ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • Books  (233)
  • Maps
  • Online Books  (233)
  • 2010-2014  (124)
  • 1995-1999  (1)
  • 1980-1984  (110)
  • 1925-1929
  • 2010  (124)
  • 1982  (66)
  • 1981  (45)
  • 1928  (1)
Collection
  • Books  (233)
  • Maps
Source
Language
Years
Year
Classification
Branch Library
  • 1
    facet.materialart.12
    Berlin, New York : De Gruyter Saur
    Call number: 9783110232103 (e-book)
    Description / Table of Contents: With the term "Library 2.0" the editors mean an institution which applies the principles of the Web 2.0 such as openness, re-use, collaboration and interaction in the entire organization. Libraries are extending their service offerings and work processes to include the potential of Web 2.0 technologies. This changes the job description and self-image of librarians. The collective volume offers a complete overview of the topic Library 2.0 and the current state of developments from a technological, sociological, information theoretical and practice-oriented perspective
    Type of Medium: 12
    Pages: 1 Online-Ressource (1 electronic resource (xii, 392 p.))
    Edition: Online-Ausg.
    ISBN: 9783110232103 , 9783110232097
    Series Statement: Bibliotheks- und Informationspraxis 41
    Language: Undetermined
    Note: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    facet.materialart.12
    Oxford : Blackwell Scientific Publications
    Associated volumes
    Call number: 10.1144/GSL.SP.1981.009.01.01
    In: Special publications / the Geological Society, London, Volume 9
    Type of Medium: 12
    Pages: 1 Online-Ressource (VI, 539 Seiten) , Illustrationen
    ISBN: 0632006145
    Series Statement: Special publications / the Geological Society, London 9
    Language: English
    Note: Table of Contents Introduction N. J. Price and K. R. McClay https://doi.org/10.1144/GSL.SP.1981.009.01.01 What is a Thrust? What is a Nappe? J. G. Dennis, R. A. Price, J. K. Sales, R. Hatcher, A. W. Bally, W. J. Perry, H. P. Laubscher, R. E. Williams, D. Elliott, D. K. Norris, D. W. Hutton, T. Emmett, and K. R. McClay https://doi.org/10.1144/GSL.SP.1981.009.01.02 I. Mechanics of Thrusts and Nappes Thoughts on the tectonics of folded belts A. W. Bally https://doi.org/10.1144/GSL.SP.1981.009.01.03 Pore pressure, discontinuities, isostasy and overthrusts P. E. Gretener https://doi.org/10.1144/GSL.SP.1981.009.01.04 Gravitational gliding in deltas G. Mandl and W. Crans https://doi.org/10.1144/GSL.SP.1981.009.01.05 Thrust sheet deformation at a ramp: summary and extensions of an earlier model D. V. Wiltschko https://doi.org/10.1144/GSL.SP.1981.009.01.06 Deformation and secondary faulting near the leading edge of a thrust fault D. A. Rodgers and W. D. Rizer https://doi.org/10.1144/GSL.SP.1981.009.01.07 Mechanical model of thrust sheet gliding and imbrication G. Mandl and G. K. Shippam https://doi.org/10.1144/GSL.SP.1981.009.01.08 The rock mechanics of thrust and nappe formation S. A. F. Murrell https://doi.org/10.1144/GSL.SP.1981.009.01.09 Subduction and coeval thrust belts, with particular reference to North America A. G. Smith https://doi.org/10.1144/GSL.SP.1981.009.01.10 The role of gravity in orogenic belts H. Ramberg https://doi.org/10.1144/GSL.SP.1981.009.01.11 II. Rock Products of Thrusting Dynamic analysis of a small imbricate thrust and related structures, Front Ranges, Southern Canadian Rocky Mountains J. H. Spang and S. P. Brown https://doi.org/10.1144/GSL.SP.1981.009.01.12 The microfabric of calcite tectonites from the Helvetic Nappes (Swiss Alps) S. M. Schmid, M. Casey, and J. Starkey https://doi.org/10.1144/GSL.SP.1981.009.01.13 Very low grade metamorphism with a reverse gradient induced by an overthrust in Haute-Savoie (France) J. Aprahamian and J.-L. Pairis https://doi.org/10.1144/GSL.SP.1981.009.01.14 Saline horizons acting as thrust planes along the southern margin of the Damara Orogen (Namibia/SW-Africa) H. J. Behr, H. Ahrendt, A. Schmidt, and K. Weber https://doi.org/10.1144/GSL.SP.1981.009.01.15 Sliding and other deformation mechanisms in a glacier of salt, S Iran C. J. Talbot https://doi.org/10.1144/GSL.SP.1981.009.01.16 The Caledonides of northern Norway: relation between preferred orientation of quartz lattice, strain and translation of the nappes A.-M. Boullier and J.-M. Quenardel https://doi.org/10.1144/GSL.SP.1981.009.01.17 Structure and distribution of fault rocks in the Alpine Fault Zone, New Zealand R. H. Sibson, S. H. White, and B. K. Atkinson https://doi.org/10.1144/GSL.SP.1981.009.01.18 Uplift rates and thermal structure in the Alpine Fault Zone and Alpine Schists, Southern Alps, New Zealand C. J. Adams https://doi.org/10.1144/GSL.SP.1981.009.01.19 III. Thrust and Nappe Regimes. A. ‘The Old World’ Caledonides The internal geometry of nappes: criteria for models of emplacement M. A. Cooper https://doi.org/10.1144/GSL.SP.1981.009.01.20 The strain profile above a major thrust fault, Finnmark, N Norway N. J. Milton and G. D. Williams https://doi.org/10.1144/GSL.SP.1981.009.01.21 The Moine Thrust Zone: an overview K. R. McClay and M. P. Coward https://doi.org/10.1144/GSL.SP.1981.009.01.22 Tectonic slides in the Caledonides D. H. W. Hutton https://doi.org/10.1144/GSL.SP.1981.009.01.23 Estimation of the rate and amount of absolute lateral shortening in an orogen using diachronism and strike slipped segments W. E. A. Phillips https://doi.org/10.1144/GSL.SP.1981.009.01.24 Strain within thrust sheets M. P. Coward and J. H. Kim https://doi.org/10.1144/GSL.SP.1981.009.01.25 III. Thrust and Nappe Regimes. A. ‘The Old World’ Alpine Tectonics of the Helvetic Nappes J. G. Ramsay https://doi.org/10.1144/GSL.SP.1981.009.01.26 The 3D propagation of décollement in the Jura H. P. Laubscher https://doi.org/10.1144/GSL.SP.1981.009.01.27 Fold-and-thrust tectonics in the Helvetic Nappes (E Switzerland) O. A. Pfiffner https://doi.org/10.1144/GSL.SP.1981.009.01.28 Some observations on the development of thrust faults in the Ultradauphinois Zone, French Alps A. Beach https://doi.org/10.1144/GSL.SP.1981.009.01.29 Gravity sliding in the Maritime Alps R. H. Graham https://doi.org/10.1144/GSL.SP.1981.009.01.30 III. Thrust and Nappe Regimes. A. ‘The Old World’ Eurasia Sutures, thrusts and nappes in the Variscan Arc of western Europe: plate tectonic implications Ph. Matte and J. P. Burg https://doi.org/10.1144/GSL.SP.1981.009.01.31 Wrench related thrusting along a Mesozoic-Cenozoic continental margin: Antalya Complex, SW Turkey N. H. Woodcock and A. H. F. Robertson https://doi.org/10.1144/GSL.SP.1981.009.01.32 Thrust and strike slip fault interaction along the Chaman transform zone, Pakistan R. D. Lawrence and R. S. Yeats S. H. Khan, A. Farah, and K. A. DeJong https://doi.org/10.1144/GSL.SP.1981.009.01.33 Active thrusting and the evolution of the Zagros fold belt J. A. Jackson and T. J. Fitch D. P. McKenzie https://doi.org/10.1144/GSL.SP.1981.009.01.34 An overview of thrusts and nappes of western Himalaya V. C. Thakur https://doi.org/10.1144/GSL.SP.1981.009.01.35 Ambiguity in interpretation of seismic data from modern convergent margins: an example from the IPOD Japan Trench transect R. von Huene, M. Arthur, and B. Carson https://doi.org/10.1144/GSL.SP.1981.009.01.36 Geometrical problems and implications of large scale over-thrusting in the Banda Arc -Australian margin collision zone M. G. Audley-Charles https://doi.org/10.1144/GSL.SP.1981.009.01.37 Neogene thrust emplacement from a frontal arc in New Guinea J. Milsom https://doi.org/10.1144/GSL.SP.1981.009.01.38 IV. Thrust and Nappe Regimes. B. ‘The New World’ The Americas The Cordilleran foreland thrust and fold belt in the southern Canadian Rocky Mountains R. A. Price https://doi.org/10.1144/GSL.SP.1981.009.01.39 The nature and significance of large ‘blind’ thrusts within the northern Rocky Mountains of Canada R. I. Thompson https://doi.org/10.1144/GSL.SP.1981.009.01.40 Metamorphic complex of SE Canadian Cordillera and relationship to foreland thrusting R. L. Brown https://doi.org/10.1144/GSL.SP.1981.009.01.41 Thrust nappes in the Rocky Mountain Foothills near Mountain Park, Alberta H. A. K. Charlesworth and W. E. Kilby https://doi.org/10.1144/GSL.SP.1981.009.01.42 Deformational styles in two Mesozoic fault zones, western Washington, USA D. S. Cowan and R. B. Miller https://doi.org/10.1144/GSL.SP.1981.009.01.43 Thrusts and nappes in the North American Appalachian Orogen R. D. Hatcher, Jr. https://doi.org/10.1144/GSL.SP.1981.009.01.44 COCORP seismic reflection profiling across thrust faults J. A. Brewer, F. A. Cook, L. D. Brown, J. E. Oliver, S. Kaufman, and D. S. Albaugh https://doi.org/10.1144/GSL.SP.1981.009.01.45 Mechanisms for basement shortening in the Andean foreland fold belt of southern South America Margaret A. Winslow https://doi.org/10.1144/GSL.SP.1981.009.01.46
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
    Call number: 10.1144/GSL.SP.1982.010.01.01
    In: Special publications / the Geological Society, London, Volume 10
    Description / Table of Contents: This book is a collection of papers on an aspect of plate tectonics of which our understanding is at present limited. In the mid-1970s, prior to the recent phase of IPOD active margin drill- ing, few geologists would have anticipated that at the start of the 1980s so many new questions concerning the nature of tectonic and sedimentary processes in forearc regions would have come to light.
    Type of Medium: 12
    Pages: 1 Online-Ressource (VII, 576 Seiten)
    ISBN: 0632007087
    Series Statement: Special publications / the Geological Society, London 10
    Language: English
    Note: Table of Contents Japan The Shimanto Belt of Japan: Cretaceous-lower Miocene active-margin sedimentation A. Taira, H. Okada,J. H. Whitaker, and A. J. Smith https://doi.org/10.1144/GSL.SP.1982.010.01.01 Sedimentation across the Japan Trench off northern Honshu Island Roland von Huene and Michael A. Arthur https://doi.org/10.1144/GSL.SP.1982.010.01.02 Tectonics of some forearc fold belts in and around the arc-arc crossing area in central Japan Yujiro Ogawa https://doi.org/10.1144/GSL.SP.1982.010.01.03 Forearc geological structure of the Japanese Islands Tsunemasa Shiki and Yoshibumi Misawa https://doi.org/10.1144/GSL.SP.1982.010.01.04 Central America Facies belts of the Middle America Trench and forearc region, southern Mexico: results from Leg 66 DSDP J. Casey Moore, Joel S. Watkins, Kenneth J. McMillen, Stephen B. Bachman, Jeremy K. Leggett, Neil Lundberg, Thomas H. Shipley, Jean-Francois Stephan, Floyd W. Beghtel, Arif Butt, Borys M. Didyk, Nobuaki Niitsuma, Les E. Shephard, and Herbert Stradner https://doi.org/10.1144/GSL.SP.1982.010.01.05 Tectonic processes along the Middle America Trench inner slope Thomas H. Shipley, John W. Ladd, Richard T. Buffler, and Joel S. Watkins https://doi.org/10.1144/GSL.SP.1982.010.01.06 Sedimentation in different tectonic environments of the Middle America Trench, southern Mexico and Guatemala Kenneth J. McMillen, Robert H. Enkeboll, J. Casey Moore, Thomas H. Shipley, and John W. Ladd https://doi.org/10.1144/GSL.SP.1982.010.01.07 A summary of Deep Sea Drilling Project Leg 67 shipboard results from the Mid-America Trench transect off Guatemala Roland von Huene, Jean Aubouin, Jacques Azema, Grant Blackinton, Jerry A. Carter, William T. Coulbourn, Darrel S. Cowan, Joseph A. Curiale, Carlos A. Dengo, Richard W. Faas, William Harrison, Reinhard Hesse, Donald M. Hussong, John W. Ladd, … View all authors https://doi.org/10.1144/GSL.SP.1982.010.01.08 Evolution of the slope landward of the Middle America Trench, Nicoya Peninsula, Costa Rica Neil Lundberg https://doi.org/10.1144/GSL.SP.1982.010.01.9 South America Cenozoic structure, stratigraphy and tectonics of the central Peru forearc L. D. Kulm, T. M. Thornburg, and H.-J. Schrader J. M. Resig https://doi.org/10.1144/GSL.SP.1982.010.01.10 Forearc and other basins, continental margin of northern and southern Peru and adjacent Ecuador and Chile R. Moberly, G. L. Shepherd, and W. T. Coulbourn https://doi.org/10.1144/GSL.SP.1982.010.01.11 The geology of the western part of the Borbón Basin, North-west Ecuador C. D. R. Evans and J. E. Whittaker https://doi.org/10.1144/GSL.SP.1982.010.01.12 Aleutians Ancient plate boundaries in the Bering Sea region M. S. Marlow, A. K. Cooper, D. W. Scholl, and H. McLean https://doi.org/10.1144/GSL.SP.1982.010.01.13 The Chugach Terrane, a Cretaceous trench-fill deposit, southern Alaska Tor H. Nilsen and Gian G. Zuffa https://doi.org/10.1144/GSL.SP.1982.010.01.14 Structural evolution of coherent terranes in the Ghost Rocks Formation, Kodiak Island, Alaska Tim Byrne https://doi.org/10.1144/GSL.SP.1982.010.01.15 Asia and Australasia Sedimentation in the Sunda Trench and forearc region Gregory F. Moore, Joseph R. Curray, and Frans J. Emmel https://doi.org/10.1144/GSL.SP.1982.010.01.16 Development of the North Island Subduction System, New Zealand Gerrit J. van der Lingen https://doi.org/10.1144/GSL.SP.1982.010.01.17 Atlantic The Barbados Ridge Complex: tectonics of a mature forearc system G. K. Westbrook https://doi.org/10.1144/GSL.SP.1982.010.01.18 Sedimentology and structure of the Scotland Group, Barbados C. J. Pudsey and H. G. Reading https://doi.org/10.1144/GSL.SP.1982.010.01.19 Subduction and tectonics on the continental margin off northern Spain: observations with the submersible Cyana Jacques-André Malod, Gilbert Boillot, Claude Lepvier, Georges Mascle, and Josette Taugourdeau-Lantz Raymond Capdevila, Pierre-Alain Dupeuble, and Carla Müller https://doi.org/10.1144/GSL.SP.1982.010.01.20 Mediterranean Subduction in the Hellenic Trench: probable role of a thick evaporitic layer based on Seabeam and submersible studies X. Le Pichon, P. Huchon, J. Angelier, N. Lybéris, J. Boulin, and D. Bureau J.P. Cadet, J. Dercourt, G. Glaçon, H. Got, D. Karig, J. Mascle, L.E. Ricou, and F. Thiebault https://doi.org/10.1144/GSL.SP.1982.010.01.21 Detailed tectonic trends on the central part of the Hellenic Outer Ridge and in the Hellenic Trench System N. H. Kenyon, R. H. Belderson, and A. H. Stride https://doi.org/10.1144/GSL.SP.1982.010.01.22 The structure of the Calabro-Sicilian Arc: result of a post-orogenic intra-plate deformation Forese Carlo Wezel https://doi.org/10.1144/GSL.SP.1982.010.01.23 Makran of Iran and Pakistan Deformation of the Makran accretionary sediment prism in the Gulf of Oman (north-west Indian Ocean) Robert S. White https://doi.org/10.1144/GSL.SP.1982.010.01.24 The Late Cretaceous-Cenozoic history of western Baluchistan Pakistan—the northern margin of the Makran subduction complex Russell S. Arthurton, Abul Farah, and Wahiduddin Ahmed https://doi.org/10.1144/GSL.SP.1982.010.01.25 The Makran, Southeastern Iran: the anatomy of a convergent plate margin active from Cretaceous to Present G. J. H. McCall and R. G. W. Kidd https://doi.org/10.1144/GSL.SP.1982.010.01.26 California The Coastal Belt of the Franciscan: youngest phase of northern California subduction Steven B. Bachman https://doi.org/10.1144/GSL.SP.1982.010.01.27 The Franciscan Complex of northernmost California: sedimentation and tectonics K. R. Aalto https://doi.org/10.1144/GSL.SP.1982.010.01.28 Sedimentation, metamorphism and tectonic accretion of the Franciscan assemblage of northern California M. C. Blake, Jr, A. S. Jayko, and D. G. Howell https://doi.org/10.1144/GSL.SP.1982.010.01.29 Deformation of partly dewatered and consolidated Franciscan sediments near Piedras Blancas Point, California Darrel S. Cowan https://doi.org/10.1144/GSL.SP.1982.010.01.30 Initiation and evolution of the Great Valley forearc basin of northern and central California, U.S.A. Raymond V. Ingersoll https://doi.org/10.1144/GSL.SP.1982.010.01.31 Forearc Terranes in Orogenic Belts Cretaceous-Palaeogene Flysch Zone of the East Alps and Carpathians: identification and plate-tectonic significance of ‘dormant’ and ‘active’ deep-sea trenches in the Alpine-Carpathian Arc Reinhard Hesse https://doi.org/10.1144/GSL.SP.1982.010.01.32 The anatomy of a Lower Palaeozoic accretionary forearc: the Southern Uplands of Scotland J. K. Leggett W. S. McKerrow and D. M. Casey https://doi.org/10.1144/GSL.SP.1982.010.01.33 Sedimentology, volcanism, structure and metamorphism of the northern margin of a Lower Palaeozoic accretionary complex; Bail Hill-Abington area of the Southern Uplands of Scotland Barry C. Hepworth, Grahame J. H. Oliver, and Michael J. McMurtry https://doi.org/10.1144/GSL.SP.1982.010.01.34 Facies, Petrology and Models Sedimentary facies associations within subduction complexes Michael B. Underwood and Steven B. Bachman https://doi.org/10.1144/GSL.SP.1982.010.01.35 Composition of modern deep-sea sands from arc-related basins J. Barry Maynard, Renzo Valloni, and Ho-Shing Yu https://doi.org/10.1144/GSL.SP.1982.010.01.36 Initiation of subduction zones: implications for arc evolution and ophiolite development D. E. Karig https://doi.org/10.1144/GSL.SP.1982.010.01.37
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 4
    Journal available for loan
    Journal available for loan
    Tübingen : Mohr Siebeck ; 1.1884 - 48.1931; N.F. 1.1932/33 - 10.1943/44(1945),3; 11.1948/49(1949) -
    Call number: ZS 22.95039
    Type of Medium: Journal available for loan
    Pages: Online-Ressource
    ISSN: 1614-0974 , 0015-2218 , 0015-2218
    Language: German , English
    Note: N.F. entfällt ab 57.2000. - Volltext auch als Teil einer Datenbank verfügbar , Ersch. ab 2000 in engl. Sprache mit dt. Hauptsacht.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    Monograph available for loan
    Monograph available for loan
    Cambridge, Mass. [u.a.] : MIT Press
    Call number: PIK B 020-16-89772
    Type of Medium: Monograph available for loan
    Pages: XXVII, 1064 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 0262232588 (hbk.) , 9780262232586
    Language: English
    Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    Monograph available for loan
    Monograph available for loan
    University Park, Pa : Pennsylvania State University Press
    Call number: IASS 16.90520
    Description / Table of Contents: "An interdisciplinary study of democratic theory, empirical political science, psychology, and philosophy. Proposes a multidimensional process model of empathy that incorporates both affective and cognitive features to demonstrate the importance of empathy in fulfilling democracy's promise of giving equal consideration to all citizens in collective decisions"--Provided by publisher
    Type of Medium: Monograph available for loan
    Pages: viii, 221 S. , graph. Darst.
    ISBN: 9780271036595 (cloth) , 9780271036601 (pbk)
    Language: English
    Note: The democratic promiseThe deliberative turn in democratic theory -- The elusive concept of empathy -- Empathy in deliberative theory -- Empathy's importance : the empirical evidence -- Deliberative democracy and its critics -- Empathy and democracy..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Monograph available for loan
    Monograph available for loan
    Princeton and Oxford : Princeton University Press,
    Call number: M 17.90645
    Description / Table of Contents: Cover; Title; Copyright; Contents; List of Illustrations; Preface; PART ONE: What Has Controlled Earth's Climate?; CHAPTER ONE: Climate and Human History; PART TWO: Nature in Control; CHAPTER TWO: Slow Going for a Few Million Years; CHAPTER THREE: Linking Earth's Orbit to Its Climate; CHAPTER FOUR: Orbital Changes Control Ice-Age Cycles; CHAPTER FIVE: Orbital Changes Control Monsoon Cycles; CHAPTER SIX: Stirrings of Change; PART THREE: Humans Begin to Take Control; CHAPTER SEVEN: Early Agriculture and Civilization; CHAPTER EIGHT: Taking Control of Methane
    Description / Table of Contents: CHAPTER NINE: Taking Control of CO[sub(2)]CHAPTER TEN: Have We Delayed a Glaciation?; CHAPTER ELEVEN: Challenges and Responses; PART FOUR: Disease Enters the Picture; CHAPTER TWELVE: But What about Those CO[sub(2)] "Wiggles"?; CHAPTER THIRTEEN: The Horsemen of the Apocalypse: Which One?; CHAPTER FOURTEEN: Pandemics, CO[sub(2)], and Climate; PART FIVE: Humans in Control; CHAPTER FIFTEEN: Greenhouse Warming: Tortoise and Hare; CHAPTER SIXTEEN: Future Warming: Large or Small?; CHAPTER SEVENTEEN: From the Past into the Distant Future; EPILOGUE; CHAPTER EIGHTEEN: Global-Change Science and Politics
    Description / Table of Contents: CHAPTER NINETEEN: Consuming Earth's GiftsAfterword to the Princeton Science Library Edition; Bibliography; Figure Sources; Index; A; B; C; D; E; F; G; H; I; K; L; M; N; O; P; R; S; T; U; V; W; Y
    Description / Table of Contents: The impact on climate from 200 years of industrial development is an everyday fact of life, but did humankind''s active involvement in climate change really begin with the industrial revolution, as commonly believed? Plows, Plagues, and Petroleum has sparked lively scientific debate since it was first published--arguing that humans have actually been changing the climate for some 8,000 years--as a result of the earlier discovery of agriculture. The ""Ruddiman Hypothesis"" will spark intense debate. We learn that the impact of farming on greenhouse-gas levels, thousands of years before the i
    Type of Medium: Monograph available for loan
    Pages: xiv, 226 Seiten , Illustrationen
    Edition: New Princeton Science Library edition
    ISBN: 9780691173214
    Series Statement: Princeton Science Library
    Classification:
    Meteorology and Climatology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    Monograph available for loan
    Monograph available for loan
    Basingstoke, England : Palgrave Macmillan
    Call number: PIK B 160-16-90200
    Description / Table of Contents: This updated and revised edition outlines strategies and models for how to use technology and knowledge to improve performance, create jobs and increase income. It shows what skills will be required to produce, sell and manage performance over time, and how manual jobs can contribute to reduce the consumption of non-renewable resources
    Type of Medium: Monograph available for loan
    Pages: XXIII, 349 Seiten , graph. Darst.
    Edition: 2nd edition
    ISBN: 0230584667 (hbk.) , 9781349369195 (pbk.) , 9780230584662 (hbk.)
    Language: English
    Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Monograph available for loan
    Monograph available for loan
    Paris : OECD
    Call number: PIK P 113-10-0202
    Description / Table of Contents: This joint IEA/NEA report on electricity generating costs presents the latest data available for a wide variety of fuels and technologies, including coal and gas (with and without carbon capture), nuclear, hydro, onshore and offshore wind, biomass, solar, wave and tidal as well as combined heat and power (CHP).  It provides levelised costs of electricity (LCOE) per MWh for almost 200 plants, based on data covering 21 countries (including four major non-OECD countries), and several industrial companies and organisations.  For the first time, the report contains an extensive sensitivit
    Type of Medium: Monograph available for loan
    Pages: 215 S. : graph. Darst.
    ISBN: 9789264084308
    Language: English
    Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    Call number: 3/S 07.0034(2016)
    In: Annual report
    Type of Medium: Monograph available for loan
    Pages: 51 Seiten
    ISSN: 1865-6439 , 1865-6447
    Parallel Title: Erscheint auch als Annual report ... / Helmholtz Association of German Research Centres
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
  • 13
  • 14
    Keywords: nuclear explosion monitoring ; nuclear test ban ; seismology ; acoustics
    Description / Table of Contents: This topical volume focuses on the most recent advances that have been achieved in relevant fields of research of nuclear test ban monitoring, including seismology, infrasound- and hydro-acoustics, as well as nuclear physics and atmospheric backtracking. This research has been presented during the special sessions on "Research and Development in Nuclear Explosion Monitoring" convened during the 2007 and 2008 General Assemblies of the European Geosciences Union (EGU). The special sessions were introduced after the Preparatory Commission for the Comprehensive Nuclear Test-Ban Treaty Organization (CTBTO Prepcom) had convened a scientific symposium in 2006 on "CTBT: Synergies with Science 1996-2006 and beyond" marking the tenth anniversary of the United Nations General Assembly’s adoption of the CTBT Treaty. With regard to the seismo-acoustic fields several papers provide important updates on advances made in these fields since publication of ‘Monitoring the Comprehensive Nuclear-Test-Ban Treaty’ (see PAGEOPH topical volumes 158-159, 2001-2002). Moreover, this topical volume expands on these publications by including radionuclide and noble gas monitoring, as well as atmospheric transport modeling. In these two areas, significant progress has been made in recent years. Two papers studying the 2006 North Korean nuclear test elucidate how progress made in the relevant fields has allowed for a good understanding on the characteristics of this underground nuclear test.
    Pages: Online-Ressource (246 Seiten)
    ISBN: 9783034603706
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Unknown
    Basel, Boston, Berlin : Birkhäuser
    Keywords: engineering ; geophysics ; mining ; monitoring technology ; seismic monitoring ; seismic tomography ; seismology ; stress re-distribution
    Description / Table of Contents: Stress re-distribution as a result of exploitation of mineral, hydrocarbon, geothermal, and water resources cannot be eliminated. The effort must be directed to a better understanding of the underlying processes for the management of the hazard and risk associated with these operations. The study of induced seismicity has continually evolved over the past couple of decades, as underlined by both the number and complexity of applied studies required to satisfy the increased economic demands, assure the safety of the workforce and equipment, and protect the environment. A considerable effort has been put into the development of passive monitoring technology, specialized products and services being available for a wide range of applications. The recording of substantial high quality seismic data has stimulated the work on theoretical and practical aspects related to these applications, involving not only seismological knowledge, but also elements of rock mechanics, and an understanding of mining, geotechnical, and petroleum engineering. Pure and Applied Geophysics has largely contributed to raising the profile of induced seismicity research and its credibility. The range of specific analyses included in the present collection of studies expresses how powerful and resourceful passive seismic monitoring has become to so many applications. Seismic data are routinely evaluated for a series of development activities specific to each application. Engineering practice is continually improved based on trials and analyses of the ground response and stress levels, confirmed through the monitoring of seismicity. We are better equipped than ever to provide management decisions based on formalized, quantitative, and thus objective assessment.
    Pages: Online-Ressource (213 Seiten)
    ISBN: 9783034603058
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
  • 18
  • 19
  • 20
  • 21
    Unknown
    Berlin ; Heidelberg : Springer
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
    Unknown
    Berlin ; Heidelberg : Springer
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 24
    Unknown
    Basel, Boston, Berlin : Birkhäuser
    Keywords: fault surfaces ; fault zones
    Description / Table of Contents: Considerable progress has been made recently in quantifying geometrical and physical properties of fault surfaces and adjacent fractured and granulated damage zones in active faulting environments. There has also been significant progress in developing rheologies and computational frameworks that can model the dynamics of fault zone processes. This volume provides state-of-the-art theoretical and observational results on the mechanics, structure and evolution of fault zones. Subjects discussed include damage rheologies, development of instabilities, fracture and friction, dynamic rupture experiments, and analyses of earthquake and fault zone data.
    Pages: Online-Ressource (381 Seiten)
    ISBN: 9783034601375
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Keywords: poverty reduction ; governance ; social justice ; energy efficiency ; social protection ; vulnerability ; climate ; climate change ; global warming ; emissions ; carbon ; equity ; renewable energy ; forest
    Description / Table of Contents: Climate change is arguably the most profound challenge facing the international community in the 21st century. It is as much a challenge for poverty reduction, growth, and development as it is a global environmental issue. Climate change could undermine or reverse progress in reducing poverty and attaining the Millennium Development Goals, thereby unraveling many of the development gains of recent decades. It already threatens the livelihoods, health, and well-being of millions of people worldwide, particularly the poorest, most vulnerable groups. This book focuses attention on these previously neglected and poorly understood social dimensions of climate change. It highlights equity and vulnerability as central organizing themes and illustrates the multiple ways that pro-poor climate policy and action should be integrated into existing approaches to poverty reduction and development—from the local to the global levels. This integration is needed both in terms of pro-poor approaches to climate change adaptation and in terms of better managing the social risks and potential benefits associated with measures to reduce greenhouse gas emissions.
    Pages: Online-Ressource (XXIII, 319 Seiten)
    ISBN: 9780821381427
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    Keywords: greenhouse gas emission reduction ; energy consumption ; bus ; greenhouse gas emission ; rapid transit ; pedestrian ; pedestrian pathway ; climate change ; transportation network ; road pricing ; emission ; urban transportation ; travel demand ; rebates ; greenhouse gas ; road ; transport ; transport sector ; transit ; travel demand management
    Description / Table of Contents: The Eco2 Cities approach is a point of departure for cities that would like to reap the many benefits of ecological and economic sustainability. It provides an analytical and operational framework that offers strategic guidance to cities on sustainable and integrated urban development. At the same time case studies are used throughout the book to provide a matter-of-fact and ground-level perspective. The Eco2 framework is flexible and easily customized to the context of each country or city. Based on the particular circumstances and the development priorities of a city - the application of the framework can contribute to the development of a unique action plan or roadmap in each case. This action plan can be triggered through catalyst projects.To support this framework, the book also begins to introduce some powerful and practical methods and tools that can further enable sustainable and integrated city planning and decision making. These include 1) operational and process methods that can strengthen collaborative decision making and cross-sector synergies in a city; 2) analytical methods ranging from diagnostics, simulation, design and scenario-generation; and 3) accounting and benchmarking methods which can help clarify, define and measure what it means to truly invest in sustainability and resilience.As additional reference reading, the book also features a series of case studies from best practice cities around the world, each demonstrating a very different dimension of the Eco2 approach. It also features a series of infrastructure sector notes (on spatial development, transport, energy, water and waste management), each of which explore sector specific issues as they pertain to urban development, and the many opportunities for coordination and integration across sectors.
    Pages: Online-Ressource (XXVIII, 358 Seiten)
    ISBN: 9780821381441
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Keywords: markets ; growth ; development strategy ; public expenditures ; inequality ; government ; developing countries ; poverty ; economic policy ; competitiveness
    Description / Table of Contents: The global financial crisis of 2008–09 did not just change the global economic order. It also changed the way we think about that order. Principles and practices that were once accepted wisdom are now in doubt or discredited. New, fundamental questions opened. And the search for answers has barely begun. For the developing world, that conceptual uncertainty is particularly uncomfortable—through a mix of good policies and good luck, they had begun to achieve real progress. Will all that now be derailed? What does the new horizon bring to them? Can they find new policy ideas that will turn the shock of the crisis into a final run toward "developed" status? How does the future look when seen from various geographic regions? Those are the kind of questions that we asked, in the summer of 2010, to some 40 development professionals working at the World Bank. This book is an unfiltered collection of their views. As seasoned practitioners in the leading development institution, they have a unique perspective from which to visualize, we would dare say "to sense", what may be coming. Some of them look at the big picture of the role that the developing world is about to play, and how it will play it. Others walk us through the conceptual links around specific issues that will affect that world—say, the likely evolution of macro-financial regulation. And others take us to continents and countries, teach us about their realities, and tell us how things will differ in the coming years. Put together, they paint a picture of reasoned optimism.
    Pages: Online-Ressource (XX, 443 Seiten)
    ISBN: 9780821385463
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    Description / Table of Contents: Our understanding of calcium carbonate precipitation within freshwater carbonate systems is being revolutionized by new quantitative approaches at both field and laboratory scale. These systems cover a diverse range of topical research areas including tufas, speleothems, stromatolites and microbial processes. Progress by various international research groups has been impressive, with major contributions to such areas as climate change, absolute dating, carbon sequestration, and biofilm construction and precipitation. A diverse sample of interrelated research is presented that provides a tantalizing glimpse of the interplay between microbial, geochemical and physical processes that control the development of tufas and speleothems. This volume will provide a cross-disciplinary platform that will stimulate further exchanges about new concepts, methodologies and interpretations associated with freshwater carbonates. In particular, it will help reinforce the importance of cross-discipline research: the driving force behind the new field of Geobiology.
    Pages: Online-Ressource (VI, 362 Seiten)
    ISBN: 9781862393011
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
    Unknown
    London : The Geological Society
    Description / Table of Contents: The Mesozoic Era begins with the approximately 50-million-year-long Triassic Period, a major juncture in Earth history when the vast Pangaean supercontinent completed its assembly and began its fragmentation, and the global biota diversified and modernized after the end-Permian mass extinction, the most extensive biotic decimation of the Phanerozoic. The temporal ordering of geological and biotic events during Triassic time thus is critical to the interpretation of some unique and pivotal events in Earth history. This temporal ordering is mostly based on the Triassic timescale, which has been developed and refined for nearly two centuries. This book reviews the state of the art of the Triassic timescale and includes comprehensive analyses of Triassic radio-isotopic ages, magnetostratigraphy, isotope-based and cyclostratigraphic correlations and timescale -relevant marine and non-marine biostratigraphy.
    Pages: Online-Ressource (514 Seiten) , Illustrationen, Diagramme, Karten
    ISBN: 9781862392960
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 30
    Description / Table of Contents: This volume contains a collection of stratigraphic and diagenetic case studies of Mesozoic and Cenozoic carbonate sequences from the Tethyan realm. High levels of industry and academic interest in the region have generated numerous multi-disciplinary studies of these sequences, a selection of which are presented in this volume. The studies presented are based on both comprehensive subsurface datasets from important hydrocarbon-bearing strata of the Middle East and the excellent surface exposures in the region of interest. The studies presented in this volume may serve as suitable starting points in the development of age and architecture specific carbonate reference models. Such models can form the basis of internally consistent models for carbonate deposition, sequence development and reservoir performance. Ideally such models, suitably scaled, will be equally applicable to academic studies, the exploration and development phases of the field life cycle and in the prediction of future reservoir performance.
    Pages: Online-Ressource (422 Seiten)
    ISBN: 9781862392922
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 31
    Description / Table of Contents: Reservoir compartmentalization - the segregation of a petroleum accumulation into a number of individual fluid/pressure compartments - controls the volume of moveable oil or gas that might be connected to any given well drilled in a field, and consequently impacts ‘booking’ of reserves and operational profitability. This is a general feature of modern exploration and production portfolios, and has driven major developments in geoscience, engineering and related technology. Given that compartmentalization is a consequence of many factors, an integrated subsurface approach is required to better understand and predict compartmentalization behaviour, and to minimize the risk of it occurring unexpectedly. This volume reviews our current understanding and ability to model compartmentalization. It highlights the necessity for effective specialist discipline integration, and the value of learning from operational experience in: detection and monitoring of compartmentalization; stratigraphic and mixed-mode compartmentalization; and fault-dominated compartmentalization.
    Pages: Online-Ressource (VI, 362 Seiten)
    ISBN: 9781863293165
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Keywords: licensing of petroleum exploration, development and production rights ; petroleum licensing rounds ; petroleum exploration ; allocation of petroleum exploration, development and production rights ; maximization of petroleum rent ; fiscal systems for hydrocarbons ; design of petroleum allocation systems ; petroleum policy ; petroleum depletion policy ; auctions of petroleum rights
    Description / Table of Contents: Governments often pursue a variety of economic, social and political objectives through their allocation policies that go beyond the maximization of the net present value of the economic rent. The optimal allocation policy depends on a range of country specific and exogenous factors. Despite the variety of factors influencing optimal design, most countries use similar solutions. In particular, when auctions or administrative procedures are used, most governments opt for simple simultaneous multi-object sealed-bid rounds. While this may appear to be paradoxical, there is a practical explanation. It is true that more complex bidding forms might increase rent capture at bidding. However, the potential marginal gain is often limited, owing to most E&P projects’ high level of uncertainty and risk. In addition market mechanisms, such as joint bidding and secondary markets, and the fiscal regime are widely used in the petroleum sector to correct inefficiency at the time of allocation.
    Pages: Online-Ressource (XIV, 106 Seiten)
    ISBN: 9780821381687
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Unknown
    Berlin, New York : De Gruyter Saur
    Description / Table of Contents: Unter Bibliothek 2.0 verstehen die Herausgeber eine Einrichtung, die die Prinzipien des Web 2.0 wie Offenheit, Wiederverwendung (ReUse), Kollaboration und Interaktion in der Gesamtorganisation anwendet. Bibliotheken erweitern Serviceangebote und Arbeitsabläufe um die Möglichkeiten der Web 2.0-Technologien. Dies verändert Berufsbild und Selbstverständnis der Bibliothekare. Der Sammelband bietet einen kompletten Überblick zum Thema Bibliothek 2.0 und den aktuellen Stand der Entwicklungen aus technologischer, soziologischer, informationstheoretischer sowie praxisorientierter Sicht.
    Pages: Online-Ressource (XII, 393 Seiten)
    ISBN: 9783110232103
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Description / Table of Contents: Echinoderms are a vast group of spiny-skinned animals including starfish, brittle-stars, sea urchins, sand dollars, feather stars, sea lilies and sea cucumbers. These relatives of chordates and hemichordates have inhabited the world’s oceans for more than 500 million years. Modern members of the Echinodermata are, with over 7 000 species, an integral part of marine communities from the intertidal to the deep sea. Echinoderms play a major ecological role in marine habitats and are of economic importance in fisheries, aquaculture and biomedicine. The present volume contains the abstracts of lectures and posters presented during the 7th European Conference on Echinoderms (ECE) as well as excursion guides. This year’s conference was held at the northern campus of the Georg-August University in Göttingen, Germany, from October 2-9, 2010. More than 100 biologists, palaeontologists and other scientists from 25 countries participated.
    Pages: Online-Ressource (145 Seiten)
    ISBN: 9783941875685
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Keywords: carbon emission ; low-carbon economy ; greenhouse gas ; CO2
    Description / Table of Contents: Companies are increasingly aware of the need to address climate change. However, while many companies are taking action to address climate change, many others are still lagging behind. This report surveys responsible business practices addressing climate change and driving the shift to a low-carbon economy. It summarises policies, regulations and other instruments in support of a low-carbon economy in OECD countries and emerging economies, and analyses corporate responses to these drivers. Using the principles of responsible business conduct identified in the OECD Guidelines for Multinational Enterprises, this report reviews three key areas of corporate action: accounting for greenhouse gas emissions; achieving emissions reductions; and engaging suppliers, consumers and other stakeholders.
    Pages: Online-Ressource (113 Seiten)
    ISBN: 9789264090231
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Keywords: natural hazards ; disasters ; economics ; emergency management
    Description / Table of Contents: This report synthesizes knowledge about the effects of natural hazards on human welfare, particularly in its economic aspects. It is a remarkable combination of case studies, data on many scales, and the application of economic principles to the problems posed by earthquakes, abnormal weather, and the like. It provides a deep understanding of the relative roles of the market, government intervention, and social institutions in determining and improving both the prevention and the response to hazardous occurrences. The report looks at disasters primarily through an economic lens. Economists emphasize self-interest to explain how people choose the amount of prevention, insurance, and coping. But lenses can distort as well as sharpen images, so the report also draws from other disciplines: psychology to examine how people may misperceive risks, political science to understand voting patterns, and nutrition science to see how stunting in children after a disaster impairs cognitive abilities and productivity as adults much later. Peering into the future, the report shows that growing cities will increase exposure to hazards, but that vulnerability will not rise if cities are better managed. The intensities and frequencies of hazards in the coming decades will change with the climate, and the report examines this complicated and contentious subject, acknowledging all the limitations of data and science.
    Pages: Online-Ressource (XX, 254 Seiten) , Illustrationen, Diagramme, Karten
    ISBN: 9780821381410
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    Unknown
    Berlin ; Heidelberg : Springer
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
  • 39
    Unknown
    Berlin ; Heidelberg : Springer
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
  • 41
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
  • 44
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
  • 46
  • 47
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    Description / Table of Contents: This wide area of the Alpine–Himalayan belt evolved through a series of tectonic events related to the opening and closure of the Tethys Ocean. In doing so it produced the largest mountain belt of the world, which extends from the Atlantic to the Pacific oceans. The basins associated with this belt contain invaluable information related to mountain building processes and are the locus of rich hydrocarbon accumulations. However, knowledge about the geological evolution of the region is limited compared to what they offer. This has been mainly due to the difficulty and inaccessibility of cross-country studies. This Special Publication is dedicated to the part of the Alpine–Himalayan belt running from Bulgaria to Armenia, and from Ukraine to the Arabian Platform. It includes twenty multidisciplinary studies covering topics in structural geology/tectonics; geophysics; geochemistry; palaeontology; petrography; sedimentology; stratigraphy; and subsidence and lithospheric modelling. This volume reports results obtained during the MEBE (Middle East Basin Evolution) Programme and related projects in the circum Black Sea and peri-Arabian regions.
    Pages: Online-Ressource (VII, 509 Seiten)
    ISBN: 9781862393080
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    Unknown
    Berlin [u.a.] : Springer
    Keywords: constructive approximation ; differential equations ; geomathematics ; inverse problems ; mathematical modelling ; number theory ; numerical methods ; potential theory
    Description / Table of Contents: During the last three decades geosciences and geo-engineering were influenced by two essential scenarios: First, the technological progress has changed completely the observational and measurement techniques. Modern high speed computers and satellite based techniques are entering more and more all geodisciplines. Second, there is a growing public concern about the future of our planet, its climate, its environment, and about an expected shortage of natural resources. Mathematics concerned with geoscientific problems, i.e., Geomathematics, is becoming increasingly important. The "Handbook of Geomathematics" as a central reference work in this area comprises the following scientific fields: (I) observational and measurement key technologies; (II) modelling of the system Earth (geosphere, cryosphere, hydrosphere, atmosphere, biosphere); (III) analytic, algebraic, and operator-theoretic methods; (IV) statistical and stochastic methods; (V) computational and numerical analysis methods; (VI) historical background and future perspectives.
    Pages: Online-Ressource (XIX, 1350 Seiten)
    ISBN: 9783642015465
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    Unknown
    Berlin ; Heidelberg : Springer
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
  • 52
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 53
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
  • 55
  • 56
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
  • 58
  • 59
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
  • 61
  • 62
    Description / Table of Contents: Limestone is a highly successful and widely used building material, found in many important historic buildings and new monuments around the world. Whilst its success reflects its durability under a wide range of environmental conditions, there are still important questions surrounding the selection, use and conservation of building limestones. In order to make best use of new limestone today, and to conserve old limestone most effectively, we need to bring modern research methods to bear on understanding the characteristics of different limestones, what mortars to use, and how key limestones have responded to polluted atmospheres. This volume brings together recent inter-disciplinary research on these issues, illustrating the diversity of innovative techniques that are now being applied to furthering our understanding of building limestones.
    Pages: Online-Ressource (VII, 257 Seiten)
    ISBN: 9781862392946
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Unknown
    Washington, D.C. : The World Bank
    Keywords: emission scenarios ; colors ; vegetative cover ; oceans ; energy efficiency ; greenhouse gas ; temperature anomalies ; temperature ; emission ; greenhouse gas emissions ; carbon ; low-carbon ; climate change ; carbon cycle ; ecosystem ; ipcc ; greenhouse ; climate ; carbon dioxide ; chlorophyll concentration
    Description / Table of Contents: Today's enormous development challenges are complicated by the reality of climate change�the two are inextricably linked and together demand immediate attention. Climate change threatens all countries, but particularly developing ones. Understanding what climate change means for development policy is the central aim of the World Development Report 2010. It explores how public policy can change to better help people cope with new or worsened risks, how land and water management must adapt to better protect a threatened natural environment while feeding an expanding and more prosperous population, and how energy systems will need to be transformed.The report is an urgent call for action, both for developing countries who are striving to ensure policies are adapted to the realities and dangers of a hotter planet, and for high-income countries who need to undertake ambitious mitigation while supporting developing countries efforts. A climate-smart world is within reach if we act now to tackle the substantial inertia in the climate, in infrastructure, and in behaviors and institutions; if we act together to reconcile needed growth with prudent and affordable development choices; and if we act differently by investing in the needed energy revolution and taking the steps required to adapt to a rapidly changing planet.In the crowded field of climate change reports, WDR 2010 uniquely: -- emphasizes development -- takes an integrated look at adaptation and mitigation -- highlights opportunities in the changing competitive landscape and how to seize them -- proposes policy solutions grounded in analytic work and in the context of the political economy of reform
    Pages: Online-Ressource (XXI, 417 Seiten)
    ISBN: 9780821379882
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
    Description / Table of Contents: Fjords are glacially over-deepened, semi-enclosed marine basins, but are often neglected as a sedimentary realm. They represent the transition from the terrestrial to the marine environment and as such have the potential to preserve evidence of environmental change. Typically most fjords have been glaciated a number of times and some high-latitude fjords still possess a resident glacier. The stratigraphic record in fjords largely preserves a glacial–deglacial cycle of deposition. Sheltered water and high sedimentation rates potentially make fjords ideal depositional environments for preserving continuous records of climate and environmental change with high temporal resolution. Fjords are also referred to as miniature oceans providing the unique opportunity to study marine processes in great detail. With predictions of warming climates, changing ocean circulation and rising sea levels, this volume is a timely look at these environmentally sensitive coastlines.
    Pages: Online-Ressource (VII, 380 Seiten)
    ISBN: 9781862393127
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 65
    Description / Table of Contents: Elevation data are a critical element in most geoscience applications. From geological mapping to modelling Earth systems and processes geologists need to understand the shape of the Earth's surface. Vast amounts of digital elevation data exist, from large-scale global to smaller scale regional datasets, and many datasets have been merged to improve scale and accuracy. For each application, decisions are made on which elevation data to use driven by cost, resolution and accuracy. This publication shows the current status of available digital elevation data and illustrates the key applications. The types of data assessed include: ASTER stereo satellite imagery, Shuttle Radar Topographic Mapping data, airborne laser and radar such as NEXTMap, and Multibeam Bathymetry. Applications covered include: glacial deposits, landslides, coastal erosion and other geological hazards. Technical issues discussed include: accuracy analysis, derived product creation, software comparisons and copyright considerations. This volume is a comprehensive look at elevation models for geoscience.
    Pages: Online-Ressource (148 Seiten)
    ISBN: 978186239313
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Description / Table of Contents: Einen Überblick für Einsteiger, die ihr gedrucktes Kulturgut durch Digitalisierung schützen und zugänglich machen möchten, bietet dieses Handbuch. Es stellt die einzelnen Phasen des Digitalisierungsprozesses vor und liefert weitere, ergänzende Informationen für die detaillierte Beschäftigung mit diesem Thema.
    Pages: Online-Ressource (116 Seiten)
    ISBN: 9783935656408
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    facet.materialart.
    Unknown
    Washington, D.C. : The World Bank ; Collins Bartholomew
    Description / Table of Contents: The World Bank eAtlas of the Millennium Development Goals lets you visualize and map the indicators that measure progress toward the Goals, with clear explanations of each Goal and its related Targets as the context. When you select an indicator, the eAtlas creates a world map keyed to that indicator, with country rankings and data in your choice of tables or graphs. You can pan or zoom to view different countries or regions, view the dynamic change in that map with a time series, compare two maps and sets of data, and do much more.
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Description / Table of Contents: Climate change is likely to have significant impacts on the agricultural sector to which farmers will have to adapt. While agriculture is a significant contributor to greenhouse gas emissions, it is also a source of carbon storage in soils. This report examines the economic and policy issues related to the impacts of climate change on agriculture and adaptation responses and to the mitigation of greenhouse gases from agriculture. It outlines research undertaken and underway in other national and international research agencies. It also highlights some of the knowledge gaps on the impacts of climate change on food production and the uncertainties of those impacts in a global context that warrant further research efforts. In particular, the report analyzes marginal abatement cost curves, which show the relative costs of achieving reductions in greenhouse gas emission through the implementation of different actions in the agricultural sector. The aim of the report is to help guide policy makers in the design of policies to address climate change issues in agriculture.
    Pages: Online-Ressource (135 Seiten)
    ISBN: 9789264086876
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    Description / Table of Contents: The discovery of dinosaurs and other large extinct ‘saurians’ - a term under which the Victorians commonly lumped ichthyosaurs, plesiosaurs, pterosaurs and their kin - makes exciting reading and has caught the attention of palaeontologists, historians of science and the general public alike. The papers in this collection go beyond the familiar tales about famous ‘fossil hunters’ and focus on relatively little-known episodes in the discovery and interpretation (from both a scientific and an artistic point of view) of dinosaurs and other inhabitants of the Mesozoic world. They cover a long time span, from the beginnings of ‘modern’ scientific palaeontology in the 1700s to the present, and deal with many parts of the world, from the Yorkshire coast to Central India, from Bavaria to the Sahara. The characters in these stories include professional palaeontologists and geologists (some of them well-known, others quite obscure), explorers, amateur fossil collectors, and artists, linked together by their interest in Mesozoic creatures.
    Pages: Online-Ressource (394 Seiten)
    ISBN: 9781862393110
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Description / Table of Contents: Several different databases and models have been developed over many years of petrological study carried out by several European and non-European groups on mantle xenoliths, peridotite massifs, ophiolites and mafic magmas spanning in age from Archaean to Recent times. This volume aims to bring together these different approaches and to integrate the geochemical perceptions of the European upper mantle. The papers include regional petrological studies of the European lithospheric mantle, from Spain to the Pannonian Basin, from Corsica and Serbia as far north as Svalbard. Six contributions are based on studies of mantle xenoliths, while the remaining three deal with ophiolitic and peridotitic complexes. A further article provides an update on the textural classification of mantle rocks using a computer-aided approach and there is an introductory overview.
    Pages: Online-Ressource (246 Seiten)
    ISBN: 9781862393042
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Unknown
    Washington, D. C. : The World Bank
    Keywords: alternative energy ; sustainable forest management ; carbon finance ; carbon ; forests ; climate change ; biodiversity conservation ; emissions ; oceans ; silver ; colors ; carbon sinks ; carbon offsets ; climate ; ecosystem ; emissions from deforestation ; coral reefs ; carbon stores ; forest ; sustainable forest
    Description / Table of Contents: Global warming and changes in climate will have severe and lasting impacts on national efforts to alleviate poverty and promote sustainable development. Some of the world s poorest countries and communities are the most vulnerable and are already suffering the consequences. Yet often these countries are rich in natural capital, ecosystems, and biodiversity that can contribute to solutions as they can to climate change. Biodiversity is the foundation and mainstay of agriculture, forests, and fisheries. Biological resources provide the raw materials for livelihoods, agriculture, medicines, trade, tourism, and industry. Forests, grasslands, freshwater, and marine and other natural ecosystems provide a range of services, often not recognized in national economic accounts but vital to human welfare: regulating water flows and water quality, flood control, pollination, decontamination, carbon sequestration, soil conservation, and nutrient and hydrological cycling. Current efforts to address climate change focus mainly on reducing emissions of greenhouse gases, mainly through cleaner energy strategies, and on attempting to reduce vulnerability of the communities at risk by improving infrastructure to meet new energy and water needs. This book book sets out a compelling argument for including ecosystem-based approaches to mitigation and adaptation as a third essential pillar in national strategies to address climate change. Such ecosystem-based strategies can offer cost-effective, proven and sustainable solutions contributing to, and complementing, other national and regional adaptation strategies.
    Pages: Online-Ressource (XII, 114 Seiten)
    ISBN: 9780821381274
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    Keywords: oil spill ; valuation ; environmental degradation ; deforestation ; demolition and military waste ; air pollution ; middle east and north africa ; water degradation ; forest degradation ; land degradation
    Description / Table of Contents: How much is a cleaner environment worth? For policy makers, that question goes largely unanswered. It's not that the environment is seen as unimportant. It's simply much easier to compare the costs and benefits of tangible projects such as airports and electrical grids, than it is to weigh the merits of a landfill cleanup. Over the past decades, the World Bank has undertaken a systematic effort to put a monetary value on environmental degradation, which results sparked policy changes. This book brings together the best case studies of the Cost of Environmental Degradation undertaken in the Middle East and North Africa region and summarizes the major policy impacts at the national and regional levels. The case studies evaluate in monetary terms the annual damages caused by economic activities to natural resources and environment – water, forests, agricultural land, air quality, waste and coastal zone – and reflects the estimates as percentages of the countries’ gross domestic product. It then captures the estimated values in a holistic picture and illuminates their concrete implications on policy, investments, and institutions for the selected countries and for the region as a whole. In addition to being a multi-nation effort, the book stands out by applying updated methods and techniques to estimate natural resource damages both in times of peace and of conflict. This is particularly relevant for the Middle East and North Africa, a region located at the crossroads of different cultures, continents, and religions. This book is primarily targeted at policy makers at the regional, national and local levels and to decision makers in government agencies, NGOs, and natural resource development institutions. It is suitable for use in training courses of decision makers working in environment, forests and water related fields. The book should also be of interest to advanced undergraduates, master’s level students and undergraduates.
    Pages: Online-Ressource (XVIII, 168 Seiten)
    ISBN: 9780821383964
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
    Description / Table of Contents: The invasion of the land by plants (‘terrestrialization’) was one of the most significant evolutionary events in the history of life on Earth, and correlates in time with periods of major palaeoenvironmental perturbations. The development of a vegetation cover on the previously barren land surfaces impacted on the global biogeochemical cycles and the geological processes of erosion and sediment transport. The terrestrialization of plants preceded the rise of major new groups of animals, such as insects and tetrapods, the latter numbering some 24 000 living species, including ourselves. Early land-plant evolution also correlates with the most spectacular decline of atmospheric CO2 concentration of Phanerozoic times and with the onset of a protracted period of glacial conditions on Earth. This book includes a selection of papers covering different aspects of the terrestrialization, from palaeobotany to vertebrate palaeontology and geochemistry, promoting a multidisciplinary approach to the understanding of the co-evolution of life and its environments during Early to Mid-Palaeozoic times.
    Pages: Online-Ressource (187 Seiten)
    ISBN: 9781862393097
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 74
    Keywords: climate change mitigation ; emission reductions ; electricity ; energy efficiency ; energy policy ; emission ; climate change ; drought ; climate ; forests ; carbon dioxide ; low-carbon ; global greenhouse gas emissions ; emissions ; colors ; deforestation ; transport sector ; global greenhouse gas ; carbon dioxide mitigation
    Description / Table of Contents: Governments and civil society in Latin America and the Caribbean should be well informed about the potential costs and benefits of combating climate change, their policy options over the next decades, and the global context for these policy decisions. At the same time, the global community needs to be better informed about the unique perspective of the Latin American and Caribbean region: problems the region will face, its potential contributions toward combating global warming, and how to maximize this potential while continuing to maintain growth and reduce poverty. This book, a companion volume to Low Carbon, High Growth: Latin American Responses to Climate Change, seeks to help fill both these needs.
    Pages: Online-Ressource (XIV, 200 Seiten)
    ISBN: 9780821380819
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Description / Table of Contents: There is an increasing consensus in the scientific community that climate change is a real and present threat. Despite the large uncertainty on the timing, magnitude and even the direction of some of the physical and economic effects of this phenomenon, it is widely accepted that these effects will be regionally differentiated and that developing countries and lower income populations will tend to suffer the most. In this context, it is critical that Latin American and Caribbean countries develop their own strategies for adapting to the various impacts of climate change and for contributing to global efforts aimed at mitigation.\'Low Carbon, High Growth\' contributes to these efforts by addressing a number of questions related to the causes and consequences of climate change in Latin America. What are the likely impacts of climate change in the region? Which countries and regions will be most affected? What can governments do to tackle the challenges associated with adapting to climate change? What role can Latin America and the Caribbean play in the area of climate change mitigation? How can the international community best help the region respond? While the study does not attempt to provide definitive answers to these questions, its goal is to contribute new information and analysis to help inform the public policy debate on this important issue.
    Pages: Online-Ressource (XXI, 180 Seiten)
    ISBN: 9780821381328
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    Description / Table of Contents: The Zagros fold-thrust belt (ZFTB) extends from Turkey to the Hormuz Strait, resulting from the collision of the Arabian and Eurasian plates during Cenozoic times, and separates the Arabian platform from the large plateaux of central Iran. To the east a pronounced syntaxis marks the transition between the Zagros collision belt and the Makran accretionary wedge. In the ZFTB, the Proterozoic to Recent stratigraphic succession pile is involved in huge folds, and offers the opportunity to study the stratigraphic and tectonic evolution of the Palaeo-Tethyan margin. Few recent data were widely available on the southern Tethys margin preserved in the Zagros Mountains. The Middle East Basins Evolution (MEBE) program was an excellent opportunity to go back to the field and to collect new data to better constrain the evolution of this margin. In this volume the structure of the Zagros Mountains is explored through different scales and using different methodologies.
    Pages: Online-Ressource (VII, 360 Seiten)
    ISBN: 9781862392939
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    Unknown
    Berlin ; Heidelberg : Springer
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
  • 80
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Keywords: climate change ; gravity change ; isostasy ; tectonics ; volcanism ; deformation ; geodynamic process
    Description / Table of Contents: During the last decades, the monitoring and modelling of various geodynamic processes have gained ever increasing importance. In particular, temporal variations of the deformation and gravity fields recorded by new types of geodetic measuring techniques and reflecting isostatic, tectonic or volcanic processes in the earth's interior as well as climatologically induced changes on its surface have opened new avenues. The present volume succeeds a similar topical volume published in 2007 and reflects the most recent developments in these fields of research. Part of the papers in this book were presented at the second workshop on 'Deformation and Gravity Change: Indicators of Isostasy, Tectonics, Volcanism and Climate Change' that took place at the Casa de los Volcanes on Lanzarote, Spain, during March 27-30, 2007. It was jointly organized and supported by the International Association of Geodesy (IAG), the Spanish Ministry of Education and Science, the Spanish Council for Scientific Research and the Cabildo Insular de Lanzarote. The workshop also served as the second meeting of the members of the IAG Working Group ICCT2 on 'Dynamic Theories of Deformation and Gravity Fields'.
    Pages: Online-Ressource (373 Seiten)
    ISBN: 9783034601474
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Unknown
    Bonn : Galileo Press
    Keywords: Windows Server 2008 R2 ; Hyper-V ; Active Directory ; Remotedesktopdienste ; Webserver IIS ; Netzwerkprotokolle ; Kerberos-Authentifizierung
    Description / Table of Contents: Das lösungsorientierte und praktische Handbuch zum Windows Server 2008 R2 mit zahlreichen fundierten Hintergrundinformationen! Der Autor Ulrich B. Boddenberg greift bei der Beschreibung des Servers auf seine praktischen Erfahrungen in zahlreichen Projekten bei mittleren und großen Kunden zurück. Denn ein modernes Betriebssystem wie Windows Server 2008 R2 bietet weit mehr als nur die Möglichkeit, Programme auszuführen. Er beschreibt alle zentralen Technologien, wie die Virtualisierung mit Hyper-V, Active Directory, Terminaldienste und den Webserver IIS. Neben diesen konkreten Technologien geht es auch um Grundlagen wie Netzwerkprotokolle, Kerberos-Authentifizierung oder die eingesetzte Hardware. Zentrale Aspekte wie Performance, Verfügbarkeit und Sicherheit ziehen sich durch das gesamte Buch.
    Pages: Online-Ressource (1410 Seiten)
    Edition: 3., akt. und erw. Aufl.
    ISBN: 9783836215282
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Keywords: carbon ; energy ; climate change ; coal emissions ; energy efficiency
    Description / Table of Contents: This study from the Independent Evaluation Group draws lessons for development and climate change mitigation from the World Bank Group’s far-reaching portfolio of projects in energy, forestry, transport, coal power, and technology transfer. Reviewing what has worked, what hasn’t, and why, the evaluation’s key findings include: Energy efficiency can offer countries direct economic returns that dwarf those of most other development projects, while also reducing greenhouse gas emissions. Tropical forest protected areas, on average, significantly reduce tropical deforestation, preserving carbon and biodiversity. Deforestation rates are lower in areas that allowed sustainable use by local populations than in strictly protected areas. Deforestation rates were lowest of all in indigenous forest areas. For renewable energy projects, long-duration loans have been important in making projects financially viable.. But at prevailing carbon prices, carbon offset sales had little impact on most renewable energy projects’ rate of returns, and did not address investors’ need for up-front capital. Technology transfer – broadly understood to include diffusion of technical and financial innovations related to low-carbon development – has worked well when the logic of piloting and demonstration is well thought out, and when grants are used to mitigate the risk of pioneering efforts.
    Pages: Online-Ressource (XXXIX, 128 Seiten)
    ISBN: 9780821386545
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Unknown
    New York : Academic Press
    Keywords: DDC 003 ; LC QA402 ; Algebra ; System analysis
    Pages: Online-Ressource (xiv, 347 pages)
    ISBN: 9780080956596
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Unknown
    London : The Geological Society
    Keywords: Australia; Australian continent; landscape; geomorphology
    Description / Table of Contents: Introduction: Australian geomorphology into the 21st century / Paul Bishop and Brad Pillans / Geological Society, London, Special Publications, 346, 1-6, 1 January 2010, https://doi.org/10.1144/SP346.1 --- A theory (involving tropical cyclones) on the formation of coarse-grained sand beach ridges in NE Australia / Jonathan Nott / Geological Society, London, Special Publications, 346, 7-22, 1 January 2010, https://doi.org/10.1144/SP346.2 --- Sheltered sandy beaches of southwestern Australia / A. Travers, M. J. Eliot, I. G. Eliot and M. Jendrzejczak / Geological Society, London, Special Publications, 346, 23-42, 1 January 2010, https://doi.org/10.1144/SP346.3 --- Are the Murray Canyons offshore southern Australia still active for sediment transport? / S. Schmidt, P. De Deckker, H. Etcheber and S. Caradec / Geological Society, London, Special Publications, 346, 43-55, 1 January 2010, https://doi.org/10.1144/SP346.4 --- East Australian marine abrasion surface / Bruce G. Thom, Jock B. Keene, Peter J. Cowell and Marc Daley / Geological Society, London, Special Publications, 346, 57-69, 1 January 2010, https://doi.org/10.1144/SP346.5 --- Geoarchaeology in Australia: understanding human-environment interactions / Simon J. Holdaway and Patricia C. Fanning / Geological Society, London, Special Publications, 346, 71-85, 1 January 2010, https://doi.org/10.1144/SP346.6 --- Ecogeomorphology in the Australian drylands and the role of biota in mediating the effects of climate change on landscape processes and evolution / David Dunkerley / Geological Society, London, Special Publications, 346, 87-120, 1 January 2010, https://doi.org/10.1144/SP346.7 --- History of Australian aridity: chronology in the evolution of arid landscapes / Toshiyuki Fujioka and John Chappell / Geological Society, London, Special Publications, 346, 121-139, 1 January 2010, https://doi.org/10.1144/SP346.8 --- The Australian desert dunefields: formation and evolution in an old, flat, dry continent / Paul P. Hesse / Geological Society, London, Special Publications, 346, 141-164, 1 January 2010, https://doi.org/10.1144/SP346.9 --- Advances in Quaternary studies in Tasmania / Eric A. Colhoun, Kevin Kiernan, Timothy T. Barrows and Albert Goede / Geological Society, London, Special Publications, 346, 165-183, 1 January 2010, https://doi.org/10.1144/SP346.10 --- ‘Of droughts and flooding rains’: an alluvial loess record from central South Australia spanning the last glacial cycle / David Haberlah, Peter Glasby, Martin A. J. Williams, Steven M. Hill, Frances Williams, Edward J. Rhodes, Victor Gostin, Anthony O'Flaherty and Geraldine E. Jacobsen / Geological Society, London, Special Publications, 346, 185-223, 1 January 2010, https://doi.org/10.1144/SP346.11 --- Eroding Australia: rates and processes from Bega Valley to Arnhem Land / Arjun M. Heimsath, John Chappell and Keith Fifield / Geological Society, London, Special Publications, 346, 225-241, 1 January 2010, https://doi.org/10.1144/SP346.12 --- Tectonic geomorphology of Australia / Mark C. Quigley, Dan Clark and Mike Sandiford / Geological Society, London, Special Publications, 346, 243-265, 1 January 2010, https://doi.org/10.1144/SP346.13 --- Lithology and the evolution of bedrock rivers in post-orogenic settings: constraints from the high-elevation passive continental margin of SE Australia / Paul Bishop and Geoff Goldrick / Geological Society, London, Special Publications, 346, 267-287, 1 January 2010, https://doi.org/10.1144/SP346.14 --- Rethinking eastern Australian caves / R. A. L. Osborne / Geological Society, London, Special Publications, 346, 289-308, 1 January 2010, https://doi.org/10.1144/SP346.15 --- Oxygen-isotope dating the Yilgarn regolith / Allan. R. Chivas and Julius. R. Atlhopheng / Geological Society, London, Special Publications, 346, 309-320, 1 January 2010, https://doi.org/10.1144/SP346.16
    Pages: Online-Ressource (VII, 328 Seiten) , Illustrationen, Diagramme, Karten
    ISBN: 9781862395947
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    Unknown
    Amsterdam ; New York : North-Holland Pub. Co
    Keywords: DDC 510/.9 ; LC QA21 ; Mathematics - History
    Pages: Online-Ressource (x, 344 pages)
    ISBN: 9780444861351
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Keywords: DDC 515.3/5 ; LC QA370 ; Differential equations - Asymptotic theory - Congresses ; Differential equations - Numerical solutions - Congresses
    Pages: Online-Ressource (xvi, 381 pages)
    ISBN: 9780444861313
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Unknown
    New York : Academic Press
    Keywords: DDC 510/.2854 ; LC QA3 ; LC QA76.95eb ; Mathematics - Data processing
    Pages: Online-Ressource (xviii, 525 pages)
    ISBN: 9780123017505
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Unknown
    Hamburg : Maribus
    Description / Table of Contents: Der „World Ocean Review“ erscheint 2010 das erste Mal und soll in Zukunft in regelmäßigen Abständen herausgegeben werden. Entstanden ist ein umfassender und profunder Bericht, der den Zustand der Weltmeere und die Wirkungszusammenhänge zwischen dem Ozean und ökologischen, ökonomischen und gesellschaftspolitischen Bedingungen aufzeigt. Die wissenschaftlich gesicherten Erkenntnisse sollen all denen dienen, die sich aktiv und fundiert an den aktuellen Diskussionen im Umfeld der Meeresforschung beteiligen möchten.
    Pages: Online-Ressource (240 Seiten)
    ISBN: 9783866480001
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Description / Table of Contents: Onshore fold–thrust belts are commonly perceived as ‘difficult’ places to explore for hydrocarbons and are therefore often avoided. However, these belts host large oil and gas fields and so these barriers to effective exploration mean that substantial unexploited resources may remain. Over time, evaluation techniques have improved. It is possible in certain circumstances to achieve good 3D seismic data. Structural restoration techniques have moved into the 3D domain and increasingly sophisticated palaeo-thermal indicators allow better modelling of burial and uplift evolution of source and reservoirs. Awareness of the influence of pre-thrust structure and stratigraphy and of hybrid thick and thin-skinned deformation styles is augmenting the simplistic geometric models employed in earlier exploration. But progress is a slow, expensive and iterative process. Industry and academia need to collaborate in order to develop and continually improve the necessary understanding of subsurface geometries, reservoir and charge evolution and timing; this publication offers papers on specific techniques, outcrop and field case studies.
    Pages: Online-Ressource (190 Seiten)
    ISBN: 9781862393172
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Unknown
    Amsterdam ; New York : North-Holland Pub. Co
    Keywords: DDC 510 s ; DDC 515/.2433 ; LC QA1 ; Fourier analysis ; Functions of real variables ; Operator theory
    Pages: Online-Ressource (xiii, 392 pages)
    ISBN: 9780444861245
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    Keywords: DDC 511.3 ; LC QA9.A1 ; Logic, Symbolic and mathematical - Congresses
    Pages: Online-Ressource (ix, 391 pages)
    ISBN: 9780444864765
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Unknown
    Amsterdam ; New York : North-Holland Pub. Co
    Keywords: DDC 515.3/53 ; LC QA374 ; Differential equations, Partial
    Pages: Online-Ressource (xiv, 559 pages)
    ISBN: 9780444864529
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Unknown
    New York : Academic Press
    Keywords: DDC 515.3/53 ; LC QA377 ; Differential equations, Partial - Numerical solutions ; Maximum principles (Mathematics)
    Pages: Online-Ressource (ix, 224 pages)
    ISBN: 9780080956640
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    Unknown
    Rijeka : InTech
    Keywords: oceanography ; atmospheric sciences ; air pollution ; air quality ; environmental engineering
    Description / Table of Contents: Air pollution is about five decades or so old field and continues to be a global concern. Therefore, the governments around the world are involved in managing air quality in their countries for the welfare of their citizens. The management of air pollution involves understanding air pollution sources, monitoring of contaminants, modeling air quality, performing laboratory experiments, the use of satellite images for quantifying air quality levels, indoor air pollution, and elimination of contaminants through control. Research activities are being performed on every aspect of air pollution throughout the world, in order to respond to public concerns. The book is grouped in five different sections. Some topics are more detailed than others. The readers should be aware that multi-authored books have difficulty maintaining consistency. A reader will find, however, that each chapter is intellectually stimulating. Our goal was to provide current information and present a reasonable analysis of air quality data compiled by knowledgeable professionals in the field of air pollution.
    Pages: Online-Ressource (382 Seiten)
    ISBN: 9789533071312
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Unknown
    Amsterdam ; New York : North-Holland Pub. Co
    Keywords: DDC 515.3/6 ; LC QA374 ; Differential inequalities ; Numerical analysis ; Variational inequalities (Mathematics)
    Pages: Online-Ressource (xxix, 776 pages)
    ISBN: 9780444861993
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    Keywords: DDC 591/.0724 ; LC QH323.5 ; Biology - Mathematical models ; Biomathematics
    Pages: Online-Ressource (xiv, 297 pages)
    ISBN: 9780444863553
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Unknown
    Rijeka : InTech
    Keywords: climate change
    Description / Table of Contents: Climate change is emerging as one of the most important issues of our time, with the potential to cause profound cascading effects on ecosystems and society. However, these effects are poorly understood and our projections for climate change trends and effects have thus far proven to be inaccurate. In this collection of 24 chapters, we present a cross-section of some of the most challenging issues related to oceans, lakes, forests, and agricultural systems under a changing climate. The authors present evidence for changes and variability in climatic and atmospheric conditions, investigate some the impacts that climate change is having on the Earth's ecological and social systems, and provide novel ideas, advances and applications for mitigation and adaptation of our socio-ecological systems to climate change. Difficult questions are asked. What have been some of the impacts of climate change on our natural and managed ecosystems? How do we manage for resilient socio-ecological systems? How do we predict the future? What are relevant climatic change and management scenarios? How can we shape management regimes to increase our adaptive capacity to climate change? These themes are visited across broad spatial and temporal scales, touch on important and relevant ecological patterns and processes, and represent broad geographic regions, from the tropics, to temperate and boreal regions, to the Arctic.
    Pages: Online-Ressource (486 Seiten)
    ISBN: 9789533071442
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Keywords: climate change ; adaptation technologies
    Description / Table of Contents: Sea level rise, more intense storm surges, and other climate change impacts will pose serious threats to large number of people living along the worlds coasts. This guidebook covers thirteen main adaptation technologies for coastal erosion and flooding due to climate change. For each technology, the authors present a technology description, its advantages and disadvantages, costs and benefits, institutional organisation requirements and detailed examples about its application. This guidebook is co-authored by Matthew M. Linham and Robert J. Nicholls from the University of Southampton. Professor Nicholls is one of the top international experts on coastal impacts and adaptation to climate change, with an emphasis on seal level rise. This guidebook will be a useful handbook for policy makers and coastal zone project planners. This publication is one of the adaptation and mitigation technology guidebooks produced as part of the GEF-funded Technology Needs Assessment (TNA) project. This project is undertaken by UNEP and URC in 36 developing countries.
    Pages: Online-Ressource (XII, 150 Seiten)
    ISBN: 9788755038554
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Unknown
    Rijeka : InTech
    Keywords: globalization ; business ; management ; economics
    Description / Table of Contents: This is a collective volume on present-day globalisation with nine chapters from authors of several academic disciplines. It covers wide aspects, ranging from the nature, impact, challenges and implications of globalisation to responses from a country or community when facing globalisation today or tomorrow. Policy suggestions are also made. This book will hence help the reader to understand the currently debated issues.
    Pages: Online-Ressource (160 Seiten)
    ISBN: 9789533071923
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...