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 55
    Monograph available for loan
    Monograph available for loan
    Science in the age of computer simulation (2010)
    Chicago [u.a.] : Univ. of Chicago Press
    Details Availability
    Call number: PIK A 190-15-89224
    Type of Medium: Monograph available for loan
    Pages: XI, 152 S. , Ill., graph. Darst
    ISBN: 0226902021 (cloth) , 9780226902029 (cloth) , 0226902048 (pbk.) , 9780226902043 (pbk.)
    URL: http://www.gbv.de/dms/bowker/toc/9780226902043.pdf
    Language: English
    Note: Introduction -- Sanctioning models : theories and their scope -- Methodology for a virtual world -- A tale of two methods -- When theories shake hands -- Models of climate : values and uncertainties -- Reliability without truth -- Conclusion..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 56
    Monograph available for loan
    Monograph available for loan
    Klimageschichte der Neuzeit : 1500 - 1900 (2010)
    Darmstadt : WBG (Wissenschaftliche Buchgesellschaft)
    Details Availability
    Call number: PIK N 456-19-93064
    Type of Medium: Monograph available for loan
    Pages: VII, 144 S. , Illustrationen, Diagramme, Karten , 240 mm x 165 mm
    ISBN: 9783534210244 (kart.)
    Series Statement: Geschichte kompakt
    URL: Inhaltsverzeichnis
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 57
    Monograph available for loan
    Monograph available for loan
    The performance economy (2010)
    Basingstoke, England : Palgrave Macmillan
    Details
    Call number: PIK B 160-16-90200
    Description / Table of Contents: This updated and revised edition outlines strategies and models for how to use technology and knowledge to improve performance, create jobs and increase income. It shows what skills will be required to produce, sell and manage performance over time, and how manual jobs can contribute to reduce the consumption of non-renewable resources
    Type of Medium: Monograph available for loan
    Pages: XXIII, 349 Seiten , graph. Darst.
    Edition: 2nd edition
    ISBN: 0230584667 (hbk.) , 9781349369195 (pbk.) , 9780230584662 (hbk.)
    URL: Inhaltsverzeichnis
    Language: English
    Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 58
    Monograph available for loan
    Monograph available for loan
    Out of water : from abundance to scarcity and how to solve the world's water problems (2010)
    Upper Saddle River, NJ : FT Press
    Details Availability
    Call number: PIK N 454-16-89315
    Type of Medium: Monograph available for loan
    Pages: XXIII, 230 S. , Ill., graph. Darst.
    Language: English
    Note: Chapter 1 Not Another Crisis! -- Chapter 2 From Abundance to Scarcity in 25 Years -- Chapter 3 Causes of Water Scarcity -- Chapter 4 Climate Change and Water -- Chapter 5 Agriculture and Water -- Chapter 6 Water, Food, and Poverty -- Chapter 7 Integrating Water Planning and Management -- Chapter 8 Water Governance for People and the Environment -- Chapter 9 Water Rights and Water Costs -- Chapter 10 Solving the World’s Water Problems
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 59
    Monograph available for loan
    Monograph available for loan
    Econometric analysis of cross section and panel data (2010)
    Cambridge, Mass. [u.a.] : MIT Press
    Details
    Call number: PIK B 020-16-89772
    Type of Medium: Monograph available for loan
    Pages: XXVII, 1064 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 0262232588 (hbk.) , 9780262232586
    Language: English
    Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 60
    Monograph available for loan
    Monograph available for loan
    Projected Costs of Generating Electricity (2010)
    Paris : OECD
    Details
    Call number: PIK P 113-10-0202
    Description / Table of Contents: This joint IEA/NEA report on electricity generating costs presents the latest data available for a wide variety of fuels and technologies, including coal and gas (with and without carbon capture), nuclear, hydro, onshore and offshore wind, biomass, solar, wave and tidal as well as combined heat and power (CHP).  It provides levelised costs of electricity (LCOE) per MWh for almost 200 plants, based on data covering 21 countries (including four major non-OECD countries), and several industrial companies and organisations.  For the first time, the report contains an extensive sensitivit
    Type of Medium: Monograph available for loan
    Pages: 215 S. : graph. Darst.
    ISBN: 9789264084308
    Language: English
    Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 61
    Series available for loan
    Series available for loan
    Hydrographisch-chemische Zustandseinschätzung der Ostsee 2009 (2010)
    Warnemünde : Inst. für Ostseeforschung
    Associated volumes
    Details Availability
    Call number: ZS-000(80)
    In: Meereswissenschaftliche Berichte
    Type of Medium: Series available for loan
    Pages: 147 S.
    Series Statement: Meereswissenschaftliche Berichte 80
    URL: http://www.io-warnemuende.de/tl_files/forschung/meereswissenschaftliche-berichte/mebe80_2010-zustand-hc-und-schwermetalle.pdf
    Classification:
    Oceanology
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 62
    Series available for loan
    Series available for loan
    Satellite image atlas of glaciers of the world; Glaciers of Asia (2010)
    Washington, DC : United States Government Printing Office
    Associated volumes
    Details Availability
    Call number: S 90.0002(1386-F) ; AWI G7-11-0050
    In: Satellite image atlas of glaciers of the world, 1386-F
    In: Professional paper, 1386-F
    Description / Table of Contents: This chapter is the ninth to be released in U.S. Geological Survey Professional Paper 1386, Satellite Image Atlas of Glaciers of the World, a series of 11 chapters. In each of the geographic area chapters, remotely sensed images, primarily from the Landsat 1, 2, and 3 series of spacecraft, are used to analyze the specific glacierized region of our planet under consideration and to monitor glacier changes. Landsat images, acquired primarily during the middle to late 1970s and early 1980s, were used by an international team of glaciologists and other scientists to study various geographic regions and (or) to discuss related glaciological topics. In each glacierized geographic region, the present areal distribution of glaciers is compared, wherever possible, with historical information about their past extent. The atlas provides an accurate regional inventory of the areal extent of glacier ice on our planet during the 1970s as part of a growing international scientific effort to measure global environmental change on the Earth's surface.The chapter is divided into seven geographic parts and one topical part: Glaciers of the Former Soviet Union (F-1), Glaciers of China (F-2), Glaciers of Afghanistan (F-3), Glaciers of Pakistan (F-4), Glaciers of India (F-5), Glaciers of Nepal (F-6), Glaciers of Bhutan (F-7), and the Paleoenvironmental Record Preserved in Middle-Latitude, High-Mountain Glaciers (F-8). Each geographic section describes the glacier extent during the 1970s and 1980s, the benchmark time period (1972-1981) of this volume, but has been updated to include more recent information.
    Type of Medium: Series available for loan
    Pages: VIII, F349 S. , Illustrationen
    ISBN: 9781411326095
    Series Statement: Satellite image atlas of glaciers of the world / ed. by Richard S. Williams ... F
    URL: https://pubs.usgs.gov/pp/p1386f/
    Classification:
    Regional Geology
    Language: English
    Note: Contents: F–1. GLACIERS OF THE FORMER SOVIET UNION / VLADIMIR M. KOTLYAKOV, with contributions from A.M. DYAKOVA (Siberia), V.S. KORYAKIN (Russian Arctic Islands), V.I. KRAVTSOVA (Caucasus, Altay), G.B. OSIPOVA (Tien Shan), G.M. VARNAKOVA (Pamirs and Alai Range), V.N. VINOGRADOV (Kamchatka), O.N. VINOGRADOV (Caucasus), and N.M. ZVERKOVA (Ural Mountains and Taymyr Peninsula) Sections on FLUCTUATIONS OF GLACIERS OF THE CENTRAL CAUCASUS AND GORA EL’BRUS (With a subsection on THE GLACIOLOGICAL DISASTER IN NORTH OSETIYA / VLADIMIR M. KOTLYAKOV, O.V. ROTOTAEVA, and G.A. NOSENKO INVESTIGATIONS OF THE FLUCTUATIONS OF SURGE-TYPE GLACIERS IN THE PAMIRS BASED ON OBSERVATIONS FROM SPACE / VLADIMIR M. KOTLYAKOV, G.B. OSIPOVA, and D.G. TSVETKOV THE GLACIOLOGY OF THE RUSSIAN HIGH ARCTIC FROM LANDSAT IMAGERY / J.A. DOWDESWELL, E.K. DOWDESWELL, M. WILLIAMS, and A.F. GLAZOVSKII F–2. GLACIERS OF CHINA / SHI YAFENG, MI DESHENG, YAO TANDONG, ZENG QUNZHU, and LIU CHAOHAI F–3 GLACIERS OF AFGHANISTAN / JOHN E. SHRODER , JR ., and MICHAEL P. BISHOP F–4 GLACIERS OF PAKISTAN / JOHN E. SHRODER , JR ., and MICHAEL P. BISHOP F–5 GLACIERS OF INDIA / CHANDER P. VOHRA Updated supplement on A STUDY OF SELECTED GLACIERS UNDER THE CHANGING CLIMATE REGIME / SYED IQBAL HASNAIN, RAJESH KUMAR , SAFARAZ AHMAD, and SHRESTH TAYAL F–6 GLACIERS OF NEPAL — GLACIER DISTRIBUTION IN THE NEPAL HIMALAYA WITH COMPARISON TO THE KARAKORAM RANGE / KEIJI HIGUCHI, OKITSUGU WATANABE, HIROJI FUSHIMI, SHUHEI TAKENAKA, and AKIO NAGOSHI, Supplement by YUTAKA AGETA F–7 GLACIERS OF BHUTAN / SHUJI IWATA F–8 THE PALEOENVIRONMENTAL RECORD PRESERVED IN MIDDLE-LATITUDE, HIGH-MOUNTAIN GLACIERS: AN OVERVIEW OF U.S. GEOLOGICAL SURVEY RESEARCH IN CENTRAL ASIA AND THE UNITED STATES / L. DeWAYNE CECIL, DAVID L. NAFTZ, PAUL F. SCHUSTER , DAVID D. SUSONG, and JAROMY R . GREEN
    Location: Lower compact magazine
    Location: AWI Reading room
    Branch Library: GFZ Library
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 63
    Monograph available for loan
    Monograph available for loan
    Handwerk (2010)
    Berlin : Berliner Taschenbuch-Verl.
    Details Availability
    Call number: PIK B 160-11-0102
    Type of Medium: Monograph available for loan
    Pages: 431 S.
    Edition: 2. Aufl.
    ISBN: 9783833306327
    Series Statement: BvT 632
    Uniform Title: The craftsman
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 64
    Monograph available for loan
    Monograph available for loan
    Tatort Statistik : wie Sie zweifelhafte Daten und fragwürdige Interpretationen erkennen (2010)
    Heidelberg : Spektrum, Akad. Verl.
    Details Availability
    Call number: PIK M 310-12-0105
    Description / Table of Contents: Contents: Teil 1 - Zum Auftakt ; Zweifelhafte Zahlen ; Allgemeine Hintergründe ; Teil 2 - Verschiedene Arten verdächtiger Daten ; Pfusch ; Quellen: Wer hat gezählt? Weshalb wurde gezählt? ; Definitionen: Was wurde gezählt? ; Kriterien: Wie wurde gezählt? ; Verpackung: Was wird uns gesagt? ; Debatten: Wenn Statistiken einander widersprechen ; Teil 3 - Allein im Datendschungel. Wie Sie fehlerhafte Statistiken im Alltag entlarven ; Zusammenfassung: Woran Sie verdächtige Daten erkennen ; Bessere Statistiken: Wie sie aussehen sollten ; Nachwort: Wenn Sie keine Ahnung davon hatten, dass die Dinge so schlecht stehen, stehen sie im Allgemeinen auch nicht so schlecht ; Anregungen für alle, die sich selbst detektivisch am Tatort Statistik betätigen wollen
    Type of Medium: Monograph available for loan
    Pages: IX, 157 S. : graph. Darst.
    ISBN: 9783827425232
    Series Statement: Spektrum Akademischer Verlag Sachbuch
    Uniform Title: Stat spotting
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 65
    Monograph available for loan
    Monograph available for loan
    100 einzigartige Orte, die schon bald verschwinden könnten (2010)
    München : Knesebeck
    Details Availability
    Call number: PIK N 076-10-0102
    Type of Medium: Monograph available for loan
    Pages: 289 S. : zahlr. Ill., Kt.
    Edition: Dt. Erstausg.
    ISBN: 9783868732238
    Uniform Title: 100 places to remember before they disappear
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 66
    Monograph available for loan
    Monograph available for loan
    The subterranean forest : energy systems and the industrial revolution (2010)
    Cambridge : White Horse Press
    Details Availability
    Call number: PIK B 160-11-0030
    Description / Table of Contents: Contents: Preface ; I. Energy Systems and Social Evolution ; 1. Palaeolithic Hunter-gatherer Societies ; 2. The Neolithic Revolution and the Problem of Dynamics ; 3. Traditional Agriculture - A Controlled Solar Energy System ; 4. The Structure of the Agrarian Energy System ; 5. The Dynamics of Agrarian Society ; 6. Crisis and Transformation ; 7. The Industrial System and Fossil Energy ; II. Forest and Wood in Preindustrial Germany ; 1. Natural Foundations ; 2. Preindustrial Wood Consumption ; 3. Regulation Problems ; III. England: Coal in the Industrial Revolution ; 1. Substitution of Wood by Coal ; 2. Wood and Coal in Iron Smelting ; 3. Transport and Steam Power ; 4. Significance of Coal in the Industrial Revolution ; IV. Germany in the 18th Century: Wood Crisis and Strategies for Solutions ; 1. Conserving Wood ; 2. Functional Separation of Agriculture and Forestry ; 3. Substitution for Wood ; 4. Was the Wood Crisis an Energy Crisis? ; V. Perceptions of Fossil Energy ; 1. The Finiteness of Fossil Fuels ; 2. Classical Political Economy and the Stationary State ; 3. Jevons and the Contraction of the Industrial System ; 4. Nuclear or Solar Energy ; Bibliography
    Type of Medium: Monograph available for loan
    Pages: X, 230 S. : graph. Darst.
    Edition: 1. pbk. ed.
    ISBN: 9781874267539
    Uniform Title: Der unterirdische Wald
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 67
    Series available for loan
    Series available for loan
    Arbeitsgruppe Automation in Kartographie, Photogrammetrie und GIS Tagung 2009 (2010)
    Frankfurt am Main : Verl. des Bundesamtes für Kartographie und Geodäsie
    Associated volumes
    Details Availability
    Call number: S 99.0435(45)
    In: Mitteilungen des Bundesamtes für Kartographie und Geodäsie
    Type of Medium: Series available for loan
    Pages: 176 S.
    ISBN: 9783898889575
    Series Statement: Mitteilungen des Bundesamtes für Kartographie und Geodäsie 45
    Classification:
    Cartography, Geographical Information Systems, GIS
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 68
    Monograph available for loan
    Monograph available for loan
    Reset : wie wir anders leben, arbeiten und eine neue Ära des Wohlstands begründen werden (2010)
    Frankfurt am Main [u.a.] : Campus
    Details Availability
    Call number: PIK B 160-11-0067
    Description / Table of Contents: Contents: Teil I: Vergangenheit als Prolog ; 1. Der große Reset ; 2. Die großen Vorgänger ; 3. Stadtentwicklung als Innovation ; 4. Das Jahrzehnt der größten technischen Fortschritte ; 5. Die Stunde der Vorstadt ; 6. Raumlösungen ; 7. Die Fäden entwirren ; Teil II: Die Umgestaltung der Wirtschaftslandschaft ; 8. Die Hauptstadt des Kapitals ; 9. Ablösung an der Spitze? ; 10. Der FIRE-Sektor ; 11. Der Boom der Behördenstädte ; 12. Leben und Sterben alter Industriestädte ; 13. Nordlicht ; 14. Sonnenuntergang über dem Sunbelt ; Teil III: Eine neue Lebensweise ; 15. Die Reset-Ökonomie ; 16. Eine gute Jobmaschine ; 17. Die neue Normalität ; 18. Die große Umsiedlung ; 19. Groß, schnell und grün ; 20. Die eigene Geschwindigkeit ; 21. Wie ein geölter Blitz ; 22. Ein Traum zur Miete ; 23. Der Zeitpunkt für den Reset
    Type of Medium: Monograph available for loan
    Pages: 248 S.
    ISBN: 9783593391250
    Uniform Title: The great reset
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 69
    Monograph available for loan
    Monograph available for loan
    Der flexible Mensch : die Kultur des neuen Kapitalismus (2010)
    Berlin : Berliner Taschenbuch-Verl.
    Details Availability
    Call number: PIK B 160-11-0101
    Type of Medium: Monograph available for loan
    Pages: 223 S.
    Edition: 8. Aufl.
    ISBN: 9783833303425
    Series Statement: BvT 342
    Uniform Title: The corrosion of character
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 70
    Monograph available for loan
    Monograph available for loan
    Leitfaden zur Finanzierung indirekter Maßnahmen des 7. Forschungsrahmenprogramms : [Übersetzung des Originaltextes der Europäischen Kommission] (2010)
    Hamburg : TuTech Innovation
    Details Availability
    Call number: PIK A 130-10-0242
    Type of Medium: Monograph available for loan
    Pages: 131 S. : graph. Darst.
    Edition: Version 30.6.2010
    ISBN: 9783941492288
    Uniform Title: Guide to financial issues relating to indirect actions of the seventh framework programmes
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 71
    Monograph available for loan
    Monograph available for loan
    Beyond the age of oil : the myths, realities, and future of fossil fuels and their alternatives (2010)
    Santa Barbara [u.a.] : Praeger
    Details Availability
    Call number: PIK P 120-11-0035
    Description / Table of Contents: Contents: Introduction ; Part I - The Fossil Sources ; 1. "King" oil ; 2. The splendor and misery of coal ; 3. All that gas ; 4. The quest to eliminate carbon dioxide ; Part II - The Alternatives ; 5. Nuclear power: renaissance or decline? ; 6. The weight of water ; 7. Biofuels: behind the smoke and mirrors ; 8. Gone with the wind? ; 9. The sun also rises ; 10. Geothermal power: the primitive energy of the earth ; 11. The hype about hydrogen, the hope about electric cars ; 12. Energy efficiency: the invisible source of energy ; Conclusions: how can we escape our energy trap?
    Type of Medium: Monograph available for loan
    Pages: XXXI, 259 S. : Ill.
    ISBN: 9780313381713
    Uniform Title: Con tutta l'energia possibile
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 72
    Monograph available for loan
    Monograph available for loan
    Graph theory (2010)
    Heidelberg [u.a.] : Springer
    Details Availability
    Call number: PIK M 390-16-89505
    Type of Medium: Monograph available for loan
    Pages: XVIII, 436 S. , graph. Darst. , 235 mm x 155 mm
    Edition: 4. ed., 2. corr. print.
    ISBN: 9783642142789 (PB.) , 9783642142796
    Series Statement: Graduate texts in mathematics 173
    URL: Inhaltsverzeichnis
    URL: Inhaltstext
    URL: http://www.gbv.de/dms/bowker/toc/9783642142789.pdf
    Language: English
    Note: The basics -- Matching, covering and packing -- Connectivity -- Planar graphs -- Colouring -- Flows -- Extremal graph theory -- Infinite graphs -- Ramsey theory for graphs -- Hamilton cycles -- Random graphs -- Minors, trees, and WQO..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 73
    Series available for loan
    Series available for loan
    Eiszeitalter und Gegenwart; Vol. 67, No. 1-2 (2010)
    Göttingen : Copernicus
    Associated volumes
    Details Availability
    Call number: S 01.0495(67,1-2)
    In: Eiszeitalter und Gegenwart
    Type of Medium: Series available for loan
    Pages: 84 Seiten , Illustrationen, Diagramme, Karten , 21 x 29,7 cm
    ISSN: 0424-7116
    Series Statement: Eiszeitalter und Gegenwart Vol 67, No. 1-2
    URL: https://www.eg-quaternary-sci-j.net/67/
    Language: English
    Note: Editorial E&G Quaternary Science Journal, Vol. 67 (2018) Christopher Lüthgens and Margot Böse E&G Quaternary Sci. J., 67, 85-86, 2019. 〈a href="https://doi.org/10.5194/egqsj-67-85-2019" target="_blank"〉https://doi.org/10.5194/egqsj-67-85-2019〈/a〉 , Middle to Late Holocene mobilization of DOC-bound Pb and Y in the Magellanic moorlands (53° S) as a function of sea spray fertilization, climate variations and volcanic fallout? A preliminary report Björn Klaes, Rolf Kilian, Gerhard Wörner, Sören Thiele-Bruhn, and Helge W. Arz E&G Quaternary Sci. J., 67, 1-6, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-1-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-1-2018〈/a〉 , Capability of U–Pb dating of zircons from Quaternary tephra: Jemez Mountains, NM, and La Sal Mountains, UT, USA Jana Krautz, Mandy Hofmann, Andreas Gärtner, Ulf Linnemann, and Arno Kleber E&G Quaternary Sci. J., 67, 7-16, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-7-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-7-2018〈/a〉 , Reconsidering the origin of the Sedrun fans (Graubünden, Switzerland) Catharina Dieleman, Susan Ivy-Ochs, Kristina Hippe, Olivia Kronig, Florian Kober, and Marcus Christl E&G Quaternary Sci. J., 67, 17-23, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-17-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-17-2018〈/a〉 , Disestablishing “Glacial Lake Speight”, New Zealand? An example for the validity of detailed geomorphological assessment with the study of mountain glaciations Stefan Winkler, David Bell, Maree Hemmingsen, Kate Pedley, and Anna Schoch E&G Quaternary Sci. J., 67, 25-31, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-25-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-25-2018〈/a〉 , Proglacial streams and their chronology in the glacier forefields of the Himalayas Gerrit Tombrink E&G Quaternary Sci. J., 67, 33-36, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-33-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-33-2018〈/a〉 , Glacial history of the upper Drac Blanc catchment (Écrins massif, French Alps) Felix Martin Hofmann E&G Quaternary Sci. J., 67, 37-40, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-37-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-37-2018〈/a〉 , New data from the Middle Palaeolithic Cotencher cave (Swiss Jura): site formation, environment, and chronology Judit Deák, Frank Preusser, Marie-Isabelle Cattin, Jean-Christophe Castel, and François-Xavier Chauvière E&G Quaternary Sci. J., 67, 41-72, 2019. 〈a href="https://doi.org/10.5194/egqsj-67-41-2019" target="_blank"〉https://doi.org/10.5194/egqsj-67-41-2019〈/a〉 , Fortification, mining, and charcoal production: landscape history at the abandoned medieval settlement of Hohenwalde at the Faule Pfütze (Saxony, Eastern Ore Mountains) Johann Friedrich Tolksdorf, Matthias Schubert, Frank Schröder, Libor Petr, Christoph Herbig, Petr Kočár, Mathias Bertuch, and Christiane Hemker E&G Quaternary Sci. J., 67, 73-84, 2019. 〈a href="https://doi.org/10.5194/egqsj-67-73-2019" target="_blank"〉https://doi.org/10.5194/egqsj-67-73-2019〈/a〉
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 74
    Monograph available for loan
    Monograph available for loan
    A deadly indifference (2014)
    Princeton, NJ : Princeton Univ. Press
    Details Availability
    Call number: PIK B 100-15-0144
    Type of Medium: Monograph available for loan
    Pages: 179 S.
    Edition: 1. Princeton paperback print.
    ISBN: 0691059691 (pbk.) , 9780691164168
    Series Statement: A Henry Spearman mystery
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...