ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • Books  (124)
  • Data
  • Online Books  (124)
  • 2020-2021
  • 2015-2019  (2)
  • 2010-2014  (124)
  • 2010  (124)
Collection
  • Books  (124)
  • Data
Language
Years
Year
Classification
Branch Library
  • 1
    Monograph available for loan
    Monograph available for loan
    Paris : OECD
    Call number: PIK P 113-10-0202
    Description / Table of Contents: This joint IEA/NEA report on electricity generating costs presents the latest data available for a wide variety of fuels and technologies, including coal and gas (with and without carbon capture), nuclear, hydro, onshore and offshore wind, biomass, solar, wave and tidal as well as combined heat and power (CHP).  It provides levelised costs of electricity (LCOE) per MWh for almost 200 plants, based on data covering 21 countries (including four major non-OECD countries), and several industrial companies and organisations.  For the first time, the report contains an extensive sensitivit
    Type of Medium: Monograph available for loan
    Pages: 215 S. : graph. Darst.
    ISBN: 9789264084308
    Language: English
    Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    Monograph available for loan
    Monograph available for loan
    University Park, Pa : Pennsylvania State University Press
    Call number: IASS 16.90520
    Description / Table of Contents: "An interdisciplinary study of democratic theory, empirical political science, psychology, and philosophy. Proposes a multidimensional process model of empathy that incorporates both affective and cognitive features to demonstrate the importance of empathy in fulfilling democracy's promise of giving equal consideration to all citizens in collective decisions"--Provided by publisher
    Type of Medium: Monograph available for loan
    Pages: viii, 221 S. , graph. Darst.
    ISBN: 9780271036595 (cloth) , 9780271036601 (pbk)
    Language: English
    Note: The democratic promiseThe deliberative turn in democratic theory -- The elusive concept of empathy -- Empathy in deliberative theory -- Empathy's importance : the empirical evidence -- Deliberative democracy and its critics -- Empathy and democracy..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 4
    Monograph available for loan
    Monograph available for loan
    Princeton and Oxford : Princeton University Press,
    Call number: M 17.90645
    Description / Table of Contents: Cover; Title; Copyright; Contents; List of Illustrations; Preface; PART ONE: What Has Controlled Earth's Climate?; CHAPTER ONE: Climate and Human History; PART TWO: Nature in Control; CHAPTER TWO: Slow Going for a Few Million Years; CHAPTER THREE: Linking Earth's Orbit to Its Climate; CHAPTER FOUR: Orbital Changes Control Ice-Age Cycles; CHAPTER FIVE: Orbital Changes Control Monsoon Cycles; CHAPTER SIX: Stirrings of Change; PART THREE: Humans Begin to Take Control; CHAPTER SEVEN: Early Agriculture and Civilization; CHAPTER EIGHT: Taking Control of Methane
    Description / Table of Contents: CHAPTER NINE: Taking Control of CO[sub(2)]CHAPTER TEN: Have We Delayed a Glaciation?; CHAPTER ELEVEN: Challenges and Responses; PART FOUR: Disease Enters the Picture; CHAPTER TWELVE: But What about Those CO[sub(2)] "Wiggles"?; CHAPTER THIRTEEN: The Horsemen of the Apocalypse: Which One?; CHAPTER FOURTEEN: Pandemics, CO[sub(2)], and Climate; PART FIVE: Humans in Control; CHAPTER FIFTEEN: Greenhouse Warming: Tortoise and Hare; CHAPTER SIXTEEN: Future Warming: Large or Small?; CHAPTER SEVENTEEN: From the Past into the Distant Future; EPILOGUE; CHAPTER EIGHTEEN: Global-Change Science and Politics
    Description / Table of Contents: CHAPTER NINETEEN: Consuming Earth's GiftsAfterword to the Princeton Science Library Edition; Bibliography; Figure Sources; Index; A; B; C; D; E; F; G; H; I; K; L; M; N; O; P; R; S; T; U; V; W; Y
    Description / Table of Contents: The impact on climate from 200 years of industrial development is an everyday fact of life, but did humankind''s active involvement in climate change really begin with the industrial revolution, as commonly believed? Plows, Plagues, and Petroleum has sparked lively scientific debate since it was first published--arguing that humans have actually been changing the climate for some 8,000 years--as a result of the earlier discovery of agriculture. The ""Ruddiman Hypothesis"" will spark intense debate. We learn that the impact of farming on greenhouse-gas levels, thousands of years before the i
    Type of Medium: Monograph available for loan
    Pages: xiv, 226 Seiten , Illustrationen
    Edition: New Princeton Science Library edition
    ISBN: 9780691173214
    Series Statement: Princeton Science Library
    Classification:
    Meteorology and Climatology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    Monograph available for loan
    Monograph available for loan
    Basingstoke, England : Palgrave Macmillan
    Call number: PIK B 160-16-90200
    Description / Table of Contents: This updated and revised edition outlines strategies and models for how to use technology and knowledge to improve performance, create jobs and increase income. It shows what skills will be required to produce, sell and manage performance over time, and how manual jobs can contribute to reduce the consumption of non-renewable resources
    Type of Medium: Monograph available for loan
    Pages: XXIII, 349 Seiten , graph. Darst.
    Edition: 2nd edition
    ISBN: 0230584667 (hbk.) , 9781349369195 (pbk.) , 9780230584662 (hbk.)
    Language: English
    Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    Keywords: Australia ; environment ; climate change ; biogeography ; palaeoecology ; human ecology
    Description / Table of Contents: Like a star chart this volume orientates the reader to the key issues and debates in Pacific and Australasian biogeography, palaeoecology and human ecology. A feature of this collection is the diversity of approaches ranging from interpretation of the biogeographic significance of plant and animal distributional patterns, pollen analysis from peats and lake sediments to discern Quaternary climate change, explanation of the patterns of faunal extinction events, the interplay of fire on landscape evolution, and models of the environmental consequences of human settlement patterns. The diversity of approaches, geographic scope and academic rigor are a fitting tribute to the enormous contributions of Geoff Hope. As made apparent in this volume, Hope pioneered multidisciplinary understanding of the history and impacts of human cultures in the Australia- Pacific region, arguably the globe’s premier model systems for understanding the consequences of human colonization on ecological systems. The distinguished scholars who have contributed to this volume also demonstrate Hope’s enduring contribution as an inspirational research leader, collaborator and mentor. Terra Australis leave no doubt that history matters, not only for land management, but more importantly, in alerting settler and indigenous societies alike to their past ecological impacts and future environmental trajectories.
    Pages: Online-Ressource (512 Seiten)
    ISBN: 9781921666810
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Journal available for loan
    Journal available for loan
    Tübingen : Mohr Siebeck ; 1.1884 - 48.1931; N.F. 1.1932/33 - 10.1943/44(1945),3; 11.1948/49(1949) -
    Call number: ZS 22.95039
    Type of Medium: Journal available for loan
    Pages: Online-Ressource
    ISSN: 1614-0974 , 0015-2218 , 0015-2218
    Language: German , English
    Note: N.F. entfällt ab 57.2000. - Volltext auch als Teil einer Datenbank verfügbar , Ersch. ab 2000 in engl. Sprache mit dt. Hauptsacht.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Monograph available for loan
    Monograph available for loan
    Cambridge, Mass. [u.a.] : MIT Press
    Call number: PIK B 020-16-89772
    Type of Medium: Monograph available for loan
    Pages: XXVII, 1064 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 0262232588 (hbk.) , 9780262232586
    Language: English
    Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    facet.materialart.12
    Berlin, New York : De Gruyter Saur
    Call number: 9783110232103 (e-book)
    Description / Table of Contents: With the term "Library 2.0" the editors mean an institution which applies the principles of the Web 2.0 such as openness, re-use, collaboration and interaction in the entire organization. Libraries are extending their service offerings and work processes to include the potential of Web 2.0 technologies. This changes the job description and self-image of librarians. The collective volume offers a complete overview of the topic Library 2.0 and the current state of developments from a technological, sociological, information theoretical and practice-oriented perspective
    Type of Medium: 12
    Pages: 1 Online-Ressource (1 electronic resource (xii, 392 p.))
    Edition: Online-Ausg.
    ISBN: 9783110232103 , 9783110232097
    Series Statement: Bibliotheks- und Informationspraxis 41
    Language: Undetermined
    Note: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Call number: 3/S 07.0034(2017)
    In: Annual report
    Type of Medium: Monograph available for loan
    Pages: 51 Seiten
    ISSN: 1865-6439 , 1865-6447
    URL: Volltext  (kostenfrei)
    Parallel Title: Annual report ... / Helmholtz Association of German Research Centres
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    Keywords: climate change mitigation ; emission reductions ; electricity ; energy efficiency ; energy policy ; emission ; climate change ; drought ; climate ; forests ; carbon dioxide ; low-carbon ; global greenhouse gas emissions ; emissions ; colors ; deforestation ; transport sector ; global greenhouse gas ; carbon dioxide mitigation
    Description / Table of Contents: Governments and civil society in Latin America and the Caribbean should be well informed about the potential costs and benefits of combating climate change, their policy options over the next decades, and the global context for these policy decisions. At the same time, the global community needs to be better informed about the unique perspective of the Latin American and Caribbean region: problems the region will face, its potential contributions toward combating global warming, and how to maximize this potential while continuing to maintain growth and reduce poverty. This book, a companion volume to Low Carbon, High Growth: Latin American Responses to Climate Change, seeks to help fill both these needs.
    Pages: Online-Ressource (XIV, 200 Seiten)
    ISBN: 9780821380819
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
    Description / Table of Contents: The discovery of dinosaurs and other large extinct ‘saurians’ - a term under which the Victorians commonly lumped ichthyosaurs, plesiosaurs, pterosaurs and their kin - makes exciting reading and has caught the attention of palaeontologists, historians of science and the general public alike. The papers in this collection go beyond the familiar tales about famous ‘fossil hunters’ and focus on relatively little-known episodes in the discovery and interpretation (from both a scientific and an artistic point of view) of dinosaurs and other inhabitants of the Mesozoic world. They cover a long time span, from the beginnings of ‘modern’ scientific palaeontology in the 1700s to the present, and deal with many parts of the world, from the Yorkshire coast to Central India, from Bavaria to the Sahara. The characters in these stories include professional palaeontologists and geologists (some of them well-known, others quite obscure), explorers, amateur fossil collectors, and artists, linked together by their interest in Mesozoic creatures.
    Pages: Online-Ressource (394 Seiten)
    ISBN: 9781862393110
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 13
    Description / Table of Contents: This wide area of the Alpine–Himalayan belt evolved through a series of tectonic events related to the opening and closure of the Tethys Ocean. In doing so it produced the largest mountain belt of the world, which extends from the Atlantic to the Pacific oceans. The basins associated with this belt contain invaluable information related to mountain building processes and are the locus of rich hydrocarbon accumulations. However, knowledge about the geological evolution of the region is limited compared to what they offer. This has been mainly due to the difficulty and inaccessibility of cross-country studies. This Special Publication is dedicated to the part of the Alpine–Himalayan belt running from Bulgaria to Armenia, and from Ukraine to the Arabian Platform. It includes twenty multidisciplinary studies covering topics in structural geology/tectonics; geophysics; geochemistry; palaeontology; petrography; sedimentology; stratigraphy; and subsidence and lithospheric modelling. This volume reports results obtained during the MEBE (Middle East Basin Evolution) Programme and related projects in the circum Black Sea and peri-Arabian regions.
    Pages: Online-Ressource (VII, 509 Seiten)
    ISBN: 9781862393080
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 14
    Description / Table of Contents: The invasion of the land by plants (‘terrestrialization’) was one of the most significant evolutionary events in the history of life on Earth, and correlates in time with periods of major palaeoenvironmental perturbations. The development of a vegetation cover on the previously barren land surfaces impacted on the global biogeochemical cycles and the geological processes of erosion and sediment transport. The terrestrialization of plants preceded the rise of major new groups of animals, such as insects and tetrapods, the latter numbering some 24 000 living species, including ourselves. Early land-plant evolution also correlates with the most spectacular decline of atmospheric CO2 concentration of Phanerozoic times and with the onset of a protracted period of glacial conditions on Earth. This book includes a selection of papers covering different aspects of the terrestrialization, from palaeobotany to vertebrate palaeontology and geochemistry, promoting a multidisciplinary approach to the understanding of the co-evolution of life and its environments during Early to Mid-Palaeozoic times.
    Pages: Online-Ressource (187 Seiten)
    ISBN: 9781862393097
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Description / Table of Contents: This volume honours the career of Brian F. Windley, who has been hugely influential in helping to achieve our current understanding of the evolution of the continental crust, and who has inspired many students and scientists to pursue studies on the evolution of the continents. Brian has studied processes of continental formation and evolution on most continents and of all ages, and has educated and inspired two generations of geologists to undertake careers in studies of continental evolution. The volume is organized into six sections, including: oceanic and island arc systems and continental growth; tectonics of accretionary orogens and continental growth; growth and stabilization of continental crust; collisions and intraplate processes; Precambrian tectonics and the birth of continents; and active tectonics and geomorphology of continental collision and growth zones.
    Pages: Online-Ressource (VIII, 414 Seiten)
    ISBN: 9781862393035
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    Keywords: geological processes; tectonics; numerical models
    Description / Table of Contents: Disequilibrium textures versus equilibrium modelling: geochronology at the crossroads / Igor M. Villa / Geological Society, London, Special Publications, 332, 1-15, 1 January 2010, https://doi.org/10.1144/SP332.1 --- Argon enters the retentive zone: reassessment of diffusion parameters for K-feldspar in the South Cyclades Shear Zone, Ios, Greece / M. A. Forster and G. S. Lister / Geological Society, London, Special Publications, 332, 17-34, 1 January 2010, https://doi.org/10.1144/SP332.2 --- Serrated quartz grain boundaries, temperature and strain rate: testing fractal techniques in a syntectonic granite / Manish A. Mamtani and R. O. Greiling / Geological Society, London, Special Publications, 332, 35-48, 1 January 2010, https://doi.org/10.1144/SP332.3 --- Microstructure and elastic anisotropy of naturally deformed leucogneiss from a shear zone in Montalto (southern Calabria, Italy) / Rosolino Cirrincione, Eugenio Fazio, Renée Heilbronner, Hartmut Kern, Kurt Mengel, Gaetano Ortolano, Antonino Pezzino and Rosalda Punturo / Geological Society, London, Special Publications, 332, 49-68, 1 January 2010, https://doi.org/10.1144/SP332.4 --- Geometry of intercrystalline brine in plastically deforming halite rocks: inference from electrical resistivity / Tohru Watanabe / Geological Society, London, Special Publications, 332, 69-78, 1 January 2010, https://doi.org/10.1144/SP332.5 --- Brittle plus plastic deformation of gypsum aggregates experimentally deformed in torsion to high strains: quantitative microstructural and texture analysis from optical and diffraction data / M. Zucali, V. Barberini, D. Chateigner, B. Ouladdiaf and L. Lutterotti / Geological Society, London, Special Publications, 332, 79-98, 1 January 2010, https://doi.org/10.1144/SP332.6 --- Numerical modelling of spontaneous slab breakoff dynamics during continental collision / Cyrill Baumann, Taras V. Gerya and James A. D. Connolly / Geological Society, London, Special Publications, 332, 99-114, 1 January 2010, https://doi.org/10.1144/SP332.7 --- Present-day vertical isostatic readjustment of the Western Alps revealed by numerical modelling and geodetic and seismotectonic data / Annalisa Gardi, Stéphane Baize and Oona Scotti / Geological Society, London, Special Publications, 332, 115-128, 1 January 2010, https://doi.org/10.1144/SP332.8 --- Block model versus thermomechanical model: new insights on the present-day regional deformation in the surroundings of the Calabrian Arc / Raffaele Splendore, Anna Maria Marotta, Riccardo Barzaghi, Alessandra Borghi and Letizia Cannizzaro / Geological Society, London, Special Publications, 332, 129-147, 1 January 2010, https://doi.org/10.1144/SP332.9 --- The role of mantle hydration in continental crust recycling in the wedge region / Marco Meda, Anna Maria Marotta and Maria Iole Spalla / Geological Society, London, Special Publications, 332, 149-172, 1 January 2010, https://doi.org/10.1144/SP332.10 --- Three-dimensional evaluation of fabric evolution and metamorphic reaction progress in polycyclic and polymetamorphic terrains: a case from the Central Italian Alps / Francesca Salvi, Maria Iole Spalla, Michele Zucali and Guido Gosso / Geological Society, London, Special Publications, 332, 173-187, 1 January 2010, https://doi.org/10.1144/SP332.11 --- The interaction of deformation and metamorphic reactions / Bruce E. Hobbs, Alison Ord, Maria Iole Spalla, Guido Gosso and Michele Zucali / Geological Society, London, Special Publications, 332, 189-223, 1 January 2010, https://doi.org/10.1144/SP332.12
    Pages: Online-Ressource (VII, 230 Seiten) , Illustrationen, Diagramme, Karten
    ISBN: 9781862395800
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
    Description / Table of Contents: Onshore fold–thrust belts are commonly perceived as ‘difficult’ places to explore for hydrocarbons and are therefore often avoided. However, these belts host large oil and gas fields and so these barriers to effective exploration mean that substantial unexploited resources may remain. Over time, evaluation techniques have improved. It is possible in certain circumstances to achieve good 3D seismic data. Structural restoration techniques have moved into the 3D domain and increasingly sophisticated palaeo-thermal indicators allow better modelling of burial and uplift evolution of source and reservoirs. Awareness of the influence of pre-thrust structure and stratigraphy and of hybrid thick and thin-skinned deformation styles is augmenting the simplistic geometric models employed in earlier exploration. But progress is a slow, expensive and iterative process. Industry and academia need to collaborate in order to develop and continually improve the necessary understanding of subsurface geometries, reservoir and charge evolution and timing; this publication offers papers on specific techniques, outcrop and field case studies.
    Pages: Online-Ressource (190 Seiten)
    ISBN: 9781862393172
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 18
    Keywords: carbon ; energy ; climate change ; coal emissions ; energy efficiency
    Description / Table of Contents: This study from the Independent Evaluation Group draws lessons for development and climate change mitigation from the World Bank Group’s far-reaching portfolio of projects in energy, forestry, transport, coal power, and technology transfer. Reviewing what has worked, what hasn’t, and why, the evaluation’s key findings include: Energy efficiency can offer countries direct economic returns that dwarf those of most other development projects, while also reducing greenhouse gas emissions. Tropical forest protected areas, on average, significantly reduce tropical deforestation, preserving carbon and biodiversity. Deforestation rates are lower in areas that allowed sustainable use by local populations than in strictly protected areas. Deforestation rates were lowest of all in indigenous forest areas. For renewable energy projects, long-duration loans have been important in making projects financially viable.. But at prevailing carbon prices, carbon offset sales had little impact on most renewable energy projects’ rate of returns, and did not address investors’ need for up-front capital. Technology transfer – broadly understood to include diffusion of technical and financial innovations related to low-carbon development – has worked well when the logic of piloting and demonstration is well thought out, and when grants are used to mitigate the risk of pioneering efforts.
    Pages: Online-Ressource (XXXIX, 128 Seiten)
    ISBN: 9780821386545
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 19
    Keywords: Ubuntu
    Description / Table of Contents: Umfassender geht es nicht! Hier erfahren Sie alles, was man mit Ubuntu anstellen kann, aktuell zur Version 10.04 LTS 'Lucid Lynx'. Von der Installation, der Paketverwaltung über Optimierung, Programmierung, Migration und Kernelkompilierung bis hin zur Virtualisierung und Netzwerktechnik finden Sie alle wichtigen Fragen zu Ubuntu Linux in diesem Buch beantwortet. Darüber hinaus profitieren Sie von mehr als 250 eigens gekennzeichneten Tipps und Tricks sowie von zahlreichen Praxisworkshops. Dieses Buch macht Sie zum Ubuntu-Profi!
    Pages: Online-Ressource (1104 Seiten)
    Edition: 5., akt. und erw. Aufl.
    ISBN: 9783836216548
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 20
    Keywords: climate change ; adaptation technologies
    Description / Table of Contents: Sea level rise, more intense storm surges, and other climate change impacts will pose serious threats to large number of people living along the worlds coasts. This guidebook covers thirteen main adaptation technologies for coastal erosion and flooding due to climate change. For each technology, the authors present a technology description, its advantages and disadvantages, costs and benefits, institutional organisation requirements and detailed examples about its application. This guidebook is co-authored by Matthew M. Linham and Robert J. Nicholls from the University of Southampton. Professor Nicholls is one of the top international experts on coastal impacts and adaptation to climate change, with an emphasis on seal level rise. This guidebook will be a useful handbook for policy makers and coastal zone project planners. This publication is one of the adaptation and mitigation technology guidebooks produced as part of the GEF-funded Technology Needs Assessment (TNA) project. This project is undertaken by UNEP and URC in 36 developing countries.
    Pages: Online-Ressource (XII, 150 Seiten)
    ISBN: 9788755038554
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 21
    Unknown
    Washington, D. C. : The World Bank
    Description / Table of Contents: The Berlin Workshop Series 2010 presents selected papers from meetings held September 28-30, 2008, at the eleventh annual forum co-hosted by InWEnt and the World Bank in preparation for the Bank's annual World Development Report. At the 2008 meetings, key researchers and policy makers from Europe, the United States, and developing countries met to explore the problems that climate governance poses for development, which are later examined in depth in the World Development Report 2010. This volume presents papers from the Berlin workshop sessions on climate governance and development, covering climate change as a development priority; policies and technologies for energy and development; natural resource governance for adaptation, mitigation, and development; non-state actors and climate governance; financing adaptation and mitigation in an unequal world; and changing institutions of governance for climate change.
    Pages: Online-Ressource (VII, 157 Seiten)
    ISBN: 9780821383070
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    Description / Table of Contents: This special issue of Pure and Applied Geophysics is the second of two volumes containing an augmented collection of papers originating from the Evison Symposium on Seismogenesis and Earthquake Forecasting held in Wellington, New Zealand, in February 2008. The volumes honor Frank Evison's interest in earthquake generation and forecasting. This volume includes descriptions of earthquake forecasting test centers through the Collaboratory for the Study of Earthquake Predictability (CSEP) program and the first results from the Regional Earthquake Likelihood Model (RELM) experiment in California. Other papers discuss methods of testing predictions, in particular by the use of error diagrams. There is discussion of prediction methodologies using seismicity, including an application of the statistical technique of Hidden Markov Models to identify changes in seismicity and a new technique for identifying precursory quiescence. Several papers employ other data besides seismicity, such as geologically determined faults, calculations of stress changes via Coulomb stress modeling, tomographically determined velocity structure, groundwater, crustal deformation, and comparisons of real earthquakes to synthetic seismicity determined from hypothesized earthquake physics. One paper focuses on the prediction of human casualties in the event that a large earthquake occurs anywhere on the globe. The volume will be useful to students and professional researchers who are interested in the earthquake preparation process and in converting that understanding into forecasts of earthquake occurrence.
    Pages: Online-Ressource (274 Seiten)
    ISBN: 9783034604994
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
    Unknown
    Berlin : Edition Open Access
    Pages: Online-Ressource (V, 320 Seiten)
    ISBN: 9783869319629
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 24
    Description / Table of Contents: Climate change has been the source of immense challenges for ethical, economic or political analysts. We are aware of the scale of the action required to be taken and the areas in which that action is needed namely efficient energy use, low carbon technologies or deforestation. We have an idea of which technologies need to be developed. We understand the basic economic policy incentives in favour of reducing emissions, stopping deforestation and promoting more sensible use of our natural environment and its resources. The main challenge today is to obtain political adherence to actually accomplishing these changes.
    ISBN: 9782722602670
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Unknown
    Rijeka : InTech
    Keywords: MATLAB ; communications
    Description / Table of Contents: This book is a collection of 19 excellent works presenting different applications of several MATLAB tools that can be used for educational, scientific and engineering purposes. Chapters include tips and tricks for programming and developing Graphical User Interfaces (GUIs), power system analysis, control systems design, system modelling and simulations, parallel processing, optimization, signal and image processing, finite different solutions, geosciences and portfolio insurance. Thus, readers from a range of professional fields will benefit from its content.
    Pages: Online-Ressource (426 Seiten)
    ISBN: 9789533071251
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    Unknown
    Rijeka : InTech
    Keywords: computer science ; web engineering ; semantics ; semantic web
    Description / Table of Contents: Chapter 1: UnBBayes: Modeling Uncertainty for Plausible Reasoning in the Semantic Web by Rommel Carvalho, Kathryn Laskey, Paulo Costa, Marcelo Ladeira, Laecio Santos and Shou Matsumoto --- Chapter 2: Alternative Bootstrapping Design for the PORTAL-DOORS Cyberinfrastructure with Self-Referencing and Self-Describing Features by Carl Taswell --- Chapter 3: Providing Semantic Content for the Next Generation Web by Irina Efimenko, Serge Minor, Anatoli Starostin, Grigory Drobyazko and Vladimir Khoroshevsky --- Chapter 4: Sustainable Advantage for the Investor Relations Team through Semantic Content by Daniel Hladky --- Chapter 5: Semantic Infrastructures by Jiri Dokulil, Jakub Yaghob and Filip Zavoral --- Chapter 6: Prime Number Labeling Scheme for Transitive Closure Computation by Gang Wu and Juanzi Li --- Chapter 7: Towards an Automatic Semantic Data Integration: Multi-agent Framework Approach by Miklos Nagy and Maria Vargas-Vera --- Chapter 8: Using Semantic Technology to Enable Behavioural Coordination of Heterogeneous Systems by Artem Katasonov and Vagan Terziyan --- Chapter 9: Leveraging Semantic Web Computing for Context-Aware Software Engineering Environments by Roy Oberhauser --- Chapter 10: Reasoning and Representing Viewpoints on the Semantic Web by Christiana Panayiotou --- Chapter 11: Semantic Web Technologies for Managing EHR-related Clinical Knowledge by Catalina Martinez-Costa, Marcos Menarguez-Tortosa, Jose Alberto Maldonado and Jesualdo Tomas Fernandez-Breis --- Chapter 12: Use Case Semantics for Business Process Validation by Michael Wolters and German Nemirovskij --- Chapter 13: Semantic-based eService Delivery for eGovernment Domain by Luis Alvarez Sabucedo, Luis Anido Rifon, Flavio Corradini, Alberto Polzonetti and Barbara Re --- Chapter 14: Context-aware Service Composition and Change-over Using BPEL Engine and Semantic Web by Yoji Yamato, Yuusuke Nakano and Hiroshi Sunaga --- Chapter 15: Metaphor and the Semantic Web by Jonathan Biguenet, Bogdan D. Czejdo and John Biguenet --- Chapter 16: Code Clone Detection Using String Based Tree Matching Technique by Ali Selamat and Norfaradilla Wahid
    Pages: Online-Ressource (310 Seiten)
    ISBN: 9789537619541
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Keywords: energy ; energy economics
    Description / Table of Contents: This joint report by the International Energy Agency (IEA) and the OECD Nuclear Energy Agency (NEA) is the seventh in a series of studies on electricity generating costs. It presents the latest data available for a wide variety of fuels and technologies, including coal and gas (with and without carbon capture), nuclear, hydro, onshore and offshore wind, biomass, solar, wave and tidal as well as combined heat and power (CHP). It provides levelised costs of electricity (LCOE) per MWh for almost 200 plants, based on data covering 21 countries (including four major non-OECD countries), and several industrial companies and organisations. For the first time, the report contains an extensive sensitivity analysis of the impact of variations in key parameters such as discount rates, fuel prices and carbon costs on LCOE. Additional issues affecting power generation choices are also examined. The study shows that the cost competitiveness of electricity generating technologies depends on a number of factors which may vary nationally and regionally. Readers will find full details and analyses, supported by over 130 figures and tables, in this report which is expected to constitute a valuable tool for decision makers and researchers concerned with energy policies and climate change.
    Pages: Online-Ressource (218 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    Keywords: energy ; energy economics
    Description / Table of Contents: Energy-related carbon dioxide (CO2) emissions are set to double by 2050 unless decisive action is taken. International Energy Agency (IEA) analysis demonstrates, however, that it is possible – in the same timeframe to 2050 – to reduce projected greenhouse-gas emissions to half 2005 levels, but this will require an energy technology revolution, involving the aggressive deployment of a portfolio of low-carbon energy technologies.
    Pages: Online-Ressource (130 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
    Unknown
    Paris : IEA Publications
    Description / Table of Contents: This report seeks to inform decision makers seeking to prioritise RD&D investments in a time of financial uncertainty. It is an update of the December 2009 IEA report Global Gaps in Clean Energy Research, Development and Demonstration, which examined whether rates of LCET investment were sufficient to achieve shared global energy and environmental goals (IEA,2009a). This report seeks to inform decision makers seeking to prioritise RD&D investments in a time of financial uncertainty. It is an update of the December 2009 IEA report Global Gaps in Clean Energy Research, Development and Demonstration, which examined whether rates of LCET investment were sufficient to achieve shared global energy and environmental goals (IEA,2009a). It discusses the impact of the green stimulus spending announcements, and provides private sector perspectives on priorities for government RD&D spending. Finally, it includes a revised assessment of the gaps in public RD&D, together with suggestions for possible areas for expanded international collaboration on specific LCETs. The conclusion re-affirms the first Global Gaps study finding that governments and industry need to dramatically increase their spending on RD&D for LCETs.
    Pages: Online-Ressource (40 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 30
    Keywords: climate change ; gravity change ; isostasy ; tectonics ; volcanism ; deformation ; geodynamic process
    Description / Table of Contents: During the last decades, the monitoring and modelling of various geodynamic processes have gained ever increasing importance. In particular, temporal variations of the deformation and gravity fields recorded by new types of geodetic measuring techniques and reflecting isostatic, tectonic or volcanic processes in the earth's interior as well as climatologically induced changes on its surface have opened new avenues. The present volume succeeds a similar topical volume published in 2007 and reflects the most recent developments in these fields of research. Part of the papers in this book were presented at the second workshop on 'Deformation and Gravity Change: Indicators of Isostasy, Tectonics, Volcanism and Climate Change' that took place at the Casa de los Volcanes on Lanzarote, Spain, during March 27-30, 2007. It was jointly organized and supported by the International Association of Geodesy (IAG), the Spanish Ministry of Education and Science, the Spanish Council for Scientific Research and the Cabildo Insular de Lanzarote. The workshop also served as the second meeting of the members of the IAG Working Group ICCT2 on 'Dynamic Theories of Deformation and Gravity Fields'.
    Pages: Online-Ressource (373 Seiten)
    ISBN: 9783034601474
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 31
    Unknown
    Bonn : Galileo Press
    Keywords: Windows Server 2008 R2 ; Hyper-V ; Active Directory ; Remotedesktopdienste ; Webserver IIS ; Netzwerkprotokolle ; Kerberos-Authentifizierung
    Description / Table of Contents: Das lösungsorientierte und praktische Handbuch zum Windows Server 2008 R2 mit zahlreichen fundierten Hintergrundinformationen! Der Autor Ulrich B. Boddenberg greift bei der Beschreibung des Servers auf seine praktischen Erfahrungen in zahlreichen Projekten bei mittleren und großen Kunden zurück. Denn ein modernes Betriebssystem wie Windows Server 2008 R2 bietet weit mehr als nur die Möglichkeit, Programme auszuführen. Er beschreibt alle zentralen Technologien, wie die Virtualisierung mit Hyper-V, Active Directory, Terminaldienste und den Webserver IIS. Neben diesen konkreten Technologien geht es auch um Grundlagen wie Netzwerkprotokolle, Kerberos-Authentifizierung oder die eingesetzte Hardware. Zentrale Aspekte wie Performance, Verfügbarkeit und Sicherheit ziehen sich durch das gesamte Buch.
    Pages: Online-Ressource (1410 Seiten)
    Edition: 3., akt. und erw. Aufl.
    ISBN: 9783836215282
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Unknown
    Basel, Boston, Berlin : Birkhäuser
    Keywords: fault surfaces ; fault zones
    Description / Table of Contents: Considerable progress has been made recently in quantifying geometrical and physical properties of fault surfaces and adjacent fractured and granulated damage zones in active faulting environments. There has also been significant progress in developing rheologies and computational frameworks that can model the dynamics of fault zone processes. This volume provides state-of-the-art theoretical and observational results on the mechanics, structure and evolution of fault zones. Subjects discussed include damage rheologies, development of instabilities, fracture and friction, dynamic rupture experiments, and analyses of earthquake and fault zone data.
    Pages: Online-Ressource (381 Seiten)
    ISBN: 9783034601375
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Keywords: greenhouse gas emission reduction ; energy consumption ; bus ; greenhouse gas emission ; rapid transit ; pedestrian ; pedestrian pathway ; climate change ; transportation network ; road pricing ; emission ; urban transportation ; travel demand ; rebates ; greenhouse gas ; road ; transport ; transport sector ; transit ; travel demand management
    Description / Table of Contents: The Eco2 Cities approach is a point of departure for cities that would like to reap the many benefits of ecological and economic sustainability. It provides an analytical and operational framework that offers strategic guidance to cities on sustainable and integrated urban development. At the same time case studies are used throughout the book to provide a matter-of-fact and ground-level perspective. The Eco2 framework is flexible and easily customized to the context of each country or city. Based on the particular circumstances and the development priorities of a city - the application of the framework can contribute to the development of a unique action plan or roadmap in each case. This action plan can be triggered through catalyst projects.To support this framework, the book also begins to introduce some powerful and practical methods and tools that can further enable sustainable and integrated city planning and decision making. These include 1) operational and process methods that can strengthen collaborative decision making and cross-sector synergies in a city; 2) analytical methods ranging from diagnostics, simulation, design and scenario-generation; and 3) accounting and benchmarking methods which can help clarify, define and measure what it means to truly invest in sustainability and resilience.As additional reference reading, the book also features a series of case studies from best practice cities around the world, each demonstrating a very different dimension of the Eco2 approach. It also features a series of infrastructure sector notes (on spatial development, transport, energy, water and waste management), each of which explore sector specific issues as they pertain to urban development, and the many opportunities for coordination and integration across sectors.
    Pages: Online-Ressource (XXVIII, 358 Seiten)
    ISBN: 9780821381441
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Keywords: markets ; growth ; development strategy ; public expenditures ; inequality ; government ; developing countries ; poverty ; economic policy ; competitiveness
    Description / Table of Contents: The global financial crisis of 2008–09 did not just change the global economic order. It also changed the way we think about that order. Principles and practices that were once accepted wisdom are now in doubt or discredited. New, fundamental questions opened. And the search for answers has barely begun. For the developing world, that conceptual uncertainty is particularly uncomfortable—through a mix of good policies and good luck, they had begun to achieve real progress. Will all that now be derailed? What does the new horizon bring to them? Can they find new policy ideas that will turn the shock of the crisis into a final run toward "developed" status? How does the future look when seen from various geographic regions? Those are the kind of questions that we asked, in the summer of 2010, to some 40 development professionals working at the World Bank. This book is an unfiltered collection of their views. As seasoned practitioners in the leading development institution, they have a unique perspective from which to visualize, we would dare say "to sense", what may be coming. Some of them look at the big picture of the role that the developing world is about to play, and how it will play it. Others walk us through the conceptual links around specific issues that will affect that world—say, the likely evolution of macro-financial regulation. And others take us to continents and countries, teach us about their realities, and tell us how things will differ in the coming years. Put together, they paint a picture of reasoned optimism.
    Pages: Online-Ressource (XX, 443 Seiten)
    ISBN: 9780821385463
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Unknown
    Washington, D. C. : The World Bank
    Keywords: alternative energy ; sustainable forest management ; carbon finance ; carbon ; forests ; climate change ; biodiversity conservation ; emissions ; oceans ; silver ; colors ; carbon sinks ; carbon offsets ; climate ; ecosystem ; emissions from deforestation ; coral reefs ; carbon stores ; forest ; sustainable forest
    Description / Table of Contents: Global warming and changes in climate will have severe and lasting impacts on national efforts to alleviate poverty and promote sustainable development. Some of the world s poorest countries and communities are the most vulnerable and are already suffering the consequences. Yet often these countries are rich in natural capital, ecosystems, and biodiversity that can contribute to solutions as they can to climate change. Biodiversity is the foundation and mainstay of agriculture, forests, and fisheries. Biological resources provide the raw materials for livelihoods, agriculture, medicines, trade, tourism, and industry. Forests, grasslands, freshwater, and marine and other natural ecosystems provide a range of services, often not recognized in national economic accounts but vital to human welfare: regulating water flows and water quality, flood control, pollination, decontamination, carbon sequestration, soil conservation, and nutrient and hydrological cycling. Current efforts to address climate change focus mainly on reducing emissions of greenhouse gases, mainly through cleaner energy strategies, and on attempting to reduce vulnerability of the communities at risk by improving infrastructure to meet new energy and water needs. This book book sets out a compelling argument for including ecosystem-based approaches to mitigation and adaptation as a third essential pillar in national strategies to address climate change. Such ecosystem-based strategies can offer cost-effective, proven and sustainable solutions contributing to, and complementing, other national and regional adaptation strategies.
    Pages: Online-Ressource (XII, 114 Seiten)
    ISBN: 9780821381274
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Description / Table of Contents: Climate change is likely to have significant impacts on the agricultural sector to which farmers will have to adapt. While agriculture is a significant contributor to greenhouse gas emissions, it is also a source of carbon storage in soils. This report examines the economic and policy issues related to the impacts of climate change on agriculture and adaptation responses and to the mitigation of greenhouse gases from agriculture. It outlines research undertaken and underway in other national and international research agencies. It also highlights some of the knowledge gaps on the impacts of climate change on food production and the uncertainties of those impacts in a global context that warrant further research efforts. In particular, the report analyzes marginal abatement cost curves, which show the relative costs of achieving reductions in greenhouse gas emission through the implementation of different actions in the agricultural sector. The aim of the report is to help guide policy makers in the design of policies to address climate change issues in agriculture.
    Pages: Online-Ressource (135 Seiten)
    ISBN: 9789264086876
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    Description / Table of Contents: The world's mountain ranges are the clearest manifestations of long-term deformation of the continental crust. As such they have attracted geological investigations for centuries. Throughout this long history of research a few keynote publications stand out. One of the most important is the Geological Survey's 1907 Memoir on The Geological Structure of the North-West Highlands of Scotland. The Memoir summarized some of the Geological Survey's finest work, and outlined many of the principles of field-based structural and tectonic analysis that have subsequently guided generations of geologists working in other mountain belts, both ancient and modern. The thematic set of 32 papers in this Special Publication celebrate the 100th anniversary of the 1907 Memoir by placing the original findings in both historical and modern contexts, and juxtaposing them against present-day studies of deformation processes operating not only in the NW Highlands, but also in other mountain belts.
    Pages: Online-Ressource (VII, 872 Seiten)
    ISBN: 9781862393004
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
    Unknown
    Washington, D. C. : The World Bank
    Keywords: land use ; congestion ; climate change ; travel costs ; energy consumption ; fossil fuel ; population density ; trip ; congestion charging ; bus ; rapid transit ; infrastructure projects ; transport ; greenhouse gas ; car ; air ; emissions ; carbon neutral ; toll ; greenhouse gas emissions
    Description / Table of Contents: Energy is intrinsic to urban settlements, embedded in the built environment, and directly used to power socio-economic activity, transport and communications, and enable the provision of municipal services. In response to the crucial role of urban energy efficiency for environmentally sustainable and inclusive development processes, ESMAP’s Energy Efficient Cities Initiative (EECI) was launched in October 2008 to facilitate the implementation of practical energy solutions that meet the development priorities of cities, and simultaneously build their climate resilience. Chapter 1 begins with a contextual background on the inter-related associations between energy, socio-economic progress and urbanization. This edited volume compiles seven topical papers presented at the two EECI sponsored sessions during the World Bank’s fifth Urban Research Symposium, held at Marseille, France, June 28-30, 2009. Chapters 2–8 comprise the papers presented at these sessions: i) tools and assessment approaches on energy efficient urban development, and ii) good practices that promote low carbon sectoral interventions. The analytical tools and policy insights offered in this volume extend from integrated assessments of new cities to the impacts of socio-economic, climate and demographic changes on existing cities. Sector-specific interventions are discussed in the context of tools to ‘green’ buildings in Australia, the transformation to efficient lighting systems in the Philippines, and Demand Responsive Transport Systems in France. In addition, the documentation and benchmarking of a variety of low-carbon and carbon neutral good practices provides a range of practical insights on plausible energy efficient interventions in urban sectors. Thus the chapters in this publication comprise significant contributions to the ESMAP objective of mainstreaming and leveraging knowledge and initiatives on urban energy efficiency. Following from them, the last chapter 9 provides a contextual overview of ESMAP’s programmatic priorities to support energy efficient urban growth, to be effected through EECI.
    Pages: Online-Ressource (XVIII, 227 Seiten)
    ISBN: 9780821383094
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 39
    Description / Table of Contents: Limestone is a highly successful and widely used building material, found in many important historic buildings and new monuments around the world. Whilst its success reflects its durability under a wide range of environmental conditions, there are still important questions surrounding the selection, use and conservation of building limestones. In order to make best use of new limestone today, and to conserve old limestone most effectively, we need to bring modern research methods to bear on understanding the characteristics of different limestones, what mortars to use, and how key limestones have responded to polluted atmospheres. This volume brings together recent inter-disciplinary research on these issues, illustrating the diversity of innovative techniques that are now being applied to furthering our understanding of building limestones.
    Pages: Online-Ressource (VII, 257 Seiten)
    ISBN: 9781862392946
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
    Description / Table of Contents: The Zagros fold-thrust belt (ZFTB) extends from Turkey to the Hormuz Strait, resulting from the collision of the Arabian and Eurasian plates during Cenozoic times, and separates the Arabian platform from the large plateaux of central Iran. To the east a pronounced syntaxis marks the transition between the Zagros collision belt and the Makran accretionary wedge. In the ZFTB, the Proterozoic to Recent stratigraphic succession pile is involved in huge folds, and offers the opportunity to study the stratigraphic and tectonic evolution of the Palaeo-Tethyan margin. Few recent data were widely available on the southern Tethys margin preserved in the Zagros Mountains. The Middle East Basins Evolution (MEBE) program was an excellent opportunity to go back to the field and to collect new data to better constrain the evolution of this margin. In this volume the structure of the Zagros Mountains is explored through different scales and using different methodologies.
    Pages: Online-Ressource (VII, 360 Seiten)
    ISBN: 9781862392939
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 41
    Description / Table of Contents: This volume contains a collection of stratigraphic and diagenetic case studies of Mesozoic and Cenozoic carbonate sequences from the Tethyan realm. High levels of industry and academic interest in the region have generated numerous multi-disciplinary studies of these sequences, a selection of which are presented in this volume. The studies presented are based on both comprehensive subsurface datasets from important hydrocarbon-bearing strata of the Middle East and the excellent surface exposures in the region of interest. The studies presented in this volume may serve as suitable starting points in the development of age and architecture specific carbonate reference models. Such models can form the basis of internally consistent models for carbonate deposition, sequence development and reservoir performance. Ideally such models, suitably scaled, will be equally applicable to academic studies, the exploration and development phases of the field life cycle and in the prediction of future reservoir performance.
    Pages: Online-Ressource (422 Seiten)
    ISBN: 9781862392922
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    Unknown
    Hamburg : Maribus
    Description / Table of Contents: Der „World Ocean Review“ erscheint 2010 das erste Mal und soll in Zukunft in regelmäßigen Abständen herausgegeben werden. Entstanden ist ein umfassender und profunder Bericht, der den Zustand der Weltmeere und die Wirkungszusammenhänge zwischen dem Ozean und ökologischen, ökonomischen und gesellschaftspolitischen Bedingungen aufzeigt. Die wissenschaftlich gesicherten Erkenntnisse sollen all denen dienen, die sich aktiv und fundiert an den aktuellen Diskussionen im Umfeld der Meeresforschung beteiligen möchten.
    Pages: Online-Ressource (240 Seiten)
    ISBN: 9783866480001
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
    Unknown
    Berlin [u.a.] : Springer
    Keywords: constructive approximation ; differential equations ; geomathematics ; inverse problems ; mathematical modelling ; number theory ; numerical methods ; potential theory
    Description / Table of Contents: During the last three decades geosciences and geo-engineering were influenced by two essential scenarios: First, the technological progress has changed completely the observational and measurement techniques. Modern high speed computers and satellite based techniques are entering more and more all geodisciplines. Second, there is a growing public concern about the future of our planet, its climate, its environment, and about an expected shortage of natural resources. Mathematics concerned with geoscientific problems, i.e., Geomathematics, is becoming increasingly important. The "Handbook of Geomathematics" as a central reference work in this area comprises the following scientific fields: (I) observational and measurement key technologies; (II) modelling of the system Earth (geosphere, cryosphere, hydrosphere, atmosphere, biosphere); (III) analytic, algebraic, and operator-theoretic methods; (IV) statistical and stochastic methods; (V) computational and numerical analysis methods; (VI) historical background and future perspectives.
    Pages: Online-Ressource (XIX, 1350 Seiten)
    ISBN: 9783642015465
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 44
    Keywords: natural hazards ; disasters ; economics ; emergency management
    Description / Table of Contents: This report synthesizes knowledge about the effects of natural hazards on human welfare, particularly in its economic aspects. It is a remarkable combination of case studies, data on many scales, and the application of economic principles to the problems posed by earthquakes, abnormal weather, and the like. It provides a deep understanding of the relative roles of the market, government intervention, and social institutions in determining and improving both the prevention and the response to hazardous occurrences. The report looks at disasters primarily through an economic lens. Economists emphasize self-interest to explain how people choose the amount of prevention, insurance, and coping. But lenses can distort as well as sharpen images, so the report also draws from other disciplines: psychology to examine how people may misperceive risks, political science to understand voting patterns, and nutrition science to see how stunting in children after a disaster impairs cognitive abilities and productivity as adults much later. Peering into the future, the report shows that growing cities will increase exposure to hazards, but that vulnerability will not rise if cities are better managed. The intensities and frequencies of hazards in the coming decades will change with the climate, and the report examines this complicated and contentious subject, acknowledging all the limitations of data and science.
    Pages: Online-Ressource (XX, 254 Seiten) , Illustrationen, Diagramme, Karten
    ISBN: 9780821381410
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
    Unknown
    Washington, D.C. : The World Bank
    Keywords: adaptation ; caribbean ; climate change ; community ; indigenous peoples ; latin america ; livelihoods ; poverty ; rural development ; vulnerability
    Description / Table of Contents: This book addresses the implications of climate change on indigenous peoples and communities living in the highlands, lowlands, and coastal areas of Latin America and the Caribbean. Across the region, indigenous people already experience the negative effects of climate change and variability. Their livelihoods are threatened by insecure food supplies and poor health. In addition, their cultural integrity is challenged: Indigenous peoples often blame themselves for the changes they observe in nature, despite their limited emission of greenhouse gasses. This book shows the complexity of how indigenous communities are affected by climate change, explores options for improving resilience, and provides guidance in the design of effective and sustainable adaptations. 'Changing climates of the world create new challenges not only for mainstream societies, but for indigenous and subsistence societies as well. The marginalized populations of Latin America and the Caribbean (LAC) have long paid a price for their isolation from the colonial societies, but now the natural foundations of their marginal, traditional habitats and cultural spaces are being changed in ways that are yet to be fathomed. Kronik and Verner systematically and fairly thoroughly substantiate the effects of changing climate on the flora and fauna and patterns of life among indigenous populations in four regions of LAC: the Amazon, Andean and sub-Andean South America, and the Caribbean. Examinations of the vulnerabilities, adjustments, and potential adaptations of an assortment of peoples in each region illuminate the complexities of understanding what the world is up against with climate change, and can help to inform thinking about how the future will unfold. An extraordinary report of rigorous research that ought to be replicated everywhere.
    Pages: Online-Ressource (XVI, 185 Seiten)
    ISBN: 9780821383810
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 46
    Keywords: bulk water ; climate change ; equitable access ; large dams ; river basins ; water conservation ; water infrastructure ; water legislation ; water management ; water quality ; water resources ; water supply ; water use
    Description / Table of Contents: The past decade has witnessed a major global shift in thinking about water, including the role that water infrastructure plays in sustainable development. This rethinking aims to balance better the social, economic, and environmental performance aspects in the development and management of large dams. Infrastructure strategies must complement strategies for water, environment, and energy security and for emerging concerns to reduce vulnerability in water resource systems to climate change on the horizon. Communication is central to multi-stakeholder dialogue and partnerships at all levels needed to achieve sustainability and governance reform in water resource management and infrastructure provision. At the same time, communication drives the advocacy to mobilize political will and public support for beneficial change and continuous improvement in practices. This case study emphasizes that is not only important to mobilize all opportunities to reconcile water demand and supply in river basins that are coming under increasing levels of water stress, but also to integrate effectively governance and anti-corruption reforms and sustainability improvements into all stages of the planning and project cycle - adding value for stakeholders.
    Pages: Online-Ressource (XIII, 116 Seiten)
    ISBN: 9780821384343
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 47
    Keywords: china ; climate change ; east asia ; energy and environment ; energy efficiency ; energy financing ; energy policy ; renewable energy ; sustainable energy ; world bank
    Description / Table of Contents: East Asia has experienced the fastest economic growth in the world over the last three decades, accompanied by a 10-fold gross domestic product increase and rapid urbanization. Energy consumption has more than tripled during this period and is expected to double over the next 20 years. This remarkable trend has led to twin energy challenges in the region - environmental sustainability and energy security. Written for an audience of energy policy makers and practitioners, Winds of Change explores the region’s energy future over the next two decades through two energy scenarios. It outlines the strategic direction East Asia’s energy sector must take to meet its growing energy demand in an environmentally sustainable manner, and presents a pathway of policy frameworks and financing mechanisms to get there. The six East Asian countries - China, Indonesia, Malaysia, the Philippines, Thailand, and Vietnam - examined in this book could, with the right policies and financing, stabilize CO2 emissions by 2025, improve their local environment, and enhance energy security without compromising economic growth. They must move their energy sectors toward much higher efficiency and more widespread use of low-carbon technologies, while obtaining substantial financing and low-carbon technologies from developed countries. This clean energy revolution requires major policy and institutional reforms, including energy pricing reforms, regulations such as energy efficiency standards, financial incentives such as feed-in tariffs for renewable energy, and accelerated research and development. Finally, building low-carbon cities will be key to containing the rapid urban energy growth through compact urban design, public transport, clean vehicles, and green buildings. The window of opportunity is closing fast - delaying action would lock the region into a longlasting high-carbon infrastructure. The technical and policy means exist for such transformational changes, but only strong political will and unprecedented international cooperation will make them happen.
    Pages: Online-Ressource (XVII, 154 Seiten)
    ISBN: 978082138502
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    Unknown
    Paris : OECD
    Description / Table of Contents: As the hubs of economic activity, cities drive the vast majority of the world’s energy use and are major contributors to global greenhouse gas emissions. Because they are home to major infrastructure and highly concentrated populations, cities are also vulnerable to the impacts of climate change, such as rising sea levels, warmer temperatures and fiercer storms. At the same time, better urban planning and policies can reduce energy use and greenhouse gas emissions and improve the resilience of urban infrastructure to climate change, thus shaping future trends. This book shows how city and metropolitan regional governments working in tandem with national governments can change the way we think about responding to climate change. The chapters analyse: trends in urbanisation, economic growth, energy use and climate change; the economic benefits of climate action; the role of urban policies in reducing energy demand, improving resilience to climate change and complementing global climate policies; frameworks for multilevel governance of climate change including engagement with relevant stakeholders; and the contribution of cities to “green growth”, including the “greening” of fiscal policies, innovation and jobs. The book also explores policy tools and best practices from both OECD and some non-member countries. Cities and Climate Change reveals the importance of addressing climate change across all levels of government. Local involvement through “climate-conscious” urban planning and management can help achieve national climate goals and minimise tradeoffs between environmental and economic priorities at local levels. The book will be relevant to policy makers, researchers, and others with an interest in learning more about urbanisation and climate change policy.
    Pages: Online-Ressource (274 Seiten)
    ISBN: 9789264091375
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    Unknown
    Venezia : Università Iuav di Venezia
    Keywords: climate change ; urbanisme ; Veneto region ; water ; waterscape
    Description / Table of Contents: “Extreme City - Climate change and the transformation of the waterscape” is the book about the results of the Intensive Learning Programme held recently at the Iuav University (Venice, 3rd – 15th April 2010) with the projectual explorations of the EMU students and the teachers contributions. The goals of the intensive programme have been to deal with changes in the water space in climate change conditions. A “research by design” approach was chosen as the starting point of a reflection on techniques and forms of knowledge which use the project to tackle complex issues. A multidisciplinary approach has been proposed to deal with the vulnerability of a dispersedly inhabited region.
    Pages: Online-Ressource (289 Seiten)
    ISBN: 9788887697438
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    Keywords: civil engineering ; geology ; geophysics ; geodesy ; remote sensing
    Description / Table of Contents: Our planet is nowadays continuously monitored by powerful remote sensors operating in wide portions of the electromagnetic spectrum. Our capability of acquiring detailed information on the environment has been revolutionized by revealing its inner structure, morphology and dynamical changes. The way we now observe and study the evolution of the Earth’s status has even radically influenced our perception and conception of the world we live in. The aim of this book is to bring together contributions from experts to present new research results and prospects of the future developments in the area of geosciences and remote sensing; emerging research directions are discussed. The volume consists of twenty-six chapters, encompassing both theoretical aspects and application-oriented studies. An unfolding perspective on various current trends in this extremely rich area is offered. The book chapters can be categorized along different perspectives, among others, use of active or passive sensors, employed technologies and configurations, considered scenario on the Earth, scientific research area involved in the studies.
    Pages: Online-Ressource (508 Seiten)
    ISBN: 9789537619978
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
    Description / Table of Contents: Solar Photovoltaic (PV) Power is a commercially available and reliable technology with a significant potential for long-term growth in nearly all world regions. This technology roadmap estimates that by 2050, PV could provide 11% of global electricity production and avoid 2.3 gigatonnes (Gt) of CO2 emissions per year. Achieving this roadmap’s vision requires an effective, long-term and balanced policy effort in the next decade to allow for optimal technology progress, cost reduction and ramp-up of industrial manufacturing for mass deployment. Further, governments will need to provide long-term targets and supporting policies in order to build confidence for investments in manufacturing capacity and deployment of PV systems. With effective policies in place, PV on residential and commercial buildings could achieve grid parity – i.e. with electricity grid retail prices – by 2020 in many regions. In this scenario, utility-scale PV could become competitive in the sunniest regions by 2030 and provide 5% of global electricity by 2050. As PV matures into a mainstream technology, grid integration and management and energy storage become key issues. The PV industry, grid operators and utilities would need to develop new technologies and strategies to integrate large amounts of PV into flexible, efficient and smart grids.
    Pages: Online-Ressource (48 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 52
    Unknown
    Paris : IEA Publications
    Description / Table of Contents: Scaling-up investment in energy efficiency is essential to achieving a sustainable energy future. Despite energy efficiency’s recognised advantages as a bankable investment with immense climate change mitigation benefits, most of the energy efficiency potential remains untapped and the investment gap to achieve climate goals is tremendous. This report seeks to improve understanding as to why this is so, and what can be done about it.
    Pages: Online-Ressource (74 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 53
    Unknown
    Paris : IEA Publications
    Description / Table of Contents: Ensuring energy security and addressing climate change cost-effectively are key global challenges. Tackling these issues will require efforts from stakeholders worldwide. To find solutions, the public and private sectors must work together, sharing burdens and resources, while at the same time multiplying results and outcomes.
    Pages: Online-Ressource (114 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
    Unknown
    Rijeka : InTech
    Keywords: vibration analysis ; vibration control
    Description / Table of Contents: Vibrations are a part of our environment and daily life. Many of them are useful and are needed for many purposes, one of the best example being the hearing system. Nevertheless, vibrations are often undesirable and have to be suppressed or reduced, as they may be harmful to structures by generating damages or compromise the comfort of users through noise generation of mechanical wave transmission to the body. the purpose of this book is to present basic and advanced methods for efficiently controlling the vibrations and limiting their effects. Open-access publishing is an extraordinary opportunity for a wide dissemination of high quality research. This book is not an exception to this, and I am proud to introduce the works performed by experts from all over the world.
    Pages: Online-Ressource (392 Seiten)
    ISBN: 9789533071176
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 55
    Keywords: energy ; energy economics
    Description / Table of Contents: The power sector carries a considerably great burden of the CO2 emission reductions required to address climate change, a feature common to many scenarios of emissions abatement. These reductions will only be possible if existing plants are replaced with more efficient and less-emitting types of plants over the coming decades. This report identifies the investments needed in the power sector, and their related risk factors.
    Pages: Online-Ressource (34 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 56
    Keywords: energy ; energy economics
    Description / Table of Contents: This paper reviews key design features of mandatory emissions trading systems that had been established or were under consideration in 2010, with a particular focus on implications for the energy sector. Putting a price on greenhouse gas emissions is a cornerstone policy in climate change mitigation. To this end, many countries have implemented or are developing domestic emissions trading systems.
    Pages: Online-Ressource (110 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
    Keywords: Naturkatastrophen
    Description / Table of Contents: Naturkatastrophen bedeuten nicht nur momenthafte Zerstörung, die nach erfolgtem Wiederaufbau wieder vergessen ist. Katastrophen haben häufig nachhaltige Auswirkungen auf Politik und Gesellschaft und damit auf die menschliche Geschichte. Sie führen mitunter zu Verordnungen, Institutionenbildung, Politikwechsel und gesellschaftlichem Umdenken, können aber auch Anlass zu Aufbruchstimmung und Fortschrittsoptimismus geben. Durch die aktuelle Diskussion zum globalen Klimawandel hat sich in der Öffentlichkeit ein stärkeres Bewusstsein für die gesellschaftliche Relevanz von Naturkatastrophen entwickelt. Welche Rolle extreme Ereignisse in der Geschichte gespielt haben und welche Strategien zu ihrer Bewältigung in verschiedenen Zeiten wirksam waren, bilden die zentralen Fragen des Sammelbandes. Die Autoren untersuchen neben klassischen Naturkatastrophen auch Seuchen und Schädlingskalamitäten in historischer Perspektive und widmen sich theoretischen Fragen zu deren Genese und Auswirkungen. Der vorliegende Band ist das Ergebnis eines Workshops, der von den Herausgebern im Rahmen des DFG-Graduiertenkollegs „Interdisziplinäre Umweltgeschichte“ unter dem Titel „Katastrophen machen Geschichte – Umweltgeschichtliche Prozesse im Spannungsfeld von Ressourcennutzung und Extremereignis“ am 6. und 7. Mai 2009 in Göttingen veranstaltet wurde.
    Pages: Online-Ressource (198 Seiten)
    ISBN: 9783941875210
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 58
    Description / Table of Contents: Electric vehicles (EVs) represent both a new demand for electricity and a possible storage medium that could supply power to utilities. The "load shifting" and “vehicle-to-grid” concepts could help cut electricity demand during peak periods and prove especially helpful in smoothing variations in power generation introduced to the grid by variable renewable resources such as wind and solar power. This paper proposes a method for simulating the potential benefits of using EVs in load shifting and "vehicle-to-grid" applications for four different regions – the United States, Western Europe, China and Japan – that are expected to have large numbers of EVs by 2050.
    Pages: Online-Ressource (67 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 59
    Unknown
    Rijeka : InTech
    Keywords: satellite communication ; wireless communication ; geoinformation technology
    Description / Table of Contents: This study is motivated by the need to give the reader a broad view of the developments, key concepts, and technologies related to information society evolution, with a focus on the wireless communications and geoinformation technologies and their role in the environment. Giving perspective, it aims at assisting people active in the industry, the public sector, and Earth science fields as well, by providing a base for their continued work and thinking.
    Pages: Online-Ressource (540 Seiten)
    ISBN: 9789533071350
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
    Unknown
    Rijeka : InTech
    Keywords: energy ; sustainable energy
    Description / Table of Contents: The world's reliance on existing sources of energy and their associated detrimental impacts on the environment- whether related to poor air or water quality or scarcity, impacts on sensitive ecosystems and forests and land use - have been well documented and articulated over the last three decades. What is needed by the world is a set of credible energy solutions that would lead us to a balance between economic growth and a sustainable environment. This book provides an open platform to establish and share knowledge developed by scholars, scientists and engineers from all over the world about various viable paths to a future of sustainable energy. It has collected a number of intellectually stimulating articles that address issues ranging from public policy formulation to technological innovations for enhancing the development of sustainable energy systems. It will appeal to stakeholders seeking guidance to pursue the paths to sustainable energy.
    Pages: Online-Ressource (676 Seiten)
    ISBN: 9789533074016
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 61
    Unknown
    Hamburg : Maribus
    Description / Table of Contents: This first “World Ocean Review” is published in 2010 and will be followed by periodic updates in the future. The result is a comprehensive, detailed and unique report about the state of the world’s oceans and their interplay with ecological, economic and sociopolitical conditions. Its aim is to increase public awareness of the interconnected nature of the diverse aspects of the marine environment and thus to boost marine conservation.
    Pages: Online-Ressource (240 Seiten)
    ISBN: 9783866480124
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 62
    Unknown
    Paris : IEA Publications
    Description / Table of Contents: This book explores how efficiency is measured and reported at coal-fired power plants. Armed with this information, policy makers would be in a better position to monitor and, if necessary, regulate how coal is used for power generation. The tools and techniques described will be of value to anyone with an interest in the more sustainable use of coal. Coal is the biggest single source of energy for electricity production and its share is growing. The efficiency of converting coal into electricity matters: more efficient power plants use less fuel and emit less climate-damaging carbon dioxide. This book explores how efficiency is measured and reported at coal-fired power plants. With many different methods used to express efficiency performance, it is often difficult to compare plants, even before accounting for any fixed constraints such as coal quality and cooling-water temperature. Practical guidelines are presented that allow the efficiency and emissions of any plant to be reported on a common basis and compared against best practice. A global database of plant performance is proposed that would allow under-performing plants to be identified for improvement. Armed with this information, policy makers would be in a better position to monitor and, if necessary, regulate how coal is used for power generation. The tools and techniques described will be of value to anyone with an interest in the more sustainable use of coal.
    Pages: Online-Ressource (114 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Description / Table of Contents: In the April 2010 Oil Market Report (OMR), the IEA included a supplementary report on the prospects to 2015 for the supply of natural gas liquids (NGLs), especially in light of new developments in natural gas production. At a time when economic, regulatory and geopolitical uncertainties are stretching lead times for expanding global crude oil supply, rising NGL and condensate availability can act as a pressure valve for the global oil market. Frequently overlooked as a component of production growth, nonetheless IEA estimates see up to 60% of expected oil supply increases through mid-decade deriving from NGLs. This timely report tries to present a clear view of the component parts of the NGL value chain, highlights optimal gas and NGL development strategies and presents detailed country and region specific forecasts for NGL supply through 2015.
    Pages: Online-Ressource (97 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
    Keywords: nuclear explosion monitoring ; nuclear test ban ; seismology ; acoustics
    Description / Table of Contents: This topical volume focuses on the most recent advances that have been achieved in relevant fields of research of nuclear test ban monitoring, including seismology, infrasound- and hydro-acoustics, as well as nuclear physics and atmospheric backtracking. This research has been presented during the special sessions on "Research and Development in Nuclear Explosion Monitoring" convened during the 2007 and 2008 General Assemblies of the European Geosciences Union (EGU). The special sessions were introduced after the Preparatory Commission for the Comprehensive Nuclear Test-Ban Treaty Organization (CTBTO Prepcom) had convened a scientific symposium in 2006 on "CTBT: Synergies with Science 1996-2006 and beyond" marking the tenth anniversary of the United Nations General Assembly’s adoption of the CTBT Treaty. With regard to the seismo-acoustic fields several papers provide important updates on advances made in these fields since publication of ‘Monitoring the Comprehensive Nuclear-Test-Ban Treaty’ (see PAGEOPH topical volumes 158-159, 2001-2002). Moreover, this topical volume expands on these publications by including radionuclide and noble gas monitoring, as well as atmospheric transport modeling. In these two areas, significant progress has been made in recent years. Two papers studying the 2006 North Korean nuclear test elucidate how progress made in the relevant fields has allowed for a good understanding on the characteristics of this underground nuclear test.
    Pages: Online-Ressource (246 Seiten)
    ISBN: 9783034603706
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 65
    Description / Table of Contents: How much CO2 are countries emitting? Where is it coming from? In the lead-up to the UN climate negotiations in Cancún, the latest information on the level and growth of CO2 emissions, their source and geographic distribution will be essential to lay the foundation for a global agreement. To provide input to and support for the UN process the IEA is making available for free download the Highlights version of CO2 Emissions from Fuel Combustion. This annual publication contains: - estimates of CO2 emissions by country from 1971 to 2008 - selected indicators such as CO2/GDP, CO2/capita, CO2/TPES and CO2/kWh - CO2 emissions from international marine and aviation bunkers, and other relevant information These estimates have been calculated using the IEA energy databases and the default methods and emission factors from the Revised 1996 IPCC Guidelines for National Greenhouse Gas Inventories.
    Pages: Online-Ressource (121 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Keywords: carbon emission ; low-carbon economy ; greenhouse gas ; CO2
    Description / Table of Contents: Companies are increasingly aware of the need to address climate change. However, while many companies are taking action to address climate change, many others are still lagging behind. This report surveys responsible business practices addressing climate change and driving the shift to a low-carbon economy. It summarises policies, regulations and other instruments in support of a low-carbon economy in OECD countries and emerging economies, and analyses corporate responses to these drivers. Using the principles of responsible business conduct identified in the OECD Guidelines for Multinational Enterprises, this report reviews three key areas of corporate action: accounting for greenhouse gas emissions; achieving emissions reductions; and engaging suppliers, consumers and other stakeholders.
    Pages: Online-Ressource (113 Seiten)
    ISBN: 9789264090231
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    Keywords: oil spill ; valuation ; environmental degradation ; deforestation ; demolition and military waste ; air pollution ; middle east and north africa ; water degradation ; forest degradation ; land degradation
    Description / Table of Contents: How much is a cleaner environment worth? For policy makers, that question goes largely unanswered. It's not that the environment is seen as unimportant. It's simply much easier to compare the costs and benefits of tangible projects such as airports and electrical grids, than it is to weigh the merits of a landfill cleanup. Over the past decades, the World Bank has undertaken a systematic effort to put a monetary value on environmental degradation, which results sparked policy changes. This book brings together the best case studies of the Cost of Environmental Degradation undertaken in the Middle East and North Africa region and summarizes the major policy impacts at the national and regional levels. The case studies evaluate in monetary terms the annual damages caused by economic activities to natural resources and environment – water, forests, agricultural land, air quality, waste and coastal zone – and reflects the estimates as percentages of the countries’ gross domestic product. It then captures the estimated values in a holistic picture and illuminates their concrete implications on policy, investments, and institutions for the selected countries and for the region as a whole. In addition to being a multi-nation effort, the book stands out by applying updated methods and techniques to estimate natural resource damages both in times of peace and of conflict. This is particularly relevant for the Middle East and North Africa, a region located at the crossroads of different cultures, continents, and religions. This book is primarily targeted at policy makers at the regional, national and local levels and to decision makers in government agencies, NGOs, and natural resource development institutions. It is suitable for use in training courses of decision makers working in environment, forests and water related fields. The book should also be of interest to advanced undergraduates, master’s level students and undergraduates.
    Pages: Online-Ressource (XVIII, 168 Seiten)
    ISBN: 9780821383964
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Keywords: licensing of petroleum exploration, development and production rights ; petroleum licensing rounds ; petroleum exploration ; allocation of petroleum exploration, development and production rights ; maximization of petroleum rent ; fiscal systems for hydrocarbons ; design of petroleum allocation systems ; petroleum policy ; petroleum depletion policy ; auctions of petroleum rights
    Description / Table of Contents: Governments often pursue a variety of economic, social and political objectives through their allocation policies that go beyond the maximization of the net present value of the economic rent. The optimal allocation policy depends on a range of country specific and exogenous factors. Despite the variety of factors influencing optimal design, most countries use similar solutions. In particular, when auctions or administrative procedures are used, most governments opt for simple simultaneous multi-object sealed-bid rounds. While this may appear to be paradoxical, there is a practical explanation. It is true that more complex bidding forms might increase rent capture at bidding. However, the potential marginal gain is often limited, owing to most E&P projects’ high level of uncertainty and risk. In addition market mechanisms, such as joint bidding and secondary markets, and the fiscal regime are widely used in the petroleum sector to correct inefficiency at the time of allocation.
    Pages: Online-Ressource (XIV, 106 Seiten)
    ISBN: 9780821381687
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    Description / Table of Contents: Natural stone is considered to be a versatile, durable and aesthetically pleasing building material. From the beginning of civilization, important structures and monuments have been built from, or based on, natural stone. Until the end of the nineteenth century, the use of local stone resources was mostly in balance with the local environment. Strict environmental legislation has resulted in the closing of many long-standing quarries in industrialized countries, which has led to a shortage of traditional stone varieties. This has caused problems for restoration practice. Cheap, imported stone from less industrialized countries has become more widely available in recent years. Some of the issues related to built stone conservation and restoration covered by this volume are: the establishment of inventories of possible replacement stones; understanding the decay mechanism and use of preventive conservation methods for slowing down decay processes; evaluation of the properties of natural stone; and assessing the risks of using replacement stones of different qualities.
    Pages: Online-Ressource (VII, 237 Seiten)
    ISBN: 9781862392915
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Unknown
    London : The Geological Society
    Keywords: Australia; Australian continent; landscape; geomorphology
    Description / Table of Contents: Introduction: Australian geomorphology into the 21st century / Paul Bishop and Brad Pillans / Geological Society, London, Special Publications, 346, 1-6, 1 January 2010, https://doi.org/10.1144/SP346.1 --- A theory (involving tropical cyclones) on the formation of coarse-grained sand beach ridges in NE Australia / Jonathan Nott / Geological Society, London, Special Publications, 346, 7-22, 1 January 2010, https://doi.org/10.1144/SP346.2 --- Sheltered sandy beaches of southwestern Australia / A. Travers, M. J. Eliot, I. G. Eliot and M. Jendrzejczak / Geological Society, London, Special Publications, 346, 23-42, 1 January 2010, https://doi.org/10.1144/SP346.3 --- Are the Murray Canyons offshore southern Australia still active for sediment transport? / S. Schmidt, P. De Deckker, H. Etcheber and S. Caradec / Geological Society, London, Special Publications, 346, 43-55, 1 January 2010, https://doi.org/10.1144/SP346.4 --- East Australian marine abrasion surface / Bruce G. Thom, Jock B. Keene, Peter J. Cowell and Marc Daley / Geological Society, London, Special Publications, 346, 57-69, 1 January 2010, https://doi.org/10.1144/SP346.5 --- Geoarchaeology in Australia: understanding human-environment interactions / Simon J. Holdaway and Patricia C. Fanning / Geological Society, London, Special Publications, 346, 71-85, 1 January 2010, https://doi.org/10.1144/SP346.6 --- Ecogeomorphology in the Australian drylands and the role of biota in mediating the effects of climate change on landscape processes and evolution / David Dunkerley / Geological Society, London, Special Publications, 346, 87-120, 1 January 2010, https://doi.org/10.1144/SP346.7 --- History of Australian aridity: chronology in the evolution of arid landscapes / Toshiyuki Fujioka and John Chappell / Geological Society, London, Special Publications, 346, 121-139, 1 January 2010, https://doi.org/10.1144/SP346.8 --- The Australian desert dunefields: formation and evolution in an old, flat, dry continent / Paul P. Hesse / Geological Society, London, Special Publications, 346, 141-164, 1 January 2010, https://doi.org/10.1144/SP346.9 --- Advances in Quaternary studies in Tasmania / Eric A. Colhoun, Kevin Kiernan, Timothy T. Barrows and Albert Goede / Geological Society, London, Special Publications, 346, 165-183, 1 January 2010, https://doi.org/10.1144/SP346.10 --- ‘Of droughts and flooding rains’: an alluvial loess record from central South Australia spanning the last glacial cycle / David Haberlah, Peter Glasby, Martin A. J. Williams, Steven M. Hill, Frances Williams, Edward J. Rhodes, Victor Gostin, Anthony O'Flaherty and Geraldine E. Jacobsen / Geological Society, London, Special Publications, 346, 185-223, 1 January 2010, https://doi.org/10.1144/SP346.11 --- Eroding Australia: rates and processes from Bega Valley to Arnhem Land / Arjun M. Heimsath, John Chappell and Keith Fifield / Geological Society, London, Special Publications, 346, 225-241, 1 January 2010, https://doi.org/10.1144/SP346.12 --- Tectonic geomorphology of Australia / Mark C. Quigley, Dan Clark and Mike Sandiford / Geological Society, London, Special Publications, 346, 243-265, 1 January 2010, https://doi.org/10.1144/SP346.13 --- Lithology and the evolution of bedrock rivers in post-orogenic settings: constraints from the high-elevation passive continental margin of SE Australia / Paul Bishop and Geoff Goldrick / Geological Society, London, Special Publications, 346, 267-287, 1 January 2010, https://doi.org/10.1144/SP346.14 --- Rethinking eastern Australian caves / R. A. L. Osborne / Geological Society, London, Special Publications, 346, 289-308, 1 January 2010, https://doi.org/10.1144/SP346.15 --- Oxygen-isotope dating the Yilgarn regolith / Allan. R. Chivas and Julius. R. Atlhopheng / Geological Society, London, Special Publications, 346, 309-320, 1 January 2010, https://doi.org/10.1144/SP346.16
    Pages: Online-Ressource (VII, 328 Seiten) , Illustrationen, Diagramme, Karten
    ISBN: 9781862395947
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Description / Table of Contents: This special issue of Pure and Applied Geophysics is one of two volumes containing an augmented collection of papers originating from the Evison Symposium on Seismogenesis and Earthquake Forecasting held in Wellington, New Zealand, in February 2008. The volumes honor Frank Evison's interest in earthquake generation and forecasting. A biography of Frank Evison and a list of his publications is included, as well as review papers and new research papers in the field. The volume includes papers related to Frank's most abiding interest of precursory earthquake swarms. The research contributions cover a range of current forecasting methods such as the Epidemic-Type Aftershock model, the Every Earthquake a precursor According to Scale model, Pattern Informatics, Reverse Tracing of Precursors, stochastic models of elastic rebound, and methods for handling multiple precursors. The methods considered employ a variety of statistical approaches to using previous seismicity to forecast future earthquakes, including regional and global earthquake likelihood models and alarm-type forecasts. The forecast time-frames of interest range from the short time-frame associated with clustering of aftershocks to the long time-frame associated with recurrence of major earthquakes. A recurring theme is the assessment of forecasting performance, whether by likelihood scores, skill scores, error diagrams, or relative operating characteristic tests. The volume will be useful to students and professional researchers who are interested in the earthquake preparation process and in converting that understanding into forecasts of earthquake occurrence.
    Pages: Online-Ressource (250 Seiten)
    ISBN: 9783034604970
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    Keywords: stratosphere ; ozone ; chemistry ; climate models
    Description / Table of Contents: Three-dimensional climate models with a fully interactive representation of stratospheric ozone chemistry — otherwise known as stratosphere-resolving chemistry-climate models (CCMs) — are key tools for the attribution and prediction of stratospheric ozone changes arising from the combined effects of changes in the amounts of greenhouse gases (GHG) and ozone-depleting substances (ODS). These models can also be used to infer potential effects of stratospheric changes on the climate of the troposphere. In order to know how much confi dence can be placed in the results from the CCMs, both individually and collectively, it is necessary to assess their performance by comparison with observations and known physical constraints. The Stratospheric Processes And their Role in Climate (SPARC) core project of the World Climate Research Programme (WCRP) initiated the CCM Validation (CCMVal) activity in 2003 to coordinate exactly such an evaluation. The CCMVal concept (see Chapter 1) takes as a starting point the premise that model performance is most accurately assessed by examining the representation of key processes, rather than just the model’s ability to reproduce long-term ozone trends, as the latter can be more easily tuned and can include compensating errors. Thus a premium is placed on high-quality observations that can be used to assess the representation of key processes in the models. This Report does not provide a detailed assessment of the quality of the observational databases; the compilation and assessment of data sets suitable for model evaluation is the focus of a future SPARC activity, which has been motivated by this Report. The fi rst round of CCMVal (CCMVal-1) evaluated only a limited set of key processes in the CCMs, focusing mainly on dynamics and transport. This Report, which describes the second round of CCMVal (CCMVal-2), represents a more complete effort by CCMVal to assess CCM performance. As with CCMVal-1, it also includes an assessment of the extent to which CCMs are able to reproduce past observations in the stratosphere, and the future evolution of stratospheric ozone and climate under one particular scenario. A key aspect of the model evaluation within this Report is the application of observationally-based performance metrics to quantify the ability of models to reproduce key processes for stratospheric ozone and its impact on climate. The Report is targeted at a variety of users, including: (1) international climate science assessments, including the WMO/ UNEP Ozone Assessments and the IPCC Assessment Reports; (2) the CCM groups themselves; (3) users of CCM simulations; (4) measurement and process scientists who wish to help improve CCM evaluation; (5) space agencies and other bodies involved in the Global Climate Observing System. The Report was prepared by dozens of scientists and underwent several revisions and extensive peer review, culminating in a Final Review Meeting in Toledo, Spain on November 9-11, 2009.
    Pages: Online-Ressource (XXXVIII, 426 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
    Unknown
    Rijeka : InTech
    Keywords: globalization ; business ; management ; economics
    Description / Table of Contents: This is a collective volume on present-day globalisation with nine chapters from authors of several academic disciplines. It covers wide aspects, ranging from the nature, impact, challenges and implications of globalisation to responses from a country or community when facing globalisation today or tomorrow. Policy suggestions are also made. This book will hence help the reader to understand the currently debated issues.
    Pages: Online-Ressource (160 Seiten)
    ISBN: 9789533071923
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 74
    Keywords: geochemistry ; South America ; Columbia
    Description / Table of Contents: Vibration is a phenomenon that we can perceive in many systems. Their effects are as diverse as the personal discomfort that can produce the unevenness of a road or the collapse of a building or a bridge during an earthquake. This book is a compendium of research works on vibration analysis and control. It goes through new methodologies that help us understand and mitigate this phenomenon. This book is divided into two sections. The first one is devoted to new advances on vibration analysis while the second part is a series of case studies that illustrate novel techniques on vibration control. The applications are varied and include areas such as vehicle suspension systems, wind turbines and civil engineering structures.
    Pages: Online-Ressource (140 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Keywords: climate events ; storms ; damage
    Description / Table of Contents: Climate events, storms, damage. Dans le monde d'aujourd'hui, presque tous les événements naturels extrêmes pourraient être qualifiés de désastre. Sur les 25 catastrophes les plus couteuses depuis 1970, toutes sont survenues après 1987 et 23 d'entre elles sont liées aux conditions climatiques. Et cela n'arrive pas qu'aux autres. La France, elle non plus, n'est pas épargnée : 88 morts et 9 milliards d'euros de dégats pour les tempêtes de décembre 1999, près de 15000 décès pour la canicule du 1er au 20 aout 2003. La récente tempête Xynthia, avec ses ruptures de digues, a provoqué 53 morts, s'ajoutant à tant d'autres tragédies survenues dans des zones inondables, et nous interrogeant. Sommes-nous prêts par exemple à affronter une crue comparable à celle de 1910 dans le Paris de demain? Dans le contexte actuel de changement climatique, nous savons que nous devons nous préparer à des événements extrêmes plus dangereux, quelquefois inédits. Ces événements voient leurs effets amplifiés par le développement urbain, le surpeuplement des zones littorales et l'anthropisation des milieux naturels. Ils représentent de véritables « trappes à pauvreté » pour les pays les plus pauvres de la Planète. C'est l'objet de ce rapport de l'Académie des Sciences qui analyse la question de ces événements climatiques extrêmes et de leurs conséquences prévisibles sur les systèmes économiques, sociaux, sanitaires et de sécurité.Un réel besoin d'anticipation existe donc : notre pays est-il prêt à y répondre? Participe-t-il suffi samment aux actions internationales visant à réduire les risques? Dispose-t-il d'une information scientifique appropriée?
    Pages: Online-Ressource (XLIV, 194 Seiten)
    ISBN: 9782759805082
    Language: French
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    Description / Table of Contents: The chapters in this volume represent an extensive review of the material presented by the invited speakers at a short course on Theoretical and Computational Methods in Mineral Physics held prior (December 10-12, 2009) to the Annual fall meeting of the American Geophysical Union in San Francisco, California. The meeting was held at the Doubletree Hotel & Executive Meeting Center in Berkeley, California. Mineral physics is one of the three pillars of geophysics, the other two being geodynamics and seismology. Geophysics advances by close cooperation between these fields. As such, mineral physicists investigate properties of minerals that are needed to interpret seismic data or that are essential for geodynamic simulations. To be useful, mineral properties must be investigated in a wide range of pressures, temperatures, and chemical compositions. The materials and conditions in the interior of Earth and other terrestrial planets present several challenges. The chemical composition of their mantles is complex with at least five major oxide components and tens of solid phases. Today, these challenges are being addressed by a combination of experimental and computational methods, with experiments offering precise information at lower pressures and temperatures, and computations offering more complete and detailed information at conditions more challenging to experiments. While bulk properties of materials are fundamental to understanding a planet’s state, atomistic inspection of these complex materials are fundamental to understanding their properties. A connection is then established between atomic and planetary scale phenomena, which mineral physicists are in a unique position to appreciate. This book presents a set of review articles offering an overview of contemporary research in computational mineral physics. Fundamental methods are discussed and important applications are illustrated. The opening chapter by John Perdew and Adrienn Ruzhinszky discusses the motivation, history, and expressions of Kohn-Sham Density Functional Theory (DFT) and approximations for exchange and correlation. This is the established framework for investigation of a condensed matter system’s ground state electronic density and energy. It also discusses the recent trend to design higher-level semi-local functionals, with solid state applications in mind. It presents arguments in favor of semi-local approximations for condensed matter and discusses problematic cases where fully non-local approximations are needed. The following article by Yan Zhao and Donald Truhlar, demonstrates current research in search of appropriate exchange and correlation energy functionals. It reviews the performance of families of local, semi-local, and fully non-local exchange and correlation functionals: the so-called “Minnesota” functionals. These new functionals have been designed to give broad accuracy in chemistry and perform very well in difficult cases where popular functionals fail badly. The prospects for their successful applications are encouraging. Stefano Baroni, Paolo Gianozzi, and Eyvaz Isaev, introduce Density Functional Perturbation Theory, a suitable technique to calculate vibrational properties of extended materials using a combination of density functional theory and linear response techniques. This method gives very accurate phonon frequencies which, in combination with the quasi-harmonic approximation, allow one to study thermal properties of materials. The next chapter by Renata Wentzcovitch, Yonggang Yu, and Zhongqing Wu review the applications of density functional perturbation theory to the investigation thermodynamic properties and phase relations in mantle minerals. The series of studies summarized in this review have explored the accuracy of DFT within its most popular approximations for exchange and correlation energy in combination with the quasiharmonic approximation to offer results with useful accuracy for geophysical studies. The following article by Renata Wentzcovitch, Zhongqing Wu, and Pierre Carrier, summarizes the combination of the quasiharmonic approximation with elasticity theory to investigate thermoelastic properties of minerals at conditions of the Earth interior. Some unfamiliar but essential aspects of the quasiharmonic approximation are discussed. Thermoelastic properties of minerals are essential to interpret seismic observations. Therefore, some examples of interpretation of seismic structures are reviewed. The article by David Ceperley, returns to the fundamental theme of calculations of ground state energy in condensed matter and introduces Quantum Monte Carlo methods. These methods treat exactly the quantum many-body problem presented by a system of electrons and ions. They treat electrons as particles rather than a scalar charge-density field, as done by DFT. These are computationally intensive methods but the only exact ones. The following article by Lubos Mitas and Jindrich Kolorenc, reviews applications of these methods to transition metals oxides, materials that have some aspects in common with mantle minerals. One of the examined systems, FeO, is a most important component of mineral solid solutions. Matteo Cococcioni continues exploring the same theme. He discusses a modified density functional useful for addressing cases like FeO, which are untreatable by standard DFT. The DFT + Hubbard U method (DFT+U) is a practical approximate method that enables investigations of electronically and structurally complex systems, like minerals. The application of this method to a contemporary and central problem in mineral physics, pressure and temperature induced spin-crossovers in mantle minerals, is reviewed in the next chapter by Han Shu, Koichiro Umemoto, and Renata Wentzcovitch. The geophysical implications of the spin-crossover phenomenon, an electronic transition, are still unclear but some possibilities are suggested. Michael Ammann, John Brodholt, and David Dobson discuss simulations of bulk ionic diffusion. This property plays an important role in chemical exchange between and within crystalline and melt phases. It plays an important role in the kinetics of phase transitions, compositional zoning, mineral growth, and other important geochemical processes. It can also control rheological properties, especially in the diffusion creep regime, and thus the time scale of mantle convection. This is a very difficult property to investigate at combined pressures and temperature conditions of the mantle, therefore, calculations play a very important role in this area. Phillip Carrez and Patrick Cordier discuss modeling of dislocations and plasticity in deep Earth materials. This article focuses on recent developments in dislocation modeling and applications to our understanding of how the direction of mantle flow is recorded in polycrystalline texture. Next, the article by Stephen Stackhouse and Lars Stixrude, discusses theoretical methods for calculating lattice thermal conductivity in minerals, which controls the cooling of Earth’s core. Measurements of thermal conductivity at lower mantle conditions are very challenging to experiments and calculations are a valuable alternative to learning about this property. This article describes the most common methods to calculate this property and presents a review of studies of the lattice thermal conductivity of periclase. Artem Oganov discusses the prediction of high pressure crystal structures. A genetic algorithm for structural prediction is described and numerous applications predicting new phases with novel properties and phases that can explain experimental data so far not understood is presented. This is a most recent development on the subject of structural predictions, a subject that has been pursued by simulations for several decades now. The possibility of predicting structure and composition by this method is also pointed out. Koichiro Umemoto and Renata Wentzcovitch continue on the same theme of structural prediction by a different approach: combination of phonon calculations and variable cell shape molecular dynamics. The former indicates unstable displacement modes in compressed structures; the latter searches for structures resulting from the superposition of these unstable modes to the compressed lattice. This approach is illustrated with the search of mineral structures at multi-Mbar pressures that are still challenging to static or dynamic compression experiments, but have great interest in view of the discovery of terrestrial exoplanets with several Earth masses. The following chapter by Koichiro Umemoto is on simulations of phase transitions on a different class of planet forming material: H2O-ice. Ice has a rich phase diagram but many of its phase relations are unknown: large hysteresis precludes their direct measurements in manageable time scales. Therefore, calculations acquire special significance but they are also challenging, the main reasons being the description of hydrogen bond by DFT and hydrogen disorder. Dario Alfè presents a review of first principles calculations of properties of iron at Earth’s core conditions. This chapter includes examples of applications of multiple techniques used in studies of high temperature properties, structure, and melting lines. Results from Quantum Monte Carlo are compared with those from DFT, and results from molecular dynamics simulations are contrasted with predictions of quasiharmonic theory. These comparisons are instructive and illustrate the breadth of research in computational mineral physics. The following chapter by Bijaya Karki turns to DFT based simulations of another type of melt: ionic silicates and oxides. The article discusses the methodology used in these simulations and specially developed methods to analyze the results. The properties of interest are high temperature equations of state, thermodynamics properties, atomic and electronic structure, and self-diffusion and viscosity. Visualization of atomic motion is one of the valuable approaches discussed to gain insight into changes in melt structure with pressure and temperature. These studies are illustrated for 3 melts along the MgO-SiO2 join. The following three articles are devoted primarily to the introduction of inter-atomic potentials of broad applicability and relatively high accuracy, and applications to large scale simulations. The first article by Julian Gale and Kate Wright describes the current status of the derivation of force-fields and their applications to static and lattice dynamic calculations in mineral physics. This is done in the context of the General Utility Lattice Program (GULP), which has become quite popular. A selection of applications illustrating the possibilities of this code is then presented. Victor Vinograd and Bjoern Winkler illustrate another important type of application of force-field models: an efficient cluster expansion method to investigate binary mineral solid solutions. The article focuses on a rock-salt system but the technique is general. This type of problem is central to mineral physics and ingenious combinations of first principles methods, force-field models, and purely parameterized free energy expressions, combined with molecular dynamics and Monte Carlo techniques are necessary to address this problem. The predictive treatment of properties of ionic solid solutions is a major challenge in mineral physics. Mark Ghiorso and Frank Spera discuss long duration large scale molecular dynamics simulations using empirical pair-potentials. This article illustrates the concrete requirements on the number of atoms and time scales necessary to obtain information on transport properties such as shear viscosity and lattice thermal conductivity using Green-Kubo theory. These more than 1000-atom and pico-second simulations also improve the statistics in the estimation of equilibrium properties. Finally, the article by Lars Stixrude and Carolina Lithgow-Bertelloni on the thermodynamics of Earth’s mantle, gives an overview of how the elucidation of materials behavior governs planetary processes. It explains how the complexity of the Earth’s mantle demands methods that are complementary to first principles calculations and experiments. These methods must allow one to interpolate among and extrapolate from results on minerals with limited compositions to the full chemical richness of the silicate mantle. It then illustrates how the derived properties of multi-phase multi-component systems are used to address mantle heterogeneity on multiple length scales, ranging from that of the subducting slab to the possibility of mantle-wide radial variations in bulk composition.
    Pages: Online-Ressource (xviii , 484 Seiten)
    ISBN: 9780939950850
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Description / Table of Contents: Unlike many other low-carbon energy sources, nuclear energy is a mature technology that has been in use for more than 50 years. The latest designs for nuclear power plants build on this experience to offer enhanced safety and performance, and are ready for wider deployment. Nuclear power will be an important contributor to a low carbon power mix and can play a significant role in achieving both enhanced energy security and combating climate change. The IEA/NEA Nuclear Energy Technology Roadmap (2010) identified major barriers, opportunities, and policy measures for policy makers and industry and financial partners to accelerate RDD&D efforts for various nuclear technologies on both a national and international level.
    Pages: Online-Ressource (52 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    Keywords: energy ; energy economics
    Description / Table of Contents: The transport sector is currently responsible for 23% of energy-related CO2 emissions, and transport associated CO2 emissions will more than double by 2050. This working paper evaluates the potential costs and benefits of using natural gas as a vehicle fuel for road transportation, as well as the policy related to its market development.
    Pages: Online-Ressource (84 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
    Keywords: energy ; energy economics
    Description / Table of Contents: For the first time, the IEA has merged its medium-term market reports for oil and gas, thereby giving readers a broader perspective on global trends. Critical questions persist for both markets, including whether economic and energy demand outlooks are clearer than in mid-2009. For the first time, the IEA has merged its medium-term market reports for oil and gas, thereby giving readers a broader perspective on global trends. Critical questions persist for both markets, including whether economic and energy demand outlooks are clearer than in mid-2009. Do oil markets show a genuine structural shift in demand patterns? Will they sustain a nascent recovery in upstream spending evident in 2010? And how long will current levels of OPEC spare capacity persist? For the gas market, will demand recover from its collapse in 2009? How long will the gas glut last? Will unconventional gas revolutionise gas markets outside North America? And how is consumption changing in China, Russia and the Middle East? Medium-Term Oil and Gas Markets 2010 presents a comprehensive outlook for oil and gas market fundamentals over the next three to five years. The oil market analysis develops two demand scenarios that reflect uncertainties about the path of economic recovery after the global slow-down in 2008/09. Market balances are generated from detailed analysis of upstream investment projects, oil field decline rates, product-by-product demand trends, and refinery investment and operations. The gas market analysis assesses prices, unconventional gas, future demand developments and LNG markets, as well as investment across the gas value chain. With a focus on key producers (including Russia, the Caspian region and the Middle East) and rising LNG exporters (such as Australia), it examines implications for global gas markets.
    Pages: Online-Ressource (373 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 80
    Keywords: energy ; energy economics
    Description / Table of Contents: The International Energy Agency (IEA) considers carbon capture and storage (CCS) a crucial part of worldwide efforts to limit global warming by reducing greenhouse-gas emissions. The IEA has estimated that the broad deployment of low-carbon energy technologies could reduce projected 2050 emissions to half 2005 levels – and that CCS could contribute about one-fifth of those reductions. Reaching that goal, however, would require around 100 CCS projects to be implemented by 2020 and over 3 000 by 2050.
    Pages: Online-Ressource (66 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Keywords: energy ; energy economics
    Description / Table of Contents: Two years after the G8 leaders commitment to the broad deployment of carbon capture and storage (CCS) by 2020, significant progress has been made towards commercialisation of CCS technologies. Yet the 2008 Hokkaido G8 recommendation to launch 20 large-scale CCS demonstration projects by 2010 remains a challenge and will require that governments and industry accelerate the pace toward achieving this critical goal. This is one of the main findings of a new report by the International Energy Agency (IEA), the Carbon Sequestration Leadership Forum (CSLF), and the Global CCS Institute, to be presented to G8 leaders at their June Summit in Muskoka, Canada.
    Pages: Online-Ressource (40 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Keywords: energy ; energy economics
    Description / Table of Contents: The purpose of this report is to help EE practitioners, government officials and stakeholders to establish the most effective EE governance structures, given their specific country context. It also aims to provide readers with relevant and accessible information to support the development of comprehensive and effective governance mechanisms. The International Energy Agency (IEA) conducted a global review of many elements of EE governance,including legal frameworks, institutional frameworks, funding mechanisms, co-ordination mechanisms and accountability arrangements, such as evaluation and oversight. The research tools included a survey of over 500 EE experts in 110 countries, follow-up interviews of over 120 experts in 27 countries and extensive desk study and literature searches on good EE governance.
    Pages: Online-Ressource (226 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Description / Table of Contents: The IEA estimates that, if implemented globally without delay, the 25 IEA Energy Efficiency recommendations could save 8.2 Gt CO2 per year by 2030. Yet many governments struggle with their implementation and thus miss a great part of the energy efficiency potential. The new IEA series Policy Pathways: Showing the way to energy efficiency implementation now aims to assist countries with improving energy efficiency policies. It features practical ‘how-to’ guides for designing, implementing and evaluating energy efficiency policies and achieving greater improvement.
    Pages: Online-Ressource (59 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Description / Table of Contents: Naturkatastrophen bedeuten nicht nur momenthafte Zerstörung, die nach erfolgtem Wiederaufbau wieder vergessen ist. Katastrophen haben häufig nachhaltige Auswirkungen auf Politik und Gesellschaft und damit auf die menschliche Geschichte. Sie führen mitunter zu Verordnungen, Institutionenbildung, Politikwechsel und gesellschaftlichem Umdenken, können aber auch Anlass zu Aufbruchstimmung und Fortschrittsoptimismus geben. Durch die aktuelle Diskussion zum globalen Klimawandel hat sich in der Öffentlichkeit ein stärkeres Bewusstsein für die gesellschaftliche Relevanz von Naturkatastrophen entwickelt. Welche Rolle extreme Ereignisse in der Geschichte gespielt haben und welche Strategien zu ihrer Bewältigung in verschiedenen Zeiten wirksam waren, bilden die zentralen Fragen des Sammelbandes. Die Autoren untersuchen neben klassischen Naturkatastrophen auch Seuchen und Schädlingskalamitäten in historischer Perspektive und widmen sich theoretischen Fragen zu deren Genese und Auswirkungen. Der vorliegende Band ist das Ergebnis eines Workshops, der von den Herausgebern im Rahmen des DFG-Graduiertenkollegs „Interdisziplinäre Umweltgeschichte“ unter dem Titel „Katastrophen machen Geschichte – Umweltgeschichtliche Prozesse im Spannungsfeld von Ressourcennutzung und Extremereignis“ am 6. und 7. Mai 2009 in Göttingen veranstaltet wurde.
    Pages: Online-Ressource (198 Seiten)
    ISBN: 9783941875210
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Unknown
    Basel, Boston, Berlin : Birkhäuser
    Keywords: engineering ; geophysics ; mining ; monitoring technology ; seismic monitoring ; seismic tomography ; seismology ; stress re-distribution
    Description / Table of Contents: Stress re-distribution as a result of exploitation of mineral, hydrocarbon, geothermal, and water resources cannot be eliminated. The effort must be directed to a better understanding of the underlying processes for the management of the hazard and risk associated with these operations. The study of induced seismicity has continually evolved over the past couple of decades, as underlined by both the number and complexity of applied studies required to satisfy the increased economic demands, assure the safety of the workforce and equipment, and protect the environment. A considerable effort has been put into the development of passive monitoring technology, specialized products and services being available for a wide range of applications. The recording of substantial high quality seismic data has stimulated the work on theoretical and practical aspects related to these applications, involving not only seismological knowledge, but also elements of rock mechanics, and an understanding of mining, geotechnical, and petroleum engineering. Pure and Applied Geophysics has largely contributed to raising the profile of induced seismicity research and its credibility. The range of specific analyses included in the present collection of studies expresses how powerful and resourceful passive seismic monitoring has become to so many applications. Seismic data are routinely evaluated for a series of development activities specific to each application. Engineering practice is continually improved based on trials and analyses of the ground response and stress levels, confirmed through the monitoring of seismicity. We are better equipped than ever to provide management decisions based on formalized, quantitative, and thus objective assessment.
    Pages: Online-Ressource (213 Seiten)
    ISBN: 9783034603058
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    facet.materialart.
    Unknown
    Washington, D.C. : The World Bank ; Collins Bartholomew
    Description / Table of Contents: The World Bank eAtlas of the Millennium Development Goals lets you visualize and map the indicators that measure progress toward the Goals, with clear explanations of each Goal and its related Targets as the context. When you select an indicator, the eAtlas creates a world map keyed to that indicator, with country rankings and data in your choice of tables or graphs. You can pan or zoom to view different countries or regions, view the dynamic change in that map with a time series, compare two maps and sets of data, and do much more.
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Keywords: poverty reduction ; governance ; social justice ; energy efficiency ; social protection ; vulnerability ; climate ; climate change ; global warming ; emissions ; carbon ; equity ; renewable energy ; forest
    Description / Table of Contents: Climate change is arguably the most profound challenge facing the international community in the 21st century. It is as much a challenge for poverty reduction, growth, and development as it is a global environmental issue. Climate change could undermine or reverse progress in reducing poverty and attaining the Millennium Development Goals, thereby unraveling many of the development gains of recent decades. It already threatens the livelihoods, health, and well-being of millions of people worldwide, particularly the poorest, most vulnerable groups. This book focuses attention on these previously neglected and poorly understood social dimensions of climate change. It highlights equity and vulnerability as central organizing themes and illustrates the multiple ways that pro-poor climate policy and action should be integrated into existing approaches to poverty reduction and development—from the local to the global levels. This integration is needed both in terms of pro-poor approaches to climate change adaptation and in terms of better managing the social risks and potential benefits associated with measures to reduce greenhouse gas emissions.
    Pages: Online-Ressource (XXIII, 319 Seiten)
    ISBN: 9780821381427
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Unknown
    Washington, D.C. : The World Bank
    Keywords: emission scenarios ; colors ; vegetative cover ; oceans ; energy efficiency ; greenhouse gas ; temperature anomalies ; temperature ; emission ; greenhouse gas emissions ; carbon ; low-carbon ; climate change ; carbon cycle ; ecosystem ; ipcc ; greenhouse ; climate ; carbon dioxide ; chlorophyll concentration
    Description / Table of Contents: Today's enormous development challenges are complicated by the reality of climate change�the two are inextricably linked and together demand immediate attention. Climate change threatens all countries, but particularly developing ones. Understanding what climate change means for development policy is the central aim of the World Development Report 2010. It explores how public policy can change to better help people cope with new or worsened risks, how land and water management must adapt to better protect a threatened natural environment while feeding an expanding and more prosperous population, and how energy systems will need to be transformed.The report is an urgent call for action, both for developing countries who are striving to ensure policies are adapted to the realities and dangers of a hotter planet, and for high-income countries who need to undertake ambitious mitigation while supporting developing countries efforts. A climate-smart world is within reach if we act now to tackle the substantial inertia in the climate, in infrastructure, and in behaviors and institutions; if we act together to reconcile needed growth with prudent and affordable development choices; and if we act differently by investing in the needed energy revolution and taking the steps required to adapt to a rapidly changing planet.In the crowded field of climate change reports, WDR 2010 uniquely: -- emphasizes development -- takes an integrated look at adaptation and mitigation -- highlights opportunities in the changing competitive landscape and how to seize them -- proposes policy solutions grounded in analytic work and in the context of the political economy of reform
    Pages: Online-Ressource (XXI, 417 Seiten)
    ISBN: 9780821379882
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Description / Table of Contents: There is an increasing consensus in the scientific community that climate change is a real and present threat. Despite the large uncertainty on the timing, magnitude and even the direction of some of the physical and economic effects of this phenomenon, it is widely accepted that these effects will be regionally differentiated and that developing countries and lower income populations will tend to suffer the most. In this context, it is critical that Latin American and Caribbean countries develop their own strategies for adapting to the various impacts of climate change and for contributing to global efforts aimed at mitigation.\'Low Carbon, High Growth\' contributes to these efforts by addressing a number of questions related to the causes and consequences of climate change in Latin America. What are the likely impacts of climate change in the region? Which countries and regions will be most affected? What can governments do to tackle the challenges associated with adapting to climate change? What role can Latin America and the Caribbean play in the area of climate change mitigation? How can the international community best help the region respond? While the study does not attempt to provide definitive answers to these questions, its goal is to contribute new information and analysis to help inform the public policy debate on this important issue.
    Pages: Online-Ressource (XXI, 180 Seiten)
    ISBN: 9780821381328
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Description / Table of Contents: The Earth's climate varies through geological time as a result of external, orbital processes, as well as the positions of continents, growth of mountains and the opening and closure of oceanic gateways. Climate modelling suggests that the intensity of the Asian monsoon should correlate, at least in part, with the uplift history of the Tibetan Plateau and the Himalaya, as well as the evolution of gateways and the retreat of shallow seas in Central Asia. Long-term reconstructions of both mountain building and monsoon activity are key to testing the proposed links. This collection of papers presents a series of new studies documenting the variations of the Asian monsoon on orbital and tectonic timescales, together with the impact this has had on environmental conditions. The issue of which proxies are best suited to measuring monsoons is addressed, as is the effect that the monsoon has had on erosion and the formation of the stratigraphic record both on and offshore.
    Pages: Online-Ressource (308 Seiten)
    ISBN: 9781862393103
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Description / Table of Contents: This volume combines original data in various fields from the offshore Levant Basin and adjacent continental slopes and platforms. The first group of papers document the tectonic structures and sedimentological patterns associated with the development of the Levant Basin. They identify the successive rifting events from the Late Palaeozoic to the Early Cretaceous, followed by a moderate tectonic activity. The contribution of external factors like global sea-level and climate changes to the sedimentation processes during the Mid-Cretaceous is discussed in the second set of papers. The final group presents new kinematics and age constraints on the Late Cretaceous to Neogene tectonic phases and discusses the relationship of the structures with the closure of the Neo-Tethys and separation of the Arabia plate. This collection of research papers demonstrates new concepts on the opening and crustal thinning of the Levant Basin and gives updated interpretations of the latter tectonic structures of the Levant.
    Pages: Online-Ressource (VII, 338 Seiten)
    ISBN: 9781862393066
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    Unknown
    Berlin, New York : De Gruyter Saur
    Description / Table of Contents: Unter Bibliothek 2.0 verstehen die Herausgeber eine Einrichtung, die die Prinzipien des Web 2.0 wie Offenheit, Wiederverwendung (ReUse), Kollaboration und Interaktion in der Gesamtorganisation anwendet. Bibliotheken erweitern Serviceangebote und Arbeitsabläufe um die Möglichkeiten der Web 2.0-Technologien. Dies verändert Berufsbild und Selbstverständnis der Bibliothekare. Der Sammelband bietet einen kompletten Überblick zum Thema Bibliothek 2.0 und den aktuellen Stand der Entwicklungen aus technologischer, soziologischer, informationstheoretischer sowie praxisorientierter Sicht.
    Pages: Online-Ressource (XII, 393 Seiten)
    ISBN: 9783110232103
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Unknown
    London : The Geological Society
    Description / Table of Contents: The Mesozoic Era begins with the approximately 50-million-year-long Triassic Period, a major juncture in Earth history when the vast Pangaean supercontinent completed its assembly and began its fragmentation, and the global biota diversified and modernized after the end-Permian mass extinction, the most extensive biotic decimation of the Phanerozoic. The temporal ordering of geological and biotic events during Triassic time thus is critical to the interpretation of some unique and pivotal events in Earth history. This temporal ordering is mostly based on the Triassic timescale, which has been developed and refined for nearly two centuries. This book reviews the state of the art of the Triassic timescale and includes comprehensive analyses of Triassic radio-isotopic ages, magnetostratigraphy, isotope-based and cyclostratigraphic correlations and timescale -relevant marine and non-marine biostratigraphy.
    Pages: Online-Ressource (514 Seiten) , Illustrationen, Diagramme, Karten
    ISBN: 9781862392960
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Description / Table of Contents: Several different databases and models have been developed over many years of petrological study carried out by several European and non-European groups on mantle xenoliths, peridotite massifs, ophiolites and mafic magmas spanning in age from Archaean to Recent times. This volume aims to bring together these different approaches and to integrate the geochemical perceptions of the European upper mantle. The papers include regional petrological studies of the European lithospheric mantle, from Spain to the Pannonian Basin, from Corsica and Serbia as far north as Svalbard. Six contributions are based on studies of mantle xenoliths, while the remaining three deal with ophiolitic and peridotitic complexes. A further article provides an update on the textural classification of mantle rocks using a computer-aided approach and there is an introductory overview.
    Pages: Online-Ressource (246 Seiten)
    ISBN: 9781862393042
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    Description / Table of Contents: Our understanding of calcium carbonate precipitation within freshwater carbonate systems is being revolutionized by new quantitative approaches at both field and laboratory scale. These systems cover a diverse range of topical research areas including tufas, speleothems, stromatolites and microbial processes. Progress by various international research groups has been impressive, with major contributions to such areas as climate change, absolute dating, carbon sequestration, and biofilm construction and precipitation. A diverse sample of interrelated research is presented that provides a tantalizing glimpse of the interplay between microbial, geochemical and physical processes that control the development of tufas and speleothems. This volume will provide a cross-disciplinary platform that will stimulate further exchanges about new concepts, methodologies and interpretations associated with freshwater carbonates. In particular, it will help reinforce the importance of cross-discipline research: the driving force behind the new field of Geobiology.
    Pages: Online-Ressource (VI, 362 Seiten)
    ISBN: 9781862393011
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Description / Table of Contents: Reservoir compartmentalization - the segregation of a petroleum accumulation into a number of individual fluid/pressure compartments - controls the volume of moveable oil or gas that might be connected to any given well drilled in a field, and consequently impacts ‘booking’ of reserves and operational profitability. This is a general feature of modern exploration and production portfolios, and has driven major developments in geoscience, engineering and related technology. Given that compartmentalization is a consequence of many factors, an integrated subsurface approach is required to better understand and predict compartmentalization behaviour, and to minimize the risk of it occurring unexpectedly. This volume reviews our current understanding and ability to model compartmentalization. It highlights the necessity for effective specialist discipline integration, and the value of learning from operational experience in: detection and monitoring of compartmentalization; stratigraphic and mixed-mode compartmentalization; and fault-dominated compartmentalization.
    Pages: Online-Ressource (VI, 362 Seiten)
    ISBN: 9781863293165
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    Description / Table of Contents: Echinoderms are a vast group of spiny-skinned animals including starfish, brittle-stars, sea urchins, sand dollars, feather stars, sea lilies and sea cucumbers. These relatives of chordates and hemichordates have inhabited the world’s oceans for more than 500 million years. Modern members of the Echinodermata are, with over 7 000 species, an integral part of marine communities from the intertidal to the deep sea. Echinoderms play a major ecological role in marine habitats and are of economic importance in fisheries, aquaculture and biomedicine. The present volume contains the abstracts of lectures and posters presented during the 7th European Conference on Echinoderms (ECE) as well as excursion guides. This year’s conference was held at the northern campus of the Georg-August University in Göttingen, Germany, from October 2-9, 2010. More than 100 biologists, palaeontologists and other scientists from 25 countries participated.
    Pages: Online-Ressource (145 Seiten)
    ISBN: 9783941875685
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Description / Table of Contents: Für alle Regionen, die auf den Tourismus als ökonomisches Standbein setzen, ist ein marktfähiges Alleinstellungsmerkmal wichtig. Die Kulturlandschaft in ihrer jeweils besonderen Eigenart bietet hierfür ein endogenes Potenzial, das es zu erschließen, aber gleichermaßen auch zu schützen gilt. Doch viele kulturlandschaftliche Charakteristika und Besonderheiten eröffnen sich nicht unmittelbar, sondern müssen erst herausgearbeitet und „interpretiert“ werden. Darin liegt die grundlegende Herausforderung. Der vorliegende Band beinhaltet zum einen theoretische Auseinandersetzungen mit dem Thema Kulturlandschaftsforschung aus der Perspektive verschiedener wissenschaftlicher Fachrichtungen, zum anderen praxisbezogene Fallbeispiele, die aufzeigen, wie die Forschungsergebnisse einem Freizeitpublikum auf interessante Art und Weise vermittelt werden können. Denn die Kulturlandschaft ist beides – wissenschaftliches Forschungsobjekt und Vermittlungsraum im Kontext touristischer Freizeitgestaltung.
    Pages: Online-Ressource (179 Seiten)
    ISBN: 9783941875333
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Keywords: oceanography ; atmospheric sciences ; environmental engineering ; geodesy ; remote sensing
    Pages: Online-Ressource (170 Seiten)
    ISBN: 9789537619602
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Description / Table of Contents: Fjords are glacially over-deepened, semi-enclosed marine basins, but are often neglected as a sedimentary realm. They represent the transition from the terrestrial to the marine environment and as such have the potential to preserve evidence of environmental change. Typically most fjords have been glaciated a number of times and some high-latitude fjords still possess a resident glacier. The stratigraphic record in fjords largely preserves a glacial–deglacial cycle of deposition. Sheltered water and high sedimentation rates potentially make fjords ideal depositional environments for preserving continuous records of climate and environmental change with high temporal resolution. Fjords are also referred to as miniature oceans providing the unique opportunity to study marine processes in great detail. With predictions of warming climates, changing ocean circulation and rising sea levels, this volume is a timely look at these environmentally sensitive coastlines.
    Pages: Online-Ressource (VII, 380 Seiten)
    ISBN: 9781862393127
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...