ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

X
feed icon rss

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • Books  (901)
  • Online Books  (901)
  • 2010-2014  (901)
  • 1945-1949  (1)
Collection
  • Books  (901)
Source
Keywords
Publisher
Language
Years
Year
Topic
Classification
Branch Library
Reading Room Location
  • 1
    Monograph available for loan
    Monograph available for loan
    Projected Costs of Generating Electricity (2010)
    Paris : OECD
    Details
    Call number: PIK P 113-10-0202
    Description / Table of Contents: This joint IEA/NEA report on electricity generating costs presents the latest data available for a wide variety of fuels and technologies, including coal and gas (with and without carbon capture), nuclear, hydro, onshore and offshore wind, biomass, solar, wave and tidal as well as combined heat and power (CHP).  It provides levelised costs of electricity (LCOE) per MWh for almost 200 plants, based on data covering 21 countries (including four major non-OECD countries), and several industrial companies and organisations.  For the first time, the report contains an extensive sensitivit
    Type of Medium: Monograph available for loan
    Pages: 215 S. : graph. Darst.
    ISBN: 9789264084308
    Language: English
    Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 2
    Monograph available for loan
    Monograph available for loan
    The war of the sexes : how conflict and cooperation have shaped men and women from prehistory to the present (2012)
    Princeton : Princeton University Press
    Details
    Call number: PIK E 713-15-0146
    Description / Table of Contents: As countless love songs, movies, and self-help books attest, men and women have long sought different things. The result? Seemingly inevitable conflict. Yet we belong to the most cooperative species on the planet. Isn't there a way we can use this capacity to achieve greater harmony and equality between the sexes? In The War of the Sexes, Paul Seabright argues that there is--but first we must understand how the tension between conflict and cooperation developed in our remote evolutionary past, how it shaped the modern world, and how it still holds us back, both at home and at work. 〈
    Type of Medium: Monograph available for loan
    Pages: XI, 241 S. : Ill.
    ISBN: 9780691159720
    URL: Rezension
    Language: English
    Note: Cover; Title Page; Copyright Page; Dedication Page; Table of Contents; Acknowledgments; Part One: Prehistory; 1. Introduction; 2. Sex and Salesmanship; 3. Seduction and the Emotions; 4. Social Primates; Part Two: Today; 5. Testing for Talent; 6. What Do Women Want?; 7. Coalitions of the Willing; 8. The Scarcity of Charm; 9. The Tender War; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 3
    Monograph available for loan
    Monograph available for loan
    Complexity and the art of public policy : solving society's problems from the bottom up (2014)
    Princeton : Princeton University Press
    Details
    Call number: PIK D 020-15-0143 ; IASS 15.89713
    Description / Table of Contents: Complexity science-made possible by modern analytical and computational advances-is changing the way we think about social systems and social theory. Unfortunately, economists' policy models have not kept up and are stuck in either a market fundamentalist or government control narrative. While these standard narratives are useful in some cases, they are damaging in others, directing thinking away from creative, innovative policy solutions. Complexity and the Art of Public Policy outlines a new, more flexible policy narrative, which envisions society as a complex evolving system that is uncont
    Type of Medium: Monograph available for loan
    Pages: VIII, 310 S.
    ISBN: 9780691152097
    URL: http://www.gbv.de/dms/bowker/toc/9780691152097.pdf
    Language: English
    Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; PART I. THE COMPLEXITY FRAME FOR POLICY; Chapter 1. Twin Peaks; Chapter 2. Government With, Not Versus, the Market; Chapter 3. I Pencil Revisited: Beyond Market Fundamentalism; Chapter 4. The Complexity Policy Frame; PART II. EXPLORING THE FOUNDATIONS; Chapter 5. How Economics Lost the Complexity Vision; Chapter 6. How Macroeconomics Lost the Complexity Vision; Chapter 7. Complexity: A New Kind of Science?; Chapter 8: A New Kind of Complexity Economics?; Chapter 9. Nudging toward a Complexity Policy Frame. , PART III. LAISSEZ-FAIRE ACTIVISM IN PRACTICEChapter 10. The Economics of Influence; Chapter 11. Implementing Influence Policy; Chapter 12. Laissez-Faire Activism; Chapter 13. Getting the Ecostructure of Government Right; PART IV. THE LOST AGENDA; Chapter 14. Getting the Ecostructure of Social Science Education Right; Chapter 15. The Lost Agenda; Notes; Bibliography; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 4
    Monograph available for loan
    Monograph available for loan
    Grundriss der Wirtschaftsethik : von der Stammesmoral zur Ethik der Globalisierung (2010)
    Stuttgart : Kohlhammer
    Details
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    URL: Inhaltsverzeichnis
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 5
    Monograph available for loan
    Monograph available for loan
    Geodesy : introduction to geodetic datum and geodetic systems (2014)
    Berlin : Springer
    Details
    Call number: 6/M 16.89656
    Description / Table of Contents: Geodetic datum (including coordinate datum, height datum, depth datum, gravimetry datum) and geodetic systems (including geodetic coordinate system, plane coordinate system, height system, gravimetry system) are the common foundations for every aspect of geomatics. This course book focuses on geodetic datum and geodetic systems, and describes the basic theories, techniques, methods of geodesy. The main themes include: the various techniques of geodetic data acquisition, geodetic datum and geodetic control networks, geoid and height systems, reference ellipsoid and geodetic coordinate systems, Gaussian projection and Gaussian plan coordinates and the establishment of geodetic coordinate systems. The framework of this book is based on several decades of lecture noted and the contents are developed systematically for a complete introduction to the geodetic foundations of geomatics.
    Description / Table of Contents: REVIEW: "The present work integrates both classical materials and modern developments in geodesy, it describes pure theoretical approaches and recent practical applications. The book can be used as a general textbook for undergraduates studying geomatics and survejing and mapping in higher education institutions. For technicians who are engaged in geomatic and surveying engineering, the book is strongly recommended as a basic and useful reference guide."
    Type of Medium: Monograph available for loan
    Pages: XXI, 401 S.
    ISBN: 9783642412455 , 9783642412448
    DOI: 10.1007/978-3-642-41245-5
    Classification:
    Geodesy
    Language: English
    Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 6
    Monograph available for loan
    Monograph available for loan
    The first great recession of the 21st century : competing explanations (2011)
    Cheltenham : Edward Elgar
    Details
    Call number: IASS 16.90013
    Description / Table of Contents: The 2008-10 financial crisis and the global recession it created is a complex phenomenon that warrants detailed examination. The various essays in this book utilise several alternative paradigms to provide a plausible explanation and a credible cure. Great detail is given to this important analysis from different theoretical perspectives, presenting a clearer understanding of what went wrong and expounding misinterpretations of current theories and practices. Fourteen insightful chapters by eminent scholars investigate the background of the crisis and draw lessons for economic theory and polic
    Type of Medium: Monograph available for loan
    Pages: ix, 260 Seiten
    ISBN: 9781849807456 , 1283072130 (ebk) , 9781283072137 (MyiLibrary) , 9781849807463 (electronic) , 1855754827 (print)
    URL: Inhaltsverzeichnis
    Language: English
    Note: CONTENTS; List of Figures; List of Tables; List of Contributors; Introduction; PART I: ECONOMISTS ON TRIAL; 1. Who predicted the crisis and what can we learn from them? ; 2 A brief note on economic recessions, banking reform and the future of capitalism; 3 Understanding crisis: on the meaning of uncertainty and probability; 4 Financial crisis and risk measurement: the historical perspective and a new methodology; 5 Did economic analysis fail in the current financial crisis?; PART II: WHAT DOES HISTORY TELL US? ; 6 Does the current global crisis remind us of the Great Depression?. , 7 Innovation, growth, cycles and finance: three (or four or more) stories from the 1930s and their lessons8 Epic Recession and economic theory; 9 Did asset prices cause the current crisis?; 10 The role of the history of economic thought in the development of economic theory and policy; PART III: COUNTRY CASES IN A GLOBAL CRISIS; 11. Testimony to the Financial Crisis Inquiry Commission by Alan Greenspan; 12 Long-term depression and new markets: economists and the 2008 recession; 13 Manifestations of the global crisis in a small open economy. , 14 The aftermath of a long decade of real nil interest rates (Spain 1996-2008)Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 7
    Monograph available for loan
    Monograph available for loan
    Models, simulations, and the reduction of complexity (2013)
    Berlin [u.a.] : de Gruyter
    Details
    Call number: PIK A 190-16-89749
    Description / Table of Contents: Modern science is a model-building activity. But how are models contructed? How are they related to theories and data? How do they explain complex scientific phenomena, and which role do computer simulations play? To address these questions which are highly relevant to scientists as well as to philosophers of science, 8 leading natural, engineering and social scientists reflect upon their modeling work, and 8 philosophers provide a commentary
    Description / Table of Contents: Modern science is a model-building activity. But how are models contructed? How are they related to theories and data? How do they explain complex scientific phenomena, and which role do computer simulations play? To address these questions which are highly relevant to scientists as well as to philosophers of science, 8 leading natural, engineering and social scientists reflect upon their modeling work, and 8 philosophers provide a commentary. U. Gähde and J. H. Wolf, University of Hamburg; S. Hartmann, Ludwig-Maximilians-Universität Munich.
    Type of Medium: Monograph available for loan
    Pages: VIII, 274 Seiten , graph. Darst.
    ISBN: 9783110313680 , 9783110313604
    Series Statement: Abhandlungen der Akademie der Wissenschaften in Hamburg 4
    Language: English
    Note: Preface; Contributors; Content; Introduction; Cosmology - The Largest Possible Model?; The Standard Model of Cosmology as a Tool for Interpretation and Discovery; Patterns in Physical and Biological Systems; Symmetry and the Explanation of Organismal Form; Pluralistic Modeling of Complex Systems; The Methodological Challenges of Complex Systems; Contested Modeling: The Case of Economics; A Unifying Approach to High- and Low-Level Cognition; High-vs Low-Level Cognition and the Neuro- Emulative Theory of Mental Representation. , Evaluating a Computational Model of Eye-Movement Control in ReadingConsidering Criteria for Model Modification and Theory Change in Psychology; Identification of Kinetic Models by Incremental Refinement; Kinetics, Models, and Mechanism; Modeling Complexity: The Case of Climate Science; Chaos, Plurality, and Model Metrics in Climate Science; Subject Index; Author Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 8
    Monograph available for loan
    Monograph available for loan
    East Asia-Arctic relations : boundary, security and international politics (2014)
    Waterloo, Ontario :CIGI,
    Details
    Call number: IASS 16.90382
    Description / Table of Contents: Acronyms -- Acknowledgments -- Introduction -- Kimie Hara and Ken Coates -- Forces for Change in the Arctic: Reflections on a Region in Transition -- Ken Coates -- The Process of Formulating Japan's Arctic Policy: From Involvement to Engagement -- Fujio Ohnishi -- China and the Arctic: China's Interests and Participation in the Region -- Kai Sun -- Arctic Prospects and Challenges from a Korean Perspective -- Young Kil Park -- East Asia and the Arctic: Alaskan and American Perspectives -- Jerry McBeath -- Canada's Northern Strategy and East Asian Interests in the Arctic
    Description / Table of Contents: P. Whitney Lackenbauer and James Manicom -- The Cooperation of Russia and Northeast Asian Countries in the Arctic: Challenges and Opportunities -- Tamara Troyakova -- From Cold War Thaws to the Arctic Thaw: The Changing Arctic and Its Security Implications to East Asia -- Kimie Hara -- The Business of Arctic Development: East Asian Economic Interests in the Far North -- Carin Holroyd -- Border Dynamics in Eurasia: Implications for the Arctic Thaw -- Akihiro Iwashita -- The Arctic and Geopolitics -- David A. Welch -- East Asian States and the Pursuit of Arctic Council Observer Status
    Description / Table of Contents: James Manicom and P. Whitney Lackenbauer -- Contributors
    Description / Table of Contents: The Arctic's profile as a region for engagement and opportunity is rising among both circumpolar and non-circumpolar states
    Type of Medium: Monograph available for loan
    Pages: viii, 217 Seiten , Illustrationen, Karten
    ISBN: 9781928096023 (print) , 9781928096030
    URL: http://www.gbv.de/dms/bowker/toc/9781928096023.pdf
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 9
    Monograph available for loan
    Monograph available for loan
    Empathy and democracy : feeling, thinking, and deliberation (2010)
    University Park, Pa : Pennsylvania State University Press
    Details
    Call number: IASS 16.90520
    Description / Table of Contents: "An interdisciplinary study of democratic theory, empirical political science, psychology, and philosophy. Proposes a multidimensional process model of empathy that incorporates both affective and cognitive features to demonstrate the importance of empathy in fulfilling democracy's promise of giving equal consideration to all citizens in collective decisions"--Provided by publisher
    Type of Medium: Monograph available for loan
    Pages: viii, 221 S. , graph. Darst.
    ISBN: 9780271036595 (cloth) , 9780271036601 (pbk)
    Language: English
    Note: The democratic promiseThe deliberative turn in democratic theory -- The elusive concept of empathy -- Empathy in deliberative theory -- Empathy's importance : the empirical evidence -- Deliberative democracy and its critics -- Empathy and democracy..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 10
    facet.materialart.12
    Onboarding : als Führungskraft neue Mitarbeiter erfolgreich einarbeiten und integrieren (2014)
    Wiesbaden, Germany : Springer Gabler
    Details
    Call number: 9783658065287 (e-book)
    Description / Table of Contents: Die zügige und ganzheitliche Einarbeitung und Integration eines neuen Mitarbeiters (Onboarding) ist ein zentraler Prozess, um die Leistungsfähigkeit einer Organisation dauerhaft sicherstellen zu können. Diese Investitionsleistung zahlt sich mehrfach aus, denn nur auf dieser Grundlage wird der neue Mitarbeiter seine volle Leistungsfähigkeit und Leistungsbereitschaft zum Nutzen der Organisation entwickeln. Dieses Essential bietet konkrete Hilfestellungen, um den Onboarding-Prozess für alle Beteiligten - den neuen Mitarbeiter, die Führungskraft und den HR Bereich - erfolgreich gestalten zu können.
    Type of Medium: 12
    Pages: 1 online resource (39 pages)
    ISBN: 9783658065287 (e-book)
    ISSN: 2197-6716
    Series Statement: Essentials
    URL: http://ebookcentral.proquest.com/lib/gfz-potsdam/detail.action?docID=1967672
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 11
    Non-book medium
    Non-book medium
    DIN EN ISO 50001: Energiemanagementsysteme : Anforderungen mit Anleitung zur Anwendung (ISO 50001:2011); Deutsche Fassung EN ISO 50001:2011 (2011)
    Beuth
    Details
    Call number: ISO 50001
    Type of Medium: Non-book medium
    Pages: Online Ressource
    Series Statement: ISO 50001:2011
    URL: http://bib.gfz-potsdam.de/intern/pubint/1855053.pdf
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 12
    facet.materialart.12
    Understanding Earth (2014)
    New York, Basingstoke : Freeman
    Details
    Call number: 9781464138744
    Type of Medium: 12
    Pages: 1 Online-Ressource (755 Seiten) , Illustrationen, Diagramme, Karten
    Edition: 7th edition
    ISBN: 978-1-4641-3874-4 , 1-4641-3874-5
    URL: http://bib.gfz-potsdam.de/intern/pubint/understanding-earth-grotzinger-and-jordan.pdf
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 13
    Non-book medium
    Non-book medium
    Spezifikation mit Anleitung zur quantitativen Bestimmung und Berichterstattung von Treibhausgasemissionen und Entzug von Treibhausgasen auf Organisationsebene (ISO 14064-1:2018); : deutsche und englische Fassung EN ISO 14064-1:2018 = Specification with guidance at the organization level for quantification and reporting of greenhouse gas emissions and removals (ISO 14064-1:2018)) = Spécifications et lignes directrices, au niveau des organismes, pour la quantification et la déclaration des émissions et des suppression des gaz à effet de serre (ISO 14064-1:2018)) (2012)
    Berlin : Beuth
    Details
    Call number: ISO 14064-1:2018
    Type of Medium: Non-book medium
    Pages: 109 Seiten , Ilustrationen
    Edition: Deutsche und Englische Fassung EN ISO 14064-1:2018
    Series Statement: Treibhausgase = Greenhouse gases = Gaz à effet de serre : DIN EN ISO 14064 / Normenausschuss Grundlagen des Umweltschutzes (NAGUS) im DIN ; Teil 1
    URL: http://bib.gfz-potsdam.de/intern/pubint/ebooks/DIN EN ISO 14064-12019-06.pdf
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 14
    Non-book medium
    Non-book medium
    Spezifikation mit Anleitung zur quantitativen Bestimmung,Überwachung und Berichterstattung von Reduktionen der Treibhausgasemissionen oder Steigerungen des Entzugs von Treibhausgaben auf Projektebene (ISO 14064-2:2006) : deutsche und englische Fassung EN ISO 14064-2:2012 = Specification with guidance at the project level for quantification, monitoring and reporting of greenhouse gas emission reductions or removal enhancements (ISO 14064-2.2006) = Spécifications et lignes directrices, au niveau des projets, pour la quantification, la surveillance et la déclaration des réductions d'émissions ou d'accroissements de supressions des gaz à effet de serre (ISO 14064-2:2006) (2012)
    Berlin : Beuth
    Details
    Call number: DIN EN ISO 14064-2:2012-05
    Type of Medium: Non-book medium
    Pages: 72 Seiten , Illustrationen
    Edition: Deutsche und Englische Fassung EN ISO 14064-2:2012
    Series Statement: Treibhausgase = Greenhouse gases = Gaz à effet de serre : DIN EN ISO 14064 / Normenausschuss Grundlagen des Umweltschutzes (NAGUS) im DIN ; Teil 2
    URL: http://bib.gfz-potsdam.de/intern/pubint/DIN EN ISO 14064-22012-05.pdf
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 15
    Non-book medium
    Non-book medium
    Vulkangiganten auf dem Mars : die großen Brüder der irdischen Feuerberge (2011)
    Heidelberg : Spektrum der Wissenschaft Verlagsgesellschaft
    Details
    Call number: (OCoLC)838497963
    Type of Medium: Non-book medium
    Pages: Online-Ressource (114 Seiten) , Illustrationen
    Series Statement: Sterne und Weltraum 50.2011,5
    URL: http://bib.gfz-potsdam.de/intern/pubint/SuW_2011_5_ges.pdf
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 16
    facet.materialart.12
    A dictionary of statistics : [the invaluable guide to all aspects of statistics] (2014)
    Oxford [u.a.] : Oxford Univ. Press
    Details
    Call number: 9780191758317 (e-book)
    Description / Table of Contents: This invaluable dictionary covers all aspects of statistics, including terms used in computing, mathematics, and probability, presented in a clear and practical way. It also provides biographical entries on over 200 key figures in the field, plus coverage of statistical journals and societies. The new edition features expanded coverage of applied statistics. Entries are complemented by over 120 figures and diagrams, and many provide worked examples. Wide-ranging appendices include a historical calendar of important statistical events, lists of statistical and mathematical notation, and statistical tables. It also features recommended web links for many entries, which provide valuable extra information. It is an invaluable dictionary for statistics students and professionals from a wide range of disciplines, including economics, politics, market research, medicine, psychology, pharmaceuticals, and mathematics, and provides a clear introduction to the subject for the general reader.
    Type of Medium: 12
    Pages: Online-Ressource , 488 S. , graph. Darst.
    Edition: 3. ed.
    ISBN: 9780191758317 (Online) , 9780199679188 (Print)
    Series Statement: Oxford paperback reference
    URL: https://doi.org/10.1093/acref/9780199679188.001.0001
    URL: Inhaltstext
    URL: Inhaltsverzeichnis
    DOI: 10.1093/acref/9780199679188.001.0001
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 17
    Journal available for loan
    Journal available for loan
    FinanzArchiv : public finance analysis (1884-)
    Tübingen : Mohr Siebeck ; 1.1884 - 48.1931; N.F. 1.1932/33 - 10.1943/44(1945),3; 11.1948/49(1949) -
    Details
    Call number: ZS 22.95039
    Type of Medium: Journal available for loan
    Pages: Online-Ressource
    ISSN: 1614-0974 , 0015-2218 , 0015-2218
    URL: https://www.jstor.org/journal/finaarch
    URL: http://www.bibliothek.uni-regensburg.de/ezeit/?2143985
    URL: https://www.mohrsiebeck.com/zeitschrift/finanzarchiv-fa
    URL: https://www.jstor.org/journal/finaarch
    Language: German , English
    Note: N.F. entfällt ab 57.2000. - Volltext auch als Teil einer Datenbank verfügbar , Ersch. ab 2000 in engl. Sprache mit dt. Hauptsacht.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 18
    Monograph available for loan
    Monograph available for loan
    Critical discourse analysis : the critical study of language (2013)
    New York : Routledge
    Details
    Call number: IASS 16.89933
    Description / Table of Contents: Bringing together papers written by Norman Fairclough over a 25 year period, Critical Discourse Analysis represents a comprehensive and important contribution to the development of this popular field.  The book is divided into seven sections covering the following themes:  language in relation to ideology and powerdiscourse in processes of social and cultural change dialectics of discourse, dialectical relations between discourse and other moments of social lifemethodology of critical discourse analysis research analysis of political discourse discourse in globalisation and ?transition' critic
    Type of Medium: Monograph available for loan
    Pages: xi, 591 S.
    Edition: Second edition
    Edition: Online-Ausg.
    ISBN: 9781405858229 (pbk.)
    URL: http://www.gbv.de/dms/bowker/toc/9781405858229.pdf
    Language: English
    Note: section A. Language, ideology and powersection B. Discourse and sociocultural change -- section C. Dialectics of discourse: theoretical developments -- section D. Methodology in CDA research -- section E. Political discourse -- F. Globalisation and 'transition' -- section G. Language and education..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 19
    Monograph available for loan
    Monograph available for loan
    Building global democracy? : civil society and accountable global governance (2011)
    Cambridge : Cambridge University Press
    Details
    Call number: IASS 16.89972
    Description / Table of Contents: "The scale, effectiveness and legitimacy of global governance lag far behind the world's needs. This path-breaking book examines how far civil society involvement provides an answer to these problems. Does civil society make global governance more democratic? Have citizen action groups raised the accountability of global bodies that deal with challenges such as climate change, financial crises, conflict, disease and inequality? What circumstances have promoted (or blocked) civil society efforts to make global governance institutions more democratically accountable? What could improve these outcomes in the future? The authors base their argument on studies of thirteen global institutions, including the UN, G8, WTO, ICANN and IMF. Specialists from around the world critically assess what has and has not worked in efforts to make global bodies answer to publics as well as states. Combining intellectual depth and political relevance, Building Global Democracy? will appeal to students, researchers, activists and policymakers"--
    Type of Medium: Monograph available for loan
    Pages: xxv, 397 S.
    ISBN: 9780521140553
    URL: Inhaltsverzeichnis
    Language: English
    Note: Machine generated contents note: Introduction Jan Aart Scholte; 1. Global governance, accountability and civil society Jan Aart Scholte; 2. Civil society and accountability of the United Nations Kerstin Martens; 3. The World Bank and democratic accountability: the role of civil society Alnoor Ebrahim and Steven Herz; 4. Civil society and IMF accountability Jan Aart Scholte; 5. Civil society and the WTO: contesting accountability Marc Williams; 6. Civil society and accountability in the Commonwealth Timothy M. Shaw and Pamela K. Mbabazi; 7. The organisation of the Islamic conference, accountability and civil society Saied Reza Ameli; 8. Civil society and patterns of accountability in the OECD Morten Ougaard; 9. Civil society and G8 accountability Peter I. Hajnal; 10. Structuring accountability: the Asia-Europe meeting Julie Gilson; 11. Civil society and accountability in global governance of climate change Peter Newell; 12. Civil society and accountability promotion in the global fund Carolyn Long and Nata Duvvury; 13. Accountability in private global governance: ICANN and civil society Mawaki Chango; 14. Civil society and the World Fair Trade Organisation: developing responsive accountability Heidi Ullrich; Conclusion Jan Aart Scholte..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 20
    Unknown
    Be the Captain of Your Career : A New Approach to Career Planning and Advancement (2014)
    Chicago : Precision Wordage Press
    Details
    Call number: 22/M 15.89567 (1. Ex.) ; 22/M 15.89567 (2. Ex.) ; 22/M 15.89567 (3. Ex.) ; 22/M 15.89567 (4. Ex.) ; 22/M 15.89567 (5. Ex.) ; 22/M 15.89567 (6. Ex.) ; 22/M 15.89567 (7. Ex.) ; 22/M 15.89567 (8. Ex.) ; 22/M 15.89567 (9. Ex.) ; 22/M 15.89567 (10. Ex.)
    Description / Table of Contents: Drawing from his own experience with corporations both large and small and as a business owner, Jack Molisani has seen every mistake the professional (or not-so-professional) can make in today's highly competitive job market. This book provides the tools for navigating these choppy waters. Starting with how to escape a dead-end job or an overbearing boss, to advancing one's career, and finally to achieving a higher standard of living, the book is divided into sections on finding new directions, making things happen, and optimizing the results. While most business guides focus on either job hun
    Pages: Online-Ressource (111 p)
    Edition: Online-Ausg.
    ISBN: 9780962709029
    URL: Volltext
    URL: Volltext
    URL: Inhaltsverzeichnis
    Parallel Title: Print version: Be the Captain of Your Career : A New Approach to Career Planning and Advancement
    Language: English
    Note: Cover; Copyright; Praise; Introduction; Contents; Section 1: THINK IT; The First Thing to Do When You Find Yourself in a Hole: Stop Digging; Stay Positive; Never Lose Faith; Seven Career Lessons I Learned from Selling Ginsu Knives; A Turning Point; Stop. Breathe. Think. Then Act.; Overcoming Inertia; Overcoming Fear; Keep Swimming; Section 2: DO IT; What Is a Resume?; What Are Managers Looking For?; Dirty Little Resume Secrets; The T-Bomb; Current Experience; What You Do Is More Important than What You're Called; The Top Ten Mistakes Professionals Make When Looking for Work. , Resumes: A SummaryCover Your Letter; Following Up; Getting Interviews; Be Proactive; Be Visible; Social Networking; Four Critical Steps to Getting a Job Offer; Send Out Ships; Gold Calling; Section 3: HAVE IT; Creating the Path; Recession-Proof Your Career; Creating a PR Campaign; Taking the Initiative; Increase Your Ability to Find Work; Advancing Your Career through Personal Branding; Advancing Your Career through Progressive Information Disclosure; Honing Your Workplace Negotiation Skills; The Sky's the Limit; What Are You Waiting For?; About Making Money; Creating the Life You Want. , Recommended ReadingAbout the Author.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 21
    Monograph available for loan
    Monograph available for loan
    Intraplate Earthquakes (2014)
    Cambridge : Cambridge University Press
    Details
    Call number: M 16.89855
    Description / Table of Contents: The first global overview of intraplate earthquakes, their mechanical models and investigative geophysical techniques, for academic researchers, professionals and engineers
    Type of Medium: Monograph available for loan
    ISBN: 9781107040380
    URL: Inhaltsverzeichnis
    Parallel Title: Print version: Intraplate Earthquakes
    Language: English
    Note: Cover; Half title; Title; Copyright; Contents; Contributors; Preface; 1 Introduction; 2 Intraplate earthquakes in Australia; 2.1 Introduction; 2.2 Two centuries of earthquake observations in Australia; 2.2.1 Mechanism, geographic distribution, and strain rate; 2.2.2 Seismogenic depth; 2.2.3 Attenuation and scaling relations; 2.3 A long-term landscape record of large (morphogenic) earthquakes; 2.3.1 Variation in fault scarp length and vertical displacement; 2.3.2 The influence of crustal type and character on seismic activity rates; 2.4 Patterns in earthquake occurrence. , 2.5 Maximum magnitude earthquake2.5.1 Scarp length as a proxy for paleo-earthquake magnitude; 2.6 Implications for SCR analogue studies: factors important in earthquake localisation; 2.6.1 Mechanical and thermal influences; 2.6.2 Structural architectural influences; 2.7 Conclusions; Acknowledgements; 3 Intraplate seismicity in Brazil; 3.1 Introduction; 3.2 Earthquake catalogue; 3.3 Seismicity map; 3.4 Seismotectonic correlations; 3.4.1 Lower seismicity in Precambrian cratonic provinces; 3.4.2 Intraplate seismicity and cratonic roots; 3.4.3 Passive margin seismicity. , 3.4.4 Influence of neotectonic faults3.4.5 Flexural stresses; 3.5 Discussion and conclusions; Acknowledgments; 4 Earthquakes and geological structures of the St. Lawrence Rift System; 4.1 Introduction; 4.2 Historical earthquakes and their impact; 4.3 Seismic zones of the SLRS; 4.3.1 Charlevoix; 4.3.2 Lower St. Lawrence; 4.3.3 Western Quebec; 4.3.4 Background seismicity; 4.4 The St. Lawrence Rift System; 4.5 The rift hypothesis and the SLRS: discussion and conclusions; Acknowledgments; 5 Intraplate earthquakes in North China; 5.1 Introduction; 5.2 Tectonic background; 5.2.1 Geological history. , 5.2.2 Lithospheric structure5.2.3 Major seismogenic faults; 5.3 Active tectonics and crustal kinematics; 5.4 Strain rates and seismicity; 5.5 Seismicity; 5.5.1 Paleoseismicity; 5.5.2 Large historic events; 1303 Hongdong earthquake (M 8.0); 1556 Huaxian earthquake (M 8.3); 1668 Tancheng earthquake (M 8.5); 1679 Sanhe earthquake (M 8.0); 1695 Linfen earthquake (M 7.5-8.0); 5.5.3 Large instrumentally recorded earthquake; The 1966 Xingtai earthquake (Ms 7.2); The 1975 Haicheng earthquake (Ms 7.3); The 1976 Tangshan earthquake (Ms 7.8); 5.6 Spatiotemporal patterns of large earthquakes. , 5.6.1 Long-distance roaming of large earthquakes5.6.2 Fault coupling and interaction; 5.6.3 A conceptual model for mid-continental earthquakes; 5.7 Implications for earthquake hazards; Acknowledgements; 6 Seismogenesis of earthquakes occurring in the ancient rift basin of Kachchh, Western India; 6.1 Introduction; 6.2 Tectonic framework, structure, and tectonic evolution of Kachchh Rift basin; 6.2.1 Structure and tectonics; 6.2.2 Tectono-volcanic events; 6.2.3 Tectonic evolution and existing earthquake generation models of the Kachchh Rift zone. , 6.2.4 Identification of magmatic intrusive bodies.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 22
    Monograph available for loan
    Monograph available for loan
    Ecotones between forest and grassland (2012)
    New York, NY : Springer
    Details
    Call number: PIK N 531-16-90092
    Description / Table of Contents: Ecotones are dynamic over-lapping boundary areas where major terrestrial biomes meet.  As past studies have shown, and as the chapters in this book will illustrate, their structure, size, and scope have changed considerably over the millennia, expanding and shrinking as climate and/or other driving conditions, also changed.  Today, however, many of them are changing at a rate not seen for a long time, perhaps largely due to climate change and other human-induced factors.  Indeed ecotones are more sensitive to climate change than the biomes on either side, and thus may serve as critical early indicators of future climate change.  As ecotones change, they also redefine the limits of the biomes on either side by altering their distributions of species because, in addition to their own endemic species, any ecotone will also have species from both adjoining biomes.  Consequently, they may also be places of high levels of species interaction, serving as active evolutionary laboratories, which generate new species that then migrate back into adjacent biomes.Ecotones Between Forest and Grassland explores how these ecotones have changed in the past, how they are changing today, and how they are likely to change in the future. The book includes chapters from around the world with a special focus on South American and Neotropical ecotones. 
    Type of Medium: Monograph available for loan
    Pages: XIII, 327 Seiten , Ill., graph. Darst.
    ISBN: 9781461437963 (print)
    URL: Inhaltsverzeichnis
    Language: English
    Note: Ecotones Between Forest and Grassland; Preface; Contents; Contributors; Chapter 1: Introduction; 1.1 Rationale; 1.2 Case Study: The Cross Timbers; 1.3 About This Book; References; Part I: Temperate Forest-Grassland Ecotones: Prairies, Steppes, and Pampas; Chapter 2: Woodland-Grassland Ecotonal Shifts in Environmental Mosaics: Lessons Learnt from the Environmental History of the Carpathian Basin (Central Europe) During the Holocene and the Last Ice Age Based on Investigation of Paleobotanical and Mollusk Remains; 2.1 Introduction. , 2.2 Modern Woodland-Grassland Ecotone in the Carpathian Basin and Controversies Around Definitions2.3 Profiles Selected and Methods Applied in Modeling Woodland-Grassland Ecotone Shifts in the Carpathian Basin; 2.3.1 The Climate-Zonal Hypothesis Put to the Test; 2.3.2 Testing the Model of Edaphic Ecological Factors; 2.3.3 Testing the Idea of Human-Induced Ecotone Development; 2.4 The Vegetation History of the Great Hungarian Plains as Inferred from the Evaluation of Quaternary Paleoecological and Environmental Historical Data; 2.4.1 Vegetation Development During Last Ice Age. , 2.4.2 Vegetation Development During the Terminal Part of the Last Ice Age2.4.3 Vegetation Development During the Pleistocene/Holocene Transition; 2.4.4 Vegetation History of the Carpathian Basin from the Settlement of the First Farmers; 2.5 Summary; References; Chapter 3: Ecotones as Complex Arenas of Disturbance, Climate, and Human Impacts: The Trans-Andean Forest-Steppe Ecotone of Northern Patagonia; 3.1 Introduction; 3.2 Physical and Biological Setting of Forest-Steppe Ecotone of Northern Patagonia; 3.2.1 Abiotic Transition; 3.2.2 Ecosystem Properties Across the Transition. , 3.2.3 Plant Communities and Plant Diversity Across the Transition3.3 Disturbance Variation and Forest Dynamics Across the Transition; 3.3.1 Fine-Scale Disturbances; 3.3.2 Coarse-Scale Disturbances; 3.4 Direct and Disturbances-Mediated In fl uences of Climate Variability Across the Transition; 3.5 Climate, Fire, Land Use, and Long-Term Vegetation Changes Across the Transition; 3.5.1 Xeric Steppe-Woodland Belt; 3.5.2 The Nothofagus Forest-Shrubland Belt; 3.5.3 The Wet Rainforest Belt; 3.6 Conclusions; References; Chapter 4: Woody-Herbaceous-Livestock Species Interaction; 4.1 Introduction. , 4.2 Woody-Herbaceous Species Interactions and Associated Models4.3 Woodland and Grassland Stable States and Conceptual Models; 4.4 Woody-Herbaceous Ecotones; 4.5 Rates and Patterns of Woody-Herbaceous Ecotone Shift; 4.6 Woody-Herbaceous-Livestock Species Dynamics; 4.7 Other Potential Factors In fl uencing Woody-Herbaceous Species Dynamics; 4.8 Current and Future Research on Woody-Herbaceous-Livestock Species Interaction; References; Chapter 5: Woody Plant Invasions in Pampa Grasslands: A Biogeographical and Community Assembly Perspective; 5.1 Introduction. , 5.2 Woody Invasions as Hierarchical Assembly Processes.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 23
    Monograph available for loan
    Monograph available for loan
    Betriebliches Nachhaltigkeitsmanagement : 19 Tabellen (2013)
    Stuttgart : Ulmer
    Details
    Call number: IASS 16.90047
    Type of Medium: Monograph available for loan
    Pages: 413 S. , Ill., graph. Darst.
    ISBN: 9783825236762 (print)
    Series Statement: UTB 3676
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 24
    Monograph available for loan
    Monograph available for loan
    Erzählungen im Öffentlichen : über die Wirkung narrativer Diskurse (2012)
    Wiesbaden : Springer VS Verlag für Sozialwissenschaften
    Details
    Call number: IASS 16.90103
    Description / Table of Contents: Ob in Medien, in der Wissenschaft, in der Politik oder in der Alltagskommuni­kation - wir sind stets mit einer Fülle an schriftlichen und mündlichen Erzäh­lungen konfrontiert. Sie schaffen gemeinsame Wirklichkeiten und Identitäten, auf die wir uns als soziale Akteure in unseren Handlungen bewusst oder unbewusst beziehen. Erzählungen im öffentlichen Raum prägen Normen und Moralvorstellungen, helfen beim Aufbau sozialer und kultureller Ordnungen und festigen oder verschieben damit bestehende Normen. Es sind Erzählungen, die in öffentlichen Diskursen bestimmen, was in einer Gesellschaft als wahr
    Type of Medium: Monograph available for loan
    Pages: 394 Seiten
    ISBN: 9783531932569 , 9783531173993 (print)
    Series Statement: Theorie und Praxis der Diskursforschung
    URL: Inhaltsverzeichnis
    DOI: 10.1007/978-3-531-93256-9
    Language: German
    Note: Inhalt; Über dieses Buch; Teil I Einführungen: Theorien der Erzählungen; Erzählen. Die ethisch-politische Funktion narrativer Diskurse; 1 Narrative Diskurse: Eigenschaften und Funktionen; 1.1 Die narrative Kunst der Begründung; 1.2 Ein semantisches Modell der Erzählung: Algirdas J. Greimas' Aktantentheorie; 1.3 Narrative Begründungen: Eine semantische Typologie; 1.4 Die Schuld und die Vergebung: Zum Verantwortungsmanagement narrativer Diskurse; 1.5 In medias res: Warum Erzählungen oft mit dem Ende beginnen; 1.6 Die doppelte Referenz: Das Allgemeine und das Einzigartige. , 2 Die Erzähler und ihr Publikum: Zur Öffentlichkeit narrativer Diskurse2.1 Öffentliche Urteile: Die Erzähler und ihr Publikum; 2.2 Die zwei Stimmen des Erzählers; 2.3 Die Präsenz des Erzählers in der Erzählung; 2.4 Die Öffentlichkeiten des Erzählers; 2.5 Autobiografisches Erzählen: Der innere Dialog und das Denken; 2.6 Ausblick: Die Öffentlichkeitsregime narrativer Diskurse; Literatur; »Menschen lesbarer machen«1: Narration, Diskurs,Referenz; 1 Narrationen als sozialwissenschaftliches Konzept; 1.1 Erzählungen zwischen Text und Handlung; 1.2 Typen der Erzählung. , 1.3 Zur lebensweltlichen Einbettung von Narrativen2 Zum Verhältnis von Narration und Diskurs; 2.1 Brauchen Diskurse Erzählungen?; 2.2 Narrationen als Sprech-Handlungen (über Satzniveau); 3 Erzählungen: Strukturen, Ereignisse und dieKomposition der Fabel; 3.1 Narration und Fabelkomposition; 3.2 Ebenen der Erzählung; 3.3 Kollektiv-Symbole und ihre Erzählungen; 3.4 Narrative und ihre Bedeutung für die kulturelle Reproduktion und Innovation; 4 Referenz und Erzählung: Jenseits der Innenwelt von Texten; 4.1 Öffentliche Erzählungen als Mimesis von Handlungen?. , 5 ConclusioLiteratur; Öffentliche Erzählungen und der globale Wandel des Klimas; 1 Einleitung; 2 Der Mensch als Klimageschichtenerzähler; 2.1 Was heißt Narrativisierung des Klimas?; 2.2 Narrationen als Geburtshelfer möglicher Welten; 2.3 Klimageschichten sind lebende Geschichten; 3 Globaler Klimawandel: Geburt eines Konzepts; 4 Sechs Varianten der Narrativisierung des globalenKlimawandels; 4.1 Das »globale Treibhaus« als anthropogene Katastrophe; 4.2 Anthropogene Eiszeiten: die Katastrophe des; 4.3 Die Geschichte vom »nuklearen Winter«; 4.4 »Paradiesische Warmzeiten«. , 4.5 Die ewige Wiederkehr der »Sonnenflecken«: Normalität statt Katastrophe. , 4.2 Die Konfiguration von Charakteren in öffentlichen Erzählungen4.3 Re-figuration und die Rolle des Lesers; Teil II Erzählungen in den Medien; Kollektivsymbolik und die deutsche Krise seit dem Jahr 2000; Heimat, Natur und die gute alte Zeit. Erzählungenüber Nachhaltige Entwicklung im Spannungsfeldöffentlicher und wissenschaftlicher Diskurse1; 1 Einleitung; 2 Wissenschaftliche Diskurse über Nachhaltige Entwicklung; 3 Nachhaltige Ernährung und Ernährungskommunikation; 4 Erzählungen über Ernährung in den Medien; 4.1 Polarisierende Rhetorik; 4.2 Affirmative Rhetorik; 4.3 Reflektierende Rhetorik.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 25
    facet.materialart.12
    (Open) Linked Data in Bibliotheken (2013)
    Berlin : De Gruyter Saur
    Details
    Call number: 9783110278736 (e-book)
    Description / Table of Contents: Das Buch ist sowohl eine Einführung in die Themen Linked Data, Open Data und Open Linked Data als es auch den konkreten Bezug auf Bibliotheken behandelt. Hierzu werden konkrete Anwendungsprojekte beschrieben. Der Band wendet sich dabei sowohl an Personen aus der Bibliothekspraxis als auch an Personen aus dem Bibliotheksmanagement, die noch nicht mit dem Thema vertraut sind. Das Buch ist eine Einführung in die Themen Data. | This book is an introduction to the subjects of linked data, open data and open linked data, and to their specific relevance for libraries. It illustrates these concepts through detailed descriptions of actual data projects. The volume will be useful to individuals involved in library practice and those in library management who have not yet become familiarized with these important contemporary fields.
    Type of Medium: 12
    Pages: 1 Online-Ressource (1 electronic resource (vi, 244 p.))
    Edition: Online-Ausg.
    ISBN: 9783110278736 , 9783110276343
    Series Statement: Bibliotheks- und Informationspraxis 50
    URL: Volltext
    Language: Undetermined
    Note: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 26
    facet.materialart.12
    Handbuch Bibliothek 2.0 (2010)
    Berlin, New York : De Gruyter Saur
    Details
    Call number: 9783110232103 (e-book)
    Description / Table of Contents: With the term "Library 2.0" the editors mean an institution which applies the principles of the Web 2.0 such as openness, re-use, collaboration and interaction in the entire organization. Libraries are extending their service offerings and work processes to include the potential of Web 2.0 technologies. This changes the job description and self-image of librarians. The collective volume offers a complete overview of the topic Library 2.0 and the current state of developments from a technological, sociological, information theoretical and practice-oriented perspective
    Type of Medium: 12
    Pages: 1 Online-Ressource (1 electronic resource (xii, 392 p.))
    Edition: Online-Ausg.
    ISBN: 9783110232103 , 9783110232097
    Series Statement: Bibliotheks- und Informationspraxis 41
    URL: https://www.degruyter.com/view/product/43790
    Language: Undetermined
    Note: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 27
    Monograph available for loan
    Monograph available for loan
    Visualization Analysis and Design (2014)
    Hoboken : Taylor and Francis
    Details
    Call number: M.19 92130
    Description / Table of Contents: Learn How to Design Effective Visualization SystemsVisualization Analysis and Design provides a systematic, comprehensive framework for thinking about visualization in terms of principles and design choices. The book features a unified approach encompassing information visualization techniques for abstract data, scientific visualization techniques for spatial data, and visual analytics techniques for interweaving data transformation and analysis with interactive visual exploration. It emphasizes the careful validation of effectiveness and the consideration of function before form. The book bre
    Type of Medium: Monograph available for loan
    ISBN: 9781466508910
    Series Statement: AK Peters Visualization Series
    URL: Inhaltsverzeichnis
    Classification:
    Informatics
    Language: English
    Note: Front Cover; Contents; Preface; 1. What's Vis, and Why Do It?; 2. What: Data Abstraction; 3. Why: Task Abstraction; 4. Analysis: Four Levels for Validation; 5. Marks and Channels; 6. Rules of Thumb; 7. Arrange Tables; 8. Arrange Spatial Data; 9. Arrange Networks and Trees; 10. Map Color and Other Channels; 11. Manipulate View; 12. Facet into Multiple Views; 13. Reduce Items and Attributes; 14. Embed: Focus+Context; 15. Analysis Case Studies; Figure Credits; Bibliography.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 28
    Monograph available for loan
    Monograph available for loan
    Varve and event layer chronology of Lake Suigetsu (Japan) back to 40 kyr BP and contribution to the international consensus atmospheric radiocarbon calibration curve (2014)
    Details
    Call number: M 20.94085
    Type of Medium: Monograph available for loan
    Pages: v, 146 Seiten , Graphiken
    URL: Volltext
    Language: English
    Note: Dissertation
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 29
    facet.materialart.12
    Biogeochemistry of thermokarst lakes of Western Siberia (2014)
    New York : Nova Publishers
    Details
    Call number: 9781629487991 (e-book)
    Description / Table of Contents: This book described the current status and possible future changes of the thermokarst (thaw) lakes of western Siberia as dominant forms of landscape and regulators of greenhouse gas exchange within the atmosphere. Thawing permafrost and resulting microbial decomposition of previously frozen organic carbon is one of the most significant terrestrial ecosystem positive feedbacks to a warming climate. Ongoing processes of the permafrost thawing in Western Siberia are likely to increase the surface of water bodies via forming so-called thermokarst lakes, mobilizing the organic carbon (OC) from the soil pool to the rivers and, finally, to the ocean, and thus modifying the fluxes of methane (CH4) and CO2 to the atmosphere. Despite their tremendous importance for green house gazes regulation and hydrological regime control, very little is known about hydrochemistry of western Siberia thaw lakes. This book assesses the variation of major and trace elements (TE) and organic carbon (OC) concentration along the chronosequence of lake development and the latitude profile of variable permafrost abundance; characterizes the colloidal status of TE and distinguishes between the relative proportion of organic and organo-mineral colloids; describes the particularity of microbiological composition of thermokarst lake waters and production/mineralization processes in the water column; and presents the perspective of water chemical composition evolution under the climate change scenario. Each of these aforementioned objectives present a scientific challenge given mainly the paucity of existing information on these important but still very poorly studied ecosystems. Taken together, understanding of these issues and identification and quantification of controlling environmental parameters should produce conceptually new knowledge of biogeochemical processes operating within the Western Siberia Plain with the possibility of extrapolation of generated knowledge to much larger territories of arctic and subarctic permafrost-affected areas. (Imprint: Nova)
    Type of Medium: 12
    Pages: 1 Online-Ressource (179 Seiten) , Illustrationen
    ISBN: 9781629487991 (e-book)
    Series Statement: Biochemistry research trends
    URL: Fulltext @ Ebook Central (AWI only)
    Language: English
    Note: Table of Contents Introduction: Thermokarst Lakes of Western Siberia as Dominant Forms of Landscape and Regulators of Greenhouse Gas Exchange with the Atmosphere Chapter 1. Thermokarst Lakes: Distribution, Cycle of Development, Surface Coverage and Evolution Chapter 2. Sources of Dissolved Components in Thermokarst Lakes Chapter 3. Temperature and Gas Regime Chapter 4. Dissolved Organic Carbon Chapter 5. Microbiology of Thermokarst Lake Systems Chapter 6. Trace Elements in Thermokarst Lakes Chapter 7. Colloids in Thermokarst Lakes Chapter 8. Latitude Profile Gradients of Lakes: Substituting Space for Time Chapter 9. Possible Impact of Climate Warming on Stocks and Fluxes of Carbon and Related Elements in Western Siberian Lakes Conclusions: Thaw Lakes as Indicators of Climate Change References Index
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 30
    Monograph available for loan
    Monograph available for loan
    Econometric analysis of cross section and panel data (2010)
    Cambridge, Mass. [u.a.] : MIT Press
    Details
    Call number: PIK B 020-16-89772
    Type of Medium: Monograph available for loan
    Pages: XXVII, 1064 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 0262232588 (hbk.) , 9780262232586
    Language: English
    Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 31
    Monograph available for loan
    Monograph available for loan
    Routledge International Handbook of Social and Environmental Change (2013)
    Hoboken : Taylor and Francis
    Details
    Call number: IASS 16.90022
    Description / Table of Contents: Today, the risks associated with global environmental change and the dangers of extreme climatic and geological events remind us of humanity's dependence on favourable environmental conditions. Our relationships with the landscapes and ecologies that we are a part of, the plants and animals that we share them with, and the natural resources that we extract, lie at the heart of contemporary social and political debates. It is no longer possible to understand key social scientific concerns without at the same time also understanding contemporary patterns of ecosystem change.The Routledge Interna
    Type of Medium: Monograph available for loan
    Pages: xv, 338 Seiten
    ISBN: 9781138645332
    Series Statement: Routledge International Handbooks
    Language: English
    Note: Cover; Title Page; Copyright Page; Table of Contents; List of illustrations; Notes on contributors; Acknowledgements; 1 Socio-ecological transformations and the social sciences; PART I Challenges, contradictions and consequences of global socio-ecological change; 2 Ecological modernization theory: taking stock, moving forward; 3 The emergence of new world-systems perspectives on global environmental change; 4 China's economic growth and environmental protection: approaching a 'win-win' situation? A discussion of ecological modernization theory; 5 Eco-imperialism and environmental justice. , 6 Neoliberalism by design: changing modalities of market-based environmental governance7 Dilemmas for standardizers of sustainable consumption; PART II Climate change, energy and adaptation; 8 Climate, scenario-building and governance: comprehending the temporalities of social-ecological change; 9 From Rio to Copenhagen: multilateral agreements, disagreements and situated actions; 10 Marriage on the rocks: sociology's counsel for our struggling energy-society relationships; 11 Sustainability as social practice: new perspectives on the theory and policies of reducing energy consumption. , 12 Environmental migration: nature, society and population movementPART III Urban environmental change, governance and adaptation; 13 Climate change and urban governance: a new politics?; 14 Recovering the city level in the global environmental struggle: going beyond carbon trading; 15 Hybrid arrangements within the environmental state; 16 The new mobilities paradigm and sustainable transport: finding synergies and creating new methods; PART IV Risk, uncertainty and social learning; 17 Towards a socio-ecological foundation for environmental risk research. , 18 Uncertainty and claims of uncertainty as impediments to risk management19 Transboundary risk governance: co-constructing environmental issues and political solutions; 20 The role of professionals in managing technological hazards: the Montara blowout; 21 Social learning to cope with global environmental change and unsustainability; PART V (Re)assembling social-ecological systems; 22 The social-ecological co-constitution of nature through ecological restoration: experimentally coping with inevitable ignorance and surprise. , 23 Biological invasions as cause and consequence of 'our' changing world: social and environmental paradoxes24 Biological resources, knowledge and property; 25 Disassembling and reassembling socionatural networks: integrated natural resource management in the Great Bear Rainforest; 26 Land use tensions for the development of renewable sources of energy; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 32
    Monograph available for loan
    Monograph available for loan
    Energiewende : Wege zu einer bezahlbaren Energieversorgung (2014)
    Wiesbaden : Springer VS
    Details
    Call number: PIK P 120-16-89806
    Description / Table of Contents: Deutschland wird seine bisher weitgehend auf fossilen Brennstoffen basierende Energieversorgung bis zum Jahr 2050 auf großtenteils regenerative Energien umstellen. Die Burgerinnen und Burger dieses Landes kennen dieses weltweit einzigartige Projekt unter dem Namen Energiewende. Von ihren gesellschaftlichen Wurzeln, dem Beginn ihrer Umsetzung und ihrer rasanten Entwicklung in den letzten Jahren berichtet Klaus-Dieter Maubach. Er beschreibt, wie das deutsche Energiesystem der Zukunft aussehen muss, und schlagt einen kurzfristigen Aktionsplan vor, der die volkswirtschaftlichen Kosten eindammt und
    Type of Medium: Monograph available for loan
    Pages: XX, 293 Seiten
    Edition: 2. Auflage
    ISBN: 3658054735 , 9783658054731
    Language: German
    Note: Vorwort zur zweiten Auflage; Vorwort; Inhalt; Abkürzungen; Einführung; Teil I; Eine kurze Geschichte der Energiewende; Fukushima und Ausstieg (2011); Fundamente der Energiewende (1980 - 1998); EnWG und EEG (1998 - 2003); Emissionshandel und Energiepreise (2003 - 2008); Netzregulierung und EEG (2004 - 2008); Krise in Europa (2009 - 2012); Teil II; Die Zukunft der Energiewende; Standortbestimmung (2013); 2050: Energiewende; Fossile Primärenergien; Die Regenerativen; Energiesystem der Zukunft; Politik für die Energiewende; 1 Braunkohle und Erdgas; 2 Auslaufbetrieb der Kernenergie ; 3 Energieeffizienz ; 4 Emissionshandel ; 5 EEG Reform ; 6 Regulierung der Stromnetze ; 7 Strommarktgestaltung ; 8 Koordinierung der Energiewende ; Zusammenfassung.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 33
    Monograph available for loan
    Monograph available for loan
    Urbane Niederschlagsbeeinflussung : Genese und räumliche Differenzierung am Beispiel von Berlin (2011)
    Berlin
    Details
    Call number: PIK 16-89825
    Type of Medium: Monograph available for loan
    Pages: Getr. Zählung , Ill., graph. Darst.
    Edition: Online-Ausg. Berlin Humboldt-Universität zu Berlin, Universitätsbibliothek 2011 〈〈Nach einem Exemplar der Humboldt-Universität zu Berlin, Universitätsbibliothek mit der Signatur: 〉〉Diss Geo11 P134
    URL: http://edoc.hu-berlin.de/docviews/abstract.php?lang=ger&id=38998
    Language: German
    Note: Berlin, Humboldt-Univ., Diss., 2011
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 34
    Monograph available for loan
    Monograph available for loan
    Governance of marine fisheries and biodiversity conservation : interaction and co-evolution (2014)
    Oxford [u.a.] : Wiley Blackwell
    Details
    Call number: IASS 16.90380
    Description / Table of Contents: Chapter 2 Governance of marine fisheries and biodiversity conservation: Convergence or coevolution?Introduction; Selected strands in fishery governance; Selected strands in conservation governance; Parallel strands in conservation and fishery governance; Discussion and conclusion; Notes; References; Chapter 3 Governance of marine fisheries and biodiversity conservation: The integration challenge; Introduction; Sustainable development backdrop; Integration process; Integration factors; Integration through interaction; Concluding thoughts; Notes; References; Part 2 Governance dimensions
    Description / Table of Contents: Chapter 4 Bio-ecological dimensions of fisheries management, biodiversity and governanceIntroduction and background; Fisheries management up to the 1990s; The ecological categories of impacts of fishing and their management; Areas of overlap and potential for inconsistencies between fisheries and conservation of biodiversity approaches; Venues for change; Conclusions; References; Chapter 5 The economic dimension: Addressing behaviour, incentives and context for effective governance; Introduction; Economic foundations of governance; The economic context of governance
    Description / Table of Contents: Evolving economic scope of governanceEconomic instruments in fisheries and marine conservation; Discussion: Economic instruments and prospects for governance integration; References; Chapter 6 The social dimension: The challenge of dealing with equity; Introduction: The two cultures; Fisheries management: creating wealth, forgetting about distribution; Conservation: creating values with unequal distribution of costs; Reconciling fisheries management and conservation; Consultation and co-management; Fisheries management and conservation within larger frameworks; Lessons learnt; Notes
    Description / Table of Contents: Governance of Marine Fisheries and Biodiversity Conservation; Copyright; Contents; Notes on contributors; Foreword Bonnie J. McCay; Foreword Árni M. Mathiesen; Foreword Braulio Ferreira de Souza Dias; Preface Serge M. Garcia, Jake Rice and Anthony Charles; Acknowledgements; List of selected acronyms; Glossary; Part 1 Governance trends and challenges; Chapter 1 Governance of marine fisheries and biodiversity conservation: A history; Introduction; Historical developments in fishery governance; Historical developments in biodiversity conservation; Conclusions; Notes; References
    Description / Table of Contents: Part 4. Regional governance. Regional governance for fisheries and biodiversity / R. Warner, K.M. Gjerde and D. Freestone ; Regional governance: The case of NEAFC and OSPAR / K. Hoydal, D. Johnson and A.H. Hoel ; Regional governance: The Mediterranean cradle / F. Simard, M. Camilleri and L. Sbai ; CCAMLR and Antarctic conservation: The leader to follow? / D. Miller and N.M. Slicer ; Implementation of the Ecosystem Approach to Fisheries in the Benguela Current LME area / J. Augustyn, S. Petersen, L. Shannon and H. Hamukuaya ; Governance of marine fisheries and conservation in the context of the European Union / S. Beslier and B. Drobenko -- Part 5. National governance. The use of national frameworks for sustainable development of marine fisheries and conservation, ecosystem-based management and integrated ocean management / K. Sainsbury, P. Gullestad and J. Rice ; Small-scale fisheries: Importance, vulnerability and deficient knowledge / J. Kolding, C. Béné and M. Bavinck ; Stewardship in tropical small-scale fisheries: Community and national perspectives / P. Christie, L.M. Campbell and N. Armada ; Making space for small-scale fishing communities: Use and misuse of spatial management instruments / M.R. Sowman, R. Rajagopalan, C. Sharma and J. Sunde ; ENGOs and SIDS: Environmental interventions in small island developing states / P. McConney, R. Pomeroy and Z. Khan ; The role of capacity building for improving governance of fisheries and conservation of marine ecosystems / J.C. Seijo and S. Salas ; Fishers' organizations: Their role in decision-making for fisheries and conservation / M. Makino, A.S. Cabanban and S. Jentoft ; The role of courts in fisheries management and marine biodiversity protection: US and EU systems / P. Shelley and T. van Rijn --
    Description / Table of Contents: Part 5. Conclusion. A tale of two streams: Synthesizing governance of marine fisheries and biodiversity conservation / A. Charles, S.M. Garcia and J. Rice -- Annexes. Annex 1: History of fisheries and biodiversity conservation: A timeline of key events (1850-2012) ; Annex 2: Key global institutions, bodies and processes: Roles, participation and main focus
    Description / Table of Contents: Part 1. Governance trends and challenges. Governance of marine fisheries and biodiversity conservation: A history / S.M. Garcia, J. Rice and A. Charles ; Governance of marine fisheries and biodiversity conservation: Convergence or coevolution? / S.M. Garcia, J. Rice and A. Charles ; Governance of marine fisheries and biodiversity conservation: The integration challenge / S.M. Garcia, J. Rice and A. Charles -- Part 2. Governance dimensions. Bio-ecological dimensions of fisheries management, biodiversity and governance / J. Rice and P. Mace ; The economic dimension: Addressing behaviour, incentives and context for effective governance / S. Hanna ; The social dimension: The challenge of dealing with equity / B. Hersoug ; The global legal dimension: Navigating the legal currents of rights and responsibilities / A.H. Hoel and D. VanderZwaag ; Spatial dimensions of fisheries and biodiversity governance / R. Kenchington, O. Vestergaard and S.M. Garcia ; Scientific foundation: Towards integration / J. Rice, S. Jennings and A. Charles -- Part 3. Global governance. Global level institutions and processes: Frameworks for understanding critical roles and foundations of cooperation and integration / L. Ridgeway ; Global level institutions and processes: Assessment of critical roles, foundations of cooperation and integration and their contribution to integrated marine governance / L. Ridgeway ; Integrative policy and legal instruments, approaches and tools: Fisheries and biodiversity conservation / B. Kuemlangan, J. Sanders, P. Deupmann and C. De Young ; Conservation and risk of extinction of marine species / P. Mace, C. O'Criodain, J. Rice and G. Sant ; Parallel initiatives: CBD's Ecologically or Biologically Significant Areas (EBSAs) and FAO's Vulnerable Marine Ecosystems (VMEs) criteria and processes / J. Rice, J. Lee and M. Tandstad --
    Description / Table of Contents: Governance of Marine Fisheries and Biodiversity Conservation explores governance of the world's oceans with a focus on the impacts of two inter-connected but historically separate streams of governance: one for fisheries, the other for biodiversity conservation. Chapters, most co-authored by leading experts from both streams, investigate the interaction of these governance streams from ecological, economic, social and legal perspectives, with emphasis on policies, institutions processes, and outcomes on scales from the global to the local community, and with coverage of a range of them
    Type of Medium: Monograph available for loan
    Pages: XXXVIII, 511 Seiten , Illustrationen, Karten
    ISBN: 9781118392645 (cloth)
    URL: http://external.dandelon.com/download/attachments/dandelon/ids/DE0085F3A3EA55C6D9855C1257D810028E8D7.pdf
    DOI: 10.1002/9781118392607
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 35
    Monograph available for loan
    Monograph available for loan
    Geschlechterverhältnisse und Nachhaltigkeit : die Kategorie Geschlecht in den Nachhaltigkeitswissenschaften (2013)
    Opladen : Verlag Barbara Budrich
    Details
    Call number: PIK E 713-17-90095
    Description / Table of Contents: Die Herausgeberinnen: Prof. Dr.-Ing. Sabine Hofmeister, Dr. rer. nat. Christine Katz, Dr. rer. soc. Tanja Mölders, alle: Lehr- und Forschungsgebiet Umweltplanung, Fakultät Nachhaltigkeit, Leuphana Universität Lüneburg
    Description / Table of Contents: Zwischen Geschlechter- und Nachhaltigkeitsforschung sind zahlreiche Synergien möglich. Die AutorInnen zeigen, warum die Umweltwissenschaften nicht auf die Kategorie Geschlecht verzichten dürfen. Den LeserInnen wird ein Überblick über das komplexe und vielfältig verwobene Forschungsfeld gegeben.
    Type of Medium: Monograph available for loan
    Pages: 403 Seiten
    ISBN: 9783847400103
    URL: Inhaltsverzeichnis
    URL: Inhaltstext
    Language: German
    Note: Contents: I Grundlegungen und Orientierungen ; 1. Grundlegungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; 2. Orientierungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; II Forschungs- und Handlungsfelder der Nachhaltigkeitswissenschaften und -politik ; 1. Einführung ; 2. Wissenschaft und Forschung ; 3. Wirtschaften und Arbeiten ; 4. Raumentwicklung ; 5. Mobilität ; 6. Klimawandel und -politik ; 7. Ressourcenpolitik und Infrastruktur ; 8. Natur und Landschaft ; 9. Konsum- und Lebensstile ; 10. Zeit(en) ; 11. Governance, Partizipation, Empowerment ; III Fazit - Die Kategorie Geschlecht: Neue Perspektiven für die Nachhaltigkeitswissenschaften
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 36
    Monograph available for loan
    Monograph available for loan
    Plows, plagues, and petroleum : how humans took control of climate ; with a new afterword by the author (2010)
    Princeton and Oxford : Princeton University Press,
    Details
    Call number: M 17.90645
    Description / Table of Contents: Cover; Title; Copyright; Contents; List of Illustrations; Preface; PART ONE: What Has Controlled Earth's Climate?; CHAPTER ONE: Climate and Human History; PART TWO: Nature in Control; CHAPTER TWO: Slow Going for a Few Million Years; CHAPTER THREE: Linking Earth's Orbit to Its Climate; CHAPTER FOUR: Orbital Changes Control Ice-Age Cycles; CHAPTER FIVE: Orbital Changes Control Monsoon Cycles; CHAPTER SIX: Stirrings of Change; PART THREE: Humans Begin to Take Control; CHAPTER SEVEN: Early Agriculture and Civilization; CHAPTER EIGHT: Taking Control of Methane
    Description / Table of Contents: CHAPTER NINE: Taking Control of CO[sub(2)]CHAPTER TEN: Have We Delayed a Glaciation?; CHAPTER ELEVEN: Challenges and Responses; PART FOUR: Disease Enters the Picture; CHAPTER TWELVE: But What about Those CO[sub(2)] "Wiggles"?; CHAPTER THIRTEEN: The Horsemen of the Apocalypse: Which One?; CHAPTER FOURTEEN: Pandemics, CO[sub(2)], and Climate; PART FIVE: Humans in Control; CHAPTER FIFTEEN: Greenhouse Warming: Tortoise and Hare; CHAPTER SIXTEEN: Future Warming: Large or Small?; CHAPTER SEVENTEEN: From the Past into the Distant Future; EPILOGUE; CHAPTER EIGHTEEN: Global-Change Science and Politics
    Description / Table of Contents: CHAPTER NINETEEN: Consuming Earth's GiftsAfterword to the Princeton Science Library Edition; Bibliography; Figure Sources; Index; A; B; C; D; E; F; G; H; I; K; L; M; N; O; P; R; S; T; U; V; W; Y
    Description / Table of Contents: The impact on climate from 200 years of industrial development is an everyday fact of life, but did humankind''s active involvement in climate change really begin with the industrial revolution, as commonly believed? Plows, Plagues, and Petroleum has sparked lively scientific debate since it was first published--arguing that humans have actually been changing the climate for some 8,000 years--as a result of the earlier discovery of agriculture. The ""Ruddiman Hypothesis"" will spark intense debate. We learn that the impact of farming on greenhouse-gas levels, thousands of years before the i
    Type of Medium: Monograph available for loan
    Pages: xiv, 226 Seiten , Illustrationen
    Edition: New Princeton Science Library edition
    ISBN: 9780691173214
    Series Statement: Princeton Science Library
    Classification:
    Meteorology and Climatology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 37
    Monograph available for loan
    Monograph available for loan
    2016 : Helmholtz investigating unknown worlds (2006-)
    Bonn : Helmholtz Association ; 2006-
    Associated volumes
    Details
    Call number: 3/S 07.0034(2016)
    In: Annual report
    Type of Medium: Monograph available for loan
    Pages: 51 Seiten
    ISSN: 1865-6439 , 1865-6447
    URL: Volltext
    Parallel Title: Erscheint auch als Annual report ... / Helmholtz Association of German Research Centres
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 38
    Monograph available for loan
    Monograph available for loan
    Modelling Norms (2014)
    Dordrecht : Springer
    Details
    Call number: PIK B 020-22-94723
    Description / Table of Contents: The book focusses on questions of individual and collective action, the emergence and dynamics of social norms and the feedback between individual behaviour and social phenomena. It discusses traditional modelling approaches to social norms and shows the usefulness of agent-based modelling for the study of these micro-macro interactions. Existing agent-based models of social norms are discussed and it is shown that so far too much priority has been given to parsimonious models and questions of the emergence of norms, with many aspects of social norms, such as norm-change, not being modelled.  Juvenile delinquency, group radicalisation and moral decision making are used as case studies for agent-based models of collective action extending existing models by providing an embedding into social networks, social influence via argumentation and a causal action theory of moral decision making. The major contribution of the book is to highlight the multifaceted nature of the dynamics of social norms, consisting not only of emergence, and the importance of embedding of agent-based models into existing theory. 
    Type of Medium: Monograph available for loan
    Pages: 215 Seiten
    Edition: Online edition Springer eBook Collection. Humanities, Social Sciences and Law
    ISBN: 978-94-017-8514-3
    Language: English
    Note: IntroductionTheorising Norms -- Theorising Crime -- Agent-based Modelling -- The Environment and Social Norms -- Punishment and Social Norms -- Imitation and Social Norms -- Socially Situated Social Norms -- Internalisation and Social Norms -- Modelling Norms -- Delinquent Networks -- Social Construction of Knowledge -- Morality -- We-Intentionality -- Conclusion -- Index..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 39
    facet.materialart.12
    Alpine treelines : functional ecology of the global high elevation tree limits (2012)
    Basel : Springer
    Details
    Call number: 9783034803960 (e-book)
    Type of Medium: 12
    Pages: 1 Online-Ressource (XI, 220 Seiten) , Illustrationen
    ISBN: 9783034803960 (e-book) , 978-3-0348-0396-0
    URL: Fulltext @ Ebook Central (AWI only)
    Language: English
    Note: Contents 1 High elevation treelines 1.1 The task 1.2 Previous works 2 Definitions and conventions 2.1 The life form ‘tree’ 2.2 Lines and transitions 2.3 Limitation, stress and disturbance 2.4 Altitude-related and other environmental drivers 2.5 Treeline nomenclature 3 Treeline patterns 3.1 Treeline taxa 3.2 The summit syndrome and other treeline depressions 3.3 Mass elevation effect 3.4 Treeline elevation 3.5 Time matters 3.6 Forest structure near treeline 4 Treeline climate 4.1 Specific aspects of treeline climatology 4.2 Criteria to define temperature regimes at treeline 4.3 Treeline temperatures in different bioclimatic regions 4.3.1 Subarctic and boreal zone (45–68° N) 4.3.2 Cool temperate zone (45–47° N, 44° S) 4.3.3 Warm temperate zone (28–42° N, 36° S) 4.3.4 Subtropical zone (19° S, 19° N) 4.3.5 Equatorial tropics (6° N to 3° S) 4.3.6 Mediterranean ‘treelines’ (38–42° N) 4.3.7 The Nothofagus and Metrosideros case 4.3.8 Treeline temperatures across bioclimatic zones 4.4 Seedbed and branch temperatures 4.5 Whole forest temperatures 5 Global mountain statistics based on treeline elevation 5.1 Mountain geostatistics 5.2 Elevational belts 5.3 Global treeline ecotones 6 Structure and stature of treeline trees 6.1 Foliage properties 6.2 Wood properties 6.3 Bark properties 6.4 Root traits 6.5 Tree stature 6.6 Dry matter allocation in treeline trees 7 Growth and development 7.1 Tree growth near the treeline 7.1.1 In situ growth of seedlings 7.1.2 In situ growth of saplings and adult trees 7.2 Xylogenesis at the treeline 7.2.1 In situ cambial activity 7.2.2 Apical growth dynamics 7.3 Root growth 7.4 Phenology at the treeline 8 Evolutionary adjustments to life at the treeline 8.1 Phylogenetic selection 8.2 Genotypic responses of growth and development 8.3 Genotypic responses of physiological traits 9 Reproduction, early life stages and tree demography 9.1 Amount and quality of seeds at high elevation 9.2 Germination, seedling and sapling stage 9.3 Tree demography at the treeline 10 Freezing and other forms of stress 10.1 Stress at the treeline in a fitness context 10.2 Mechanisms and principles of freezing resistance 10.3 Freezing resistance in treeline trees 10.4 Other forms of stress at the treeline 10.4.1 Freeze-thaw cycles and hydraulic failure 10.4.2 Winter desiccation 11 Water, nutrient and carbon relations 11.1 Tree water relations during the growing season 11.2 Nutrient relations 11.3 Carbon relations 12 Treeline formation - currently, in the past and in the future 12.1 Causes of current treelines 12.2 Treelines in the recent past 12.3 Treelines in the distant past (Holocene) 12.4 Treelines in the future References Subject Index Taxonomic Index
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 40
    facet.materialart.12
    Earth dynamics : deformations and oscillations of the rotating Earth (2013)
    Cambridge : Cambridge University Press
    Details
    Call number: 9781107306189 (e-book)
    Description / Table of Contents: "The Earth is a dynamic system. Internal processes, together with external gravitational forces of the Sun, Moon and planets, displace the Earth's mass, impacting on its shape, rotation and gravitational field. Doug Smylie provides a rigorous overview of the dynamical behaviour of the solid Earth, explaining the theory and presenting methods for numerical implementation. Topics include advanced digital analysis, earthquake displacement fields, Free Core Nutations observed by the Very Long Baseline Interferometric technique, translational modes of the solid inner core observed by the superconducting gravimeters, and dynamics of the outer fluid core. This book is supported by freeware computer code, available online for students to implement the theory. Online materials also include a suite of graphics generated from the numerical analysis, combined with 100 graphic examples in the book to make this an ideal tool for researchers and graduate students in the fields of geodesy, seismology and solid earth geophysics"--
    Type of Medium: 12
    Pages: 1 Online-Ressource (XII, 543 Seiten) , Illustrationen
    Edition: Electronic reproduction. Ann Arbor, MI : ProQuest, 2015. Available via World Wide Web. Access may be limited to ProQuest affiliated libraries.
    ISBN: 9781107306189
    URL: Fulltext @ Ebook Central
    Language: English
    Note: Contents Preface and acknowledgments The book website www.cambridge.org/smylie 1 Introduction and theoretical background 1.1 Scalar, vector and tensor analysis 1.2 Separation of vector fields 1.3 Vector spherical harmonics 1.4 Elasticity theory 1.5 Linear algebraic systems 1.6 Interpolation and approximation 2 Time sequence and spectral analysis 2.1 Time domain analysis 2.2 Linear optimum Wiener filters 2.3 Frequency domain analysis 2.4 Fourier series and transforms 2.5 Power spectral density estimation 2.6 Maximum entropy spectral analysis 3 Earth deformations 3.1 Equilibrium equations 3.2 The reciprocal theorem of Betti 3.3 Radial equations: spheroidal and torsional 3.4 Dynamical equations 3.5 Solutions near the geocentre 3.6 Numerical integration of the radial equations 3.7 Fundamental, regular solutions in the inner core 4 Earth's rotation: observations and theory 4.1 Reference frames 4.2 Polar motion and wobble 4.3 The dynamics of polar motion and wobble 4.4 Nutation and motion of the celestial pole 5 Earth's figure and gravitation 5.1 Historical development 5.2 External gravity and figure 5.3 Equilibrium theory of the internal figure 5.4 Gravity coupling 6 Rotating fluids and the outer core 6.1 The inertial wave equation 6.2 Dynamics of the fluid outer core 6.3 Scaling of the core equations 6.4 Compressibility and density stratification 7 The subseisniic equation and boundary conditions 7.1 The subseismic wave equation 7.2 Deformation of the shell and inner core 8 Variational methods and core modes 8.1 A subseismic variational principle 8.2 Representation of the functional 8.3 Finite element support functions 8.4 Boundary conditions and constraints 8.5 Numerical implementation and results 8.6 Rotational splitting and viscosity 8.7 A viscosity profile for the outer core 9 Static deformations and dislocation theory 9.1 The elasticity theory of dislocations 9.2 The theory for realistic Earth models 9.3 Changes in the inertia tensor and the secular polar shift Appendix A Elementary results from vector analysis A.1 Vector identities A.2 Vector calculus identities A.3 Integral theorems Appendix B Properties of Legendre functions B.1 Recurrence relations B.2 Evaluation of Legendre functions Appendix C Numerical Earth models C.1 The Earth models References Fortran index Subject index
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 41
    Unknown
    Encyclopedia of Geobiology (2011)
    Dordrecht : Springer
    Details
    Keywords: astrobiology ; biogeochemistry ; biogeoscience ; geobiology ; geology ; microbiology ; origin of life
    Description / Table of Contents: The interplay between Geology and Biology has shaped the Earth from the early Precambrian, 4 billion years ago. Moving beyond the borders of the classical core disciplines, Geobiology strives to identify cause-and-effect chains and synergisms between the geo- and the biospheres that have been driving evolution of life in modern and ancient environments. Combining modern methods, geobiological information can be extracted not only from visible remains of organisms, but also from organic molecules, rock fabrics, minerals, isotopes and other tracers. Exploring these processes and their signatures also creates enormous applied potentials with respect to issues of environment protection, public health, energy and resource management. The Encyclopedia of Geobiology is designed as a key reference for students, researchers, teachers, and the informed public to provide basic, but comprehensible knowledge on this rapidly expanding discipline at the interface between modern geo- and biosciences.
    Pages: Online-Ressource (XXXVIII, 927 Seiten)
    ISBN: 9781402092121
    URL: http://link.springer.com/referencework/10.1007/978-1-4020-9212-1
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 42
    Unknown
    Ice-Marginal and Periglacial Processes and Sediments (2011)
    London : The Geological Society
    Details
    Description / Table of Contents: Understanding the sediments deposited by glaciers or other cold-climate processes assumes enhanced significance in the context of current global warming and the predicted melt and retreat of glaciers and ice sheets. This volume analyses glacial, proglacial and periglacial settings focusing, among others, on sedimentation at termini of tidewater glaciers, on hitherto not-well-understood high-mountain features, and on sediments such as slope and aeolian deposits whose clasts were sourced in glacial and periglacial regions, but have been transported and deposited by azonal processes. Difficulties are thus often encountered in inferring Pleistocene and pre-Pleistocene cold-climate conditions when the sedimentary record lacks many of the specific diagnostic indicators. The main objective of this volume is to establish the validity and limitations of the evidence that can be obtained from widely distributed clastic deposits, in order to achieve reliable palaeogeographic and palaeoclimatic reconstructions. At a more general level and on the much longer geological timescale, an understanding of ice-marginal and periglacial environments may better prepare us for the unavoidable reversal towards cooler and perhaps even glacial times in the future.
    Pages: Online-Ressource (VII, 284 Seiten)
    ISBN: 9781862393271
    URL: http://sp.lyellcollection.org/content/vol354/issue1/
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 43
    Unknown
    Berg Water Project : Communication Practices for Governance and Sustainability Improvement (2010)
    Washington, D.C. : The World Bank
    Details
    Keywords: bulk water ; climate change ; equitable access ; large dams ; river basins ; water conservation ; water infrastructure ; water legislation ; water management ; water quality ; water resources ; water supply ; water use
    Description / Table of Contents: The past decade has witnessed a major global shift in thinking about water, including the role that water infrastructure plays in sustainable development. This rethinking aims to balance better the social, economic, and environmental performance aspects in the development and management of large dams. Infrastructure strategies must complement strategies for water, environment, and energy security and for emerging concerns to reduce vulnerability in water resource systems to climate change on the horizon. Communication is central to multi-stakeholder dialogue and partnerships at all levels needed to achieve sustainability and governance reform in water resource management and infrastructure provision. At the same time, communication drives the advocacy to mobilize political will and public support for beneficial change and continuous improvement in practices. This case study emphasizes that is not only important to mobilize all opportunities to reconcile water demand and supply in river basins that are coming under increasing levels of water stress, but also to integrate effectively governance and anti-corruption reforms and sustainability improvements into all stages of the planning and project cycle - adding value for stakeholders.
    Pages: Online-Ressource (XIII, 116 Seiten)
    ISBN: 9780821384343
    URL: http://books.google.com/books?id=SpqGp7a47cUC
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 44
    Unknown
    Cities and Climate Change : Responding to an Urgent Agenda (2011)
    Washington, D. C. : The World Bank
    Details
    Keywords: climate change ; emissions ; poverty
    Description / Table of Contents: This book provides the latest knowledge and practice in responding to the challenge of climate change in cities. Case studies focus on topics such as New Orleans in the context of a fragile environment, a framework to include poverty in the cities and climate change discussion, and measuring the impact of GHG emissions.
    Pages: Online-Ressource (XIV, 306 Seiten)
    ISBN: 9780821386675
    URL: http://issuu.com/world.bank.publications/docs/9780821384930
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 45
    Unknown
    Encyclopedia of Solid Earth Geophysics (2011)
    Dordrecht : Springer
    Details
    Keywords: deep earth processes ; earth science encyclopedia ; lithosphere ; mathematical geophysics ; plate tectonics ; potential fields ; seismology ; solid earth geophysics ; solid earth science
    Description / Table of Contents: The past few decades have witnessed the growth of the Earth Sciences in the pursuit of knowledge and understanding of the planet that we live on. This development addresses the challenging endeavor to enrich human lives with the bounties of Nature as well as to preserve the planet for the generations to come. Solid Earth Geophysics aspires to define and quantify the internal structure and processes of the Earth in terms of the principles of physics and forms the intrinsic framework, which other allied disciplines utilize for more specific investigations. The first edition of the Encyclopedia of Solid Earth Geophysics was published in 1989 by Van Nostrand Reinhold publishing company. More than two decades later, this new volume, edited by Prof. Harsh K. Gupta, represents a thoroughly revised and expanded reference work. It brings together more than 200 articles covering established and new concepts of Geophysics across the various sub-disciplines such as Gravity, Geodesy, Geomagnetism, Seismology, Seismics, Deep Earth Processes, Plate Tectonics, Thermal Domains, Computational Methods, etc. in a systematic and consistent format and standard. It is an authoritative and current reference source with extraordinary width of scope. It draws its unique strength from the expert contributions of editors and authors across the globe. It is designed to serve as a valuable and cherished source of information for current and future generations of professionals.
    Pages: Online-Ressource (XXXVIII, 1540 Seiten)
    Edition: 1st ed.
    ISBN: 9789048187027
    URL: http://link.springer.com/referencework/10.1007/978-90-481-8702-7
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 46
    Unknown
    Aspects of Today's Cosmology (2011)
    Rijeka : InTech
    Details
    Keywords: atmospheric sciences ; cosmology
    Description / Table of Contents: This book presents some aspects of the cosmological scientific odyssey that started last century. The chapters vary with different particular works, giving a versatile picture. It is the result of the work of many scientists in the field of cosmology, in accordance with their expertise and particular interests. Is a collection of different research papers produced by important scientists in the field of cosmology. A sample of the great deal of efforts made by the scientific community, trying to understand our universe. And it has many challenging subjects, like the possible doomsday to be confirmed by the next decade of experimentation. May be we are now half way in the life of the universe. Many more challenging subjects are not present here: they will be the result of further future work. Among them, we have the possibility of cyclic universes, and the evidence for the existence of a previous universe.
    Pages: Online-Ressource (396 Seiten)
    ISBN: 9789533076263
    URL: http://www.intechopen.com/books/show/title/aspects-of-today-s-cosmology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 47
    Unknown
    Neue Untersuchungen zur Geologie der Leinetalgrabenstruktur : Bausteine zur Erkundung des geothermischen Potentials der Region Göttingen (2011)
    Göttingen : Universitätsverlag Göttingen
    Details
    Keywords: Geothermie ; Geologie ; Göttingen ; Niedersachsen
    Description / Table of Contents: Der vorliegende Band enthält eine Sammlung von Arbeiten, die sich mit unterschiedlichen Aspekten der geologischen Entwicklung des Leinetalgrabens und seines strukturellen Rahmens befassen. Grundlage stellen neue und ältere, bislang nicht veröffentlichte Ergebnisse dar, die teilweise im Rahmen von geowissenschaftlichen Examensarbeiten erbracht wurden. Diese häufig in Archiven „versteckten“ Daten sollen hiermit interessierten Fachleuten aber auch geologisch interessierten Laien zugänglich gemacht werden. Herausgeber ist die GeothermieGruppeGöttingen (GGG), in der GeowissenschaftlerInnen aus verschiedenen Abteilungen des Geowissenschaftlichen Zentrums der Georg-August-Universität Göttingen (GZG) tätig sind. Aktuelles Forschungsziel der GGG ist, ein dreidimensionales Strukturmodell für die Region Göttingen mit dem Leinetalgraben als zentrale Struktur zu erstellen, das als Grundlage für eine anwendungsbezogene Bewertung geothermischer Potentiale dienen soll.
    Pages: Online-Ressource (170 Seiten)
    ISBN: 9783863950194
    URL: http://resolver.sub.uni-goettingen.de/purl?isbn-978-3-86395-019-4
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 48
    Unknown
    Space Science (2012)
    Rijeka : InTech
    Details
    Keywords: astronomy ; astrophysics ; cosmology
    Description / Table of Contents: The all-encompassing term Space Science was coined to describe all of the various fields of research in science: Physics and astronomy, aerospace engineering and spacecraft technologies, advanced computing and radio communication systems, that are concerned with the study of the Universe, and generally means either excluding the Earth or outside of the Earth's atmosphere. This special volume on Space Science was built throughout a scientifically rigorous selection process of each contributed chapter. Its structure drives the reader into a fascinating journey starting from the surface of our planet to reach a boundary where something lurks at the edge of the observable, light-emitting Universe, presenting four Sections running over a timely review on space exploration and the role being played by newcomer nations, an overview on Earth's early evolution during its long ancient ice age, a reanalysis of some aspects of satellites and planetary dynamics, to end up with intriguing discussions on recent advances in physics of cosmic microwave background radiation and cosmology.
    Pages: Online-Ressource (152 Seiten)
    ISBN: 9789535104230
    URL: http://www.intechopen.com/books/space-science
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 49
    Unknown
    Oceanography (2012)
    Rijeka : InTech
    Details
    Keywords: oceanography ; atmospheric sciences
    Description / Table of Contents: How inappropriate to call this planet Earth when it is quite clearly Ocean (Arthur C. Clarke). Life has been originated in the oceans, human health and activities depend from the oceans and the world life is modulated by marine and oceanic processes. From the micro-scale, like coastal processes, to macro-scale, the oceans, the seas and the marine life, play the main role to maintain the earth equilibrium, both from a physical and a chemical point of view. Since ancient times, the world's oceans discovery has brought to humanity development and wealth of knowledge, the metaphors of Ulysses and Jason, represent the cultural growth gained through the explorations and discoveries. The modern oceanographic research represents one of the last frontier of the knowledge of our planet, it depends on the oceans exploration and so it is strictly connected to the development of new technologies. Furthermore, other scientific and social disciplines can provide many fundamental inputs to complete the description of the entire ocean ecosystem. Such multidisciplinary approach will lead us to understand the better way to preserve our "Blue Planet": the Earth.
    Pages: Online-Ressource (348 Seiten)
    ISBN: 9789535103011
    URL: http://www.intechopen.com/books/oceanography
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 50
    Unknown
    Global Advances in Biogeography (2012)
    Rijeka : InTech
    Details
    Keywords: biogeography ; agricultural and biological sciences
    Description / Table of Contents: Global Advances in Biogeography brings together the work of more than 30 scientific authorities on biogeography from around the world. The book focuses on spatial and temporal variation of biological assemblages in relation to landscape complexity and environmental change. Global Advances embraces four themes: biogeographic theory and tests of concepts, the regional biogeography of individual taxa, the biogeography of complex landscapes, and the deep-time evolutionary biogeography of macrotaxa. In addition, the book provides a trove of new information about unusual landscapes, the natural history of a wide array of poorly known plant and animal species, and global conservation issues. This book is well illustrated with numerous maps, graphics, and photographs, and contains much new basic biogeographical information that is not available elsewhere. It will serve as an invaluable reference for professionals and members of the public interested in global biogeography, evolution, taxonomy, and conservation.
    Pages: Online-Ressource (360 Seiten)
    ISBN: 9789535104544
    URL: http://www.intechopen.com/books/global-advances-in-biogeography
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 51
    Unknown
    Bernardino Baldi’s In mechanica Aristotelis problemata exercitationes (2011)
    Berlin : Edition Open Access
    Details
    Pages: Online-Ressource (VI, 269 Seiten)
    ISBN: 9783869319612
    URL: http://www.edition-open-access.de/sources/3/index.html
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 52
    Unknown
    Earthquake Engineering (2012)
    Rijeka : InTech
    Details
    Keywords: earthquake ; seismology ; geology ; geophysics
    Description / Table of Contents: Recent major earthquakes around the world have shown the vulnerability of infrastructure and the need for research to better understand the nature of seismic events and their effects on structures. As a result, earthquake engineering research has been expanding as more and more data become available from a large array of seismic instruments, large scale experiments and numerical simulations. The first part of this book presents results from some of the current seismic research work including three-dimensional wave propagation in different soil media, seismic loss assessment, probabilistic hazard analysis, geotechnical problems including soil-structure interaction. The second part of the book focuses on the seismic behavior of structures including historical and monumental structures, bridge embankments, and different types of bridges and bearings.
    Pages: Online-Ressource (336 Seiten)
    ISBN: 9789535106944
    URL: http://www.intechopen.com/books/earthquake-engineering
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 53
    Unknown
    Emerging Informatics : Innovative Concepts and Applications (2012)
    Rijeka : InTech
    Details
    Keywords: informatics ; computer science
    Description / Table of Contents: The book on emerging informatics brings together the new concepts and applications that will help define and outline problem solving methods and features in designing business and human systems. It covers international aspects of information systems design in which many relevant technologies are introduced for the welfare of human and business systems. This initiative can be viewed as an emergent area of informatics that helps better conceptualise and design new world-class solutions. The book provides four flexible sections that accommodate total of fourteen chapters. The section specifies learning contexts in emerging fields. Each chapter presents a clear basis through the problem conception and its applicable technological solutions. I hope this will help further exploration of knowledge in the informatics discipline.
    Pages: Online-Ressource (274 Seiten)
    ISBN: 9789535105145
    URL: http://www.intechopen.com/books/emerging-informatics-innovative-concepts-and-applications
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 54
    Unknown
    Special Applications of Photogrammetry (2012)
    Rijeka : InTech
    Details
    Keywords: photogrammetry ; surveying
    Description / Table of Contents: Photogrammetry is widely accepted as one of the best surveying methods to acquire tridimensional data without direct contact with the object, but its high operational costs in equipment and personnel somewhat limit its application in mapping. However, with the development of digital photogrammetry in the 1990's, it was possible to introduce automated processes and reduce the personnel costs. In the following years, the cost of computer hardware, digital cameras and positioning sensors has been lowering, making photogrammetry more accessible to other engineering fields, such as architecture, archeology and health fields. This book shows the results of the work of researchers from different professional backgrounds, which evaluate the uses of photogrammetry, including issues of the data, processing, as well as the solutions developed for some surveying types that can be extended to many applications.
    Pages: Online-Ressource (136 Seiten)
    ISBN: 9789535105480
    URL: http://www.intechopen.com/books/special-applications-of-photogrammetry
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 55
    Unknown
    Soil Contamination (2011)
    Rijeka : InTech
    Details
    Keywords: soil science
    Description / Table of Contents: Soil contamination has severely increased over the last decades, mainly due to petroleum hydrocarbons, solvents, pesticides, lead and other heavy metals from industrial wastes and human activities. The critical point regarding contaminated soil monitoring is the intrinsic difficulty in defining fixed monitoring variables and indicators as the establishment of any a priori criterion and threshold for soil quality can be still considered subjective. This book is organized into eight chapters and presents the state-of-the art and new research highlights in the context of contaminated soil monitoring and remediation strategies, including examples from South America, Europe and Asia. The chapters deal with the following topics: - monitoring of dioxin, furan, hydrocarbons and heavy metals level in soils - bioindicators and biomarkers for the assessment of soil toxicity - use of reflectance spectroscopy for soil contaminants and waste material detection - remediation technologies and strategies.
    Pages: Online-Ressource (168 Seiten)
    ISBN: 9789533076478
    URL: http://www.intechopen.com/books/show/title/soil-contamination
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 56
    Unknown
    Advanced Seismic Hazard Assessment, Part II : Regional Seismic Hazard and Seismic Microzonation Case Studies (2011)
    Basel, Boston, Berlin : Birkhäuser
    Details
    Keywords: Earthquake predition ; Ground motion prediction ; Neo-deterministic seismic hazard assessments ; Probabilistic seismic hazard assessments ; Seismic risk analysis ; Seismic wave propagation
    Description / Table of Contents: Issues pertaining to urban risks are a pressing concern for those involved in disasters mitigation. Development of effective mitigation strategies requires sound seismic hazard information that is commonly derived through a seismic hazard assessment (SHA). The purpose of SHA is to provide a scientifically consistent estimate of seismic hazard for engineering design and other considerations. The time is ripe to move beyond the old paradigms of the traditional Probabilistic Seismic Hazard Analysis (PSHA). This two-part volume advocates advanced methods for SHA that utilize up to date earthquake science and basic scientific principles to derive the seismic hazard in terms of a ground motion or related quantity and its occurrence frequency at a site, as well as the associated uncertainty. It aims to: 1) identify the issues in the current SHAs, 2) facilitate the development of a scientifically consistent approach for SHA and 3) disseminate, both in scientific and in engineering practice societies, advanced reliable tools for independent hazard estimates, like NDSHA (neo-deterministic SHA), which incorporates physically based ground motion models. It provides a fresh approach to seismic hazard analysis. Part 2 provides advanced SHA case studies, concerning regional national and metropolitan estimates for different parts of the world, including Asia, Europe, North and South America. It is addressed to seismologists, engineers and stake-holders, and aims to contribute to bridging between modern interdisciplinary research and practitioners.
    Pages: Online-Ressource (320 Seiten)
    ISBN: 9783034800914
    URL: http://link.springer.com/journal/24/168/3/
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 57
    Unknown
    New Frontiers in Tectonic Research : At the Midst of Plate Convergence (2011)
    Rijeka : InTech
    Details
    Keywords: geology ; geophysics
    Description / Table of Contents: Ocean closure involves a variety of converging tectonic processes that reshape shrinking basins, their adjacent margins and the entire earth underneath. Following continental breakup, margin formation and sediment accumulation, tectonics normally relaxes and the margins become passive for millions of years. However, when final convergence is at the gate, the passive days of any ocean and its margins are over or soon will be. The fate of the Mediterranean and Persian Gulf is seemingly known beforehand, as they are nestled in the midst of Africa-Arabia plate convergence with Eurasia. Over millions of years through the Cenozoic era they progressively shriveled, leaving only a glimpse of the Tethys Ocean. Eventually, the basins will adhere to the Alpine-Himalaya orogen and dissipate. This book focuses on a unique stage in the ocean closure process, when significant convergence already induced major deformations, yet the inter-plate basins and margins still record the geological history.
    Pages: Online-Ressource (352 Seiten)
    ISBN: 9789533075945
    URL: http://www.intechopen.com/books/show/title/new-frontiers-in-tectonic-research-at-the-midst-of-plate-convergence
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 58
    Unknown
    Recent Hurricane Research : Climate, Dynamics, and Societal Impacts (2011)
    Rijeka : InTech
    Details
    Keywords: oceanography ; atmospheric sciences ; hurricane research ; meteorology
    Description / Table of Contents: This book represents recent research on tropical cyclones and their impact, and a wide range of topics are covered. An updated global climatology is presented, including the global occurrence of tropical cyclones and the terrestrial factors that may contribute to the variability and long-term trends in their occurrence. Research also examines long term trends in tropical cyclone occurrences and intensity as related to solar activity, while other research discusses the impact climate change may have on these storms. The dynamics and structure of tropical cyclones are studied, with traditional diagnostics employed to examine these as well as more modern approaches in examining their thermodynamics. The book aptly demonstrates how new research into short-range forecasting of tropical cyclone tracks and intensities using satellite information has led to significant improvements. In looking at societal and ecological risks, and damage assessment, authors investigate the use of technology for anticipating, and later evaluating, the amount of damage that is done to human society, watersheds, and forests by land-falling storms. The economic and ecological vulnerability of coastal regions are also studied and are supported by case studies which examine the potential hazards related to the evacuation of populated areas, including medical facilities. These studies provide decision makers with a potential basis for developing improved evacuation techniques.
    Pages: Online-Ressource (616 Seiten)
    ISBN: 9789533072388
    URL: http://www.intechopen.com/books/show/title/recent-hurricane-research-climate-dynamics-and-societal-impacts
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 59
    Unknown
    Tectonics (2011)
    Rijeka : InTech
    Details
    Keywords: geology ; geophysics ; tectonics ; seismology
    Description / Table of Contents: Chapter 1: Plates Amalgamation and Plate Destruction, the Western Gondwana History by Ngako Vincent and Njonfang Emmanuel --- Chapter 2: Lithospheric Structure and Tectonics of the Eastern Alps – Evidence from New Seismic Data by Ewald Brückl --- Chapter 3: Structure and Plate Tectonic Evolution of the Northern Outer Carpathians by Jan Golonka, Kaja Pietsch and Paweł Marzec --- Chapter 4: Tectonic Model of the Sinai Peninsula Based on Geophysical Investigations by Taha Rabeh --- Chapter 5: Siberia - From Rodinia to Eurasia by Dmitry V. Metelkin, Valery A. Vernikovsky and Alexey Yu. Kazansky --- Chapter 6: Proto-Basin Types of North China Craton (NCC) in Late Triassic and Its Implication for Regional Tectonics of Initial Craton Destruction by Yang Minghui, Liu Chiyang, Zeng Peng, Bai Hua and Zhou Jin --- Chapter 7: Tectonic Implications of Stratigraphy Architecture in Distal Part of Foreland Basin, Southwestern Taiwan by Jong-Chang Wu, Kenn-Ming Yang, Yi-Ru Chen and Wen-Rong Chi --- Chapter 8: Seismic Hazard in Tien Shan: Basement Structure Control Over the Deformation Induced by Indo-Eurasia Collision by Buslov, Mikhail M. and De Grave, Johan --- Chapter 9: Lithosphere as a Nonlinear System: Geodynamic Consequences by E. G. Mirlin --- Chapter 10: Layer-Block Tectonics, a New Concept of Plate Tectonics - An Example from Nansha Micro-Plate, Southern South China Sea by Hai-ling Liu, Hong-bo Zheng, Yan-Lin Wang, Chao-Hua Wu, Mei-Song Zhao and Yun-Kong Du --- Chapter 11: The Role of Geoelectrical DC Methods in Determining the Subsurface Tectonics Features. Case Studies from Syria by Jamal Asfahani --- Chapter 12: Salt Tectonics of the Lisan Diapir Revealed by Synthetic Aperture Radar Images by Damien Closson, Najib Abou Karaki, Nada Milisavljević, Frédéric Hallot, and Marc Acheroy --- Chapter 13: Mantle-like Trace Element Composition of Petroleum – Contributions from Serpentinizing Peridotites by Peter Szatmari, Teresa Cristina O. da Fonseca and Norbert F. Miekeley
    Pages: Online-Ressource (358 Seiten)
    ISBN: 9789533075457
    URL: http://www.intechopen.com/books/show/title/tectonics
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 60
    Unknown
    Planet Earth 2011 - Global Warming Challenges and Opportunities for Policy and Practice (2011)
    Rijeka : InTech
    Details
    Keywords: environmental engineering ; climate change ; global warming
    Description / Table of Contents: The failure of the UN climate change summit in Copenhagen in December 2009 to effectively reach a global agreement on emission reduction targets, led many within the developing world to view this as a reversal of the Kyoto Protocol and an attempt by the developed nations to shirk out of their responsibility for climate change. The issue of global warming has been at the top of the political agenda for a number of years and has become even more pressing with the rapid industrialization taking place in China and India. This book looks at the effects of climate change throughout different regions of the world and discusses to what extent cleantech and environmental initiatives such as the destruction of fluorinated greenhouse gases, biofuels, and the role of plant breeding and biotechnology. The book concludes with an insight into the socio-religious impact that global warming has, citing Christianity and Islam.
    Pages: Online-Ressource (646 Seiten)
    ISBN: 9789533077338
    URL: http://www.intechopen.com/books/show/title/planet-earth-2011-global-warming-challenges-and-opportunities-for-policy-and-practice
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 61
    Unknown
    Another Technoscience is Possible : Agricultural Lessons for the Posthumanities (2011)
    Open Humanities Press
    Details
    Keywords: agriculture
    Description / Table of Contents: When Foucault introduced the concept of biopolitics, he referred to a historically specific power agenda involving a particular approach to life. This approach was at the root of the modern sciences of biology and political economy, both of which set out to describe, explain and manage their objects of study as abstract processes of production and reproduction. Agricultural science must be situated in relation to the biopolitical agenda of 'applying' the modern scientific approach to the management of social life. The scientification of agriculture took place in the United States towards the end of the 19th century, through a process that entailed both a delegitimation of farmer-generated knowledges and the production of new, modern subjectivities. While farmers were being reconceptualized as entrepreneurs in need of scientific education and advice, newly trained agronomists devoted themselves to designing fertilizers, pesticides and hybrid seeds with the goal of maximizing yields. Public institutions were created which coordinated agricultural production with both science and trade policy. Agricultural science was thus inseparable from the process which transformed much of US agriculture into transnational agribusiness, and local farming networks all over the world into consumer endpoints of a globalized food industry.
    URL: http://www.livingbooksaboutlife.org/books/Another_Technoscience_is_Possible
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 62
    Unknown
    Geology of the Earthquake Source : A Volume in Honour of Rick Sibson (2011)
    London : The Geological Society
    Details
    Description / Table of Contents: Professor Richard (Rick) Sibson revolutionized structural geology by illustrating that fault rocks contain an integrated record of earthquakes. Fault-rock textures develop in response to geological and physical variables such as composition, environmental conditions (e.g. temperature and pressure), fluid presence and strain rate. These parameters also determine the rate- and state-variable frictional stability of a fault, the dominant mineral deformation mechanism and shear strength, and ultimately control the partitioning between seismic and aseismic deformation. This volume contains a collection of papers that address the geological record of earthquake faulting from field-based or theoretical perspectives. The papers cover observations in active fault zones, the relationships between fault rocks and fault-slip styles, interpretation of fault-rock textures from the base of the seismogenic zone, consideration of the effects of fluids on faulting, discussion of fault reactivation v. initiation, and a review of future directions in geological earthquake research by Professor Sibson.
    Pages: Online-Ressource (VIII, 341 Seiten)
    ISBN: 9781862393370
    URL: http://sp.lyellcollection.org/content/vol359/issue1/
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 63
    Unknown
    Energy Efficiency in Communications and Networks (2012)
    Rijeka : InTech
    Details
    Keywords: energy efficiency
    Description / Table of Contents: The topic of "Energy Efficiency in Communications and Networks" attracts growing attention due to economical and environmental reasons. The amount of power consumed by information and communication technologies (ICT) is rapidly increasing, as well as the energy bill of service providers. According to a number of studies, ICT alone is responsible for a percentage which varies from 2% to 10% of the world power consumption. Thus, driving rising cost and sustainability concerns about the energy footprint of the IT infrastructure. Energy-efficiency is an aspect that until recently was only considered for battery driven devices. Today we see energy-efficiency becoming a pervasive issue that will need to be considered in all technology areas from device technology to systems management. This book is seeking to provide a compilation of novel research contributions on hardware design, architectures, protocols and algorithms that will improve the energy efficiency of communication devices and networks and lead to a more energy proportional technology infrastructure.
    Pages: Online-Ressource (142 Seiten)
    ISBN: 9789535104827
    URL: http://www.intechopen.com/books/energy-efficiency-in-communications-and-networks
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 64
    Unknown
    MATLAB - A Ubiquitous Tool for the Practical Engineer (2011)
    Rijeka : InTech
    Details
    Keywords: MATLAB ; communications
    Description / Table of Contents: A well-known statement says that the PID controller is the "bread and butter" of the control engineer. This is indeed true, from a scientific standpoint. However, nowadays, in the era of computer science, when the paper and pencil have been replaced by the keyboard and the display of computers, one may equally say that MATLAB is the "bread" in the above statement. MATLAB has became a de facto tool for the modern system engineer. This book is written for both engineering students, as well as for practicing engineers. The wide range of applications in which MATLAB is the working framework, shows that it is a powerful, comprehensive and easy-to-use environment for performing technical computations. The book includes various excellent applications in which MATLAB is employed: from pure algebraic computations to data acquisition in real-life experiments, from control strategies to image processing algorithms, from graphical user interface design for educational purposes to Simulink embedded systems.
    Pages: Online-Ressource (564 Seiten)
    ISBN: 9789533079073
    URL: http://www.intechopen.com/books/matlab-a-ubiquitous-tool-for-the-practical-engineer
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 65
    Unknown
    Applications of MATLAB in Science and Engineering (2011)
    Rijeka : InTech
    Details
    Keywords: MATLAB ; communications
    Description / Table of Contents: The book consists of 24 chapters illustrating a wide range of areas where MATLAB tools are applied. These areas include mathematics, physics, chemistry and chemical engineering, mechanical engineering, biological (molecular biology) and medical sciences, communication and control systems, digital signal, image and video processing, system modeling and simulation. Many interesting problems have been included throughout the book, and its contents will be beneficial for students and professionals in wide areas of interest.
    Pages: Online-Ressource (510 Seiten)
    ISBN: 9789533077086
    URL: http://www.intechopen.com/books/applications-of-matlab-in-science-and-engineering
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 66
    Unknown
    Advances in Knowledge Representation (2012)
    Rijeka : InTech
    Details
    Keywords: computer science ; information science ; knowledge representation
    Description / Table of Contents: Advances in Knowledge Representation offers a compilation of state of the art research works on topics such as concept theory, positive relational algebra and k-relations, structured, visual and ontological models of knowledge representation, as well as detailed descriptions of applications to various domains, such as semantic representation and extraction, intelligent information retrieval, program proof checking, complex planning, and data preparation for knowledge modelling, and a extensive bibliography. It is a valuable contribution to the advancement of the field. The expected readers are advanced students and researchers on the knowledge representation field and related areas; it may also help to computer oriented practitioners of diverse fields looking for ideas on how to develop a knowledge-based application.
    Pages: Online-Ressource (272 Seiten)
    ISBN: 9789535105978
    URL: http://www.intechopen.com/books/advances-in-knowledge-representation
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 67
    Unknown
    LabVIEW : Practical Applications and Solutions (2011)
    Rijeka : InTech
    Details
    Keywords: computer science ; LabVIEW
    Description / Table of Contents: The book consists of 21 chapters which present interesting applications implemented using the LabVIEW environment, belonging to several distinct fields such as engineering, fault diagnosis, medicine, remote access laboratory, internet communications, chemistry, physics, etc. The virtual instruments designed and implemented in LabVIEW provide the advantages of being more intuitive, of reducing the implementation time and of being portable. The audience for this book includes PhD students, researchers, engineers and professionals who are interested in finding out new tools developed using LabVIEW. Some chapters present interesting ideas and very detailed solutions which offer the immediate possibility of making fast innovations and of generating better products for the market. The effort made by all the scientists who contributed to editing this book was significant and as a result new and viable applications were presented.
    Pages: Online-Ressource (472 Seiten)
    ISBN: 9789533076508
    URL: http://www.intechopen.com/books/practical-applications-and-solutions-using-labview-software
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 68
    Unknown
    Chemistry, Emission Control, Radioactive Pollution and Indoor Air Quality (2011)
    Rijeka : InTech
    Details
    Keywords: oceanography ; atmospheric sciences ; air pollution ; emission
    Description / Table of Contents: The atmosphere may be our most precious resource. Accordingly, the balance between its use and protection is a high priority for our civilization. While many of us would consider air pollution to be an issue that the modern world has resolved to a greater extent, it still appears to have considerable influence on the global environment. In many countries with ambitious economic growth targets the acceptable levels of air pollution have been transgressed. Serious respiratory disease related problems have been identified with both indoor and outdoor pollution throughout the world. The 25 chapters of this book deal with several air pollution issues grouped into the following sections: a) air pollution chemistry; b) air pollutant emission control; c) radioactive pollution and d) indoor air quality.
    Pages: Online-Ressource (680 Seiten)
    ISBN: 9789533073163
    URL: http://www.intechopen.com/books/show/title/chemistry-emission-control-radioactive-pollution-and-indoor-air-quality
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 69
    Unknown
    Air Quality (2010)
    Rijeka : InTech
    Details
    Keywords: oceanography ; atmospheric sciences ; air pollution ; air quality ; environmental engineering
    Description / Table of Contents: Air pollution is about five decades or so old field and continues to be a global concern. Therefore, the governments around the world are involved in managing air quality in their countries for the welfare of their citizens. The management of air pollution involves understanding air pollution sources, monitoring of contaminants, modeling air quality, performing laboratory experiments, the use of satellite images for quantifying air quality levels, indoor air pollution, and elimination of contaminants through control. Research activities are being performed on every aspect of air pollution throughout the world, in order to respond to public concerns. The book is grouped in five different sections. Some topics are more detailed than others. The readers should be aware that multi-authored books have difficulty maintaining consistency. A reader will find, however, that each chapter is intellectually stimulating. Our goal was to provide current information and present a reasonable analysis of air quality data compiled by knowledgeable professionals in the field of air pollution.
    Pages: Online-Ressource (382 Seiten)
    ISBN: 9789533071312
    URL: http://www.intechopen.com/books/show/title/air-quality
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 70
    Unknown
    Climate Change and Variability (2010)
    Rijeka : InTech
    Details
    Keywords: climate change
    Description / Table of Contents: Climate change is emerging as one of the most important issues of our time, with the potential to cause profound cascading effects on ecosystems and society. However, these effects are poorly understood and our projections for climate change trends and effects have thus far proven to be inaccurate. In this collection of 24 chapters, we present a cross-section of some of the most challenging issues related to oceans, lakes, forests, and agricultural systems under a changing climate. The authors present evidence for changes and variability in climatic and atmospheric conditions, investigate some the impacts that climate change is having on the Earth's ecological and social systems, and provide novel ideas, advances and applications for mitigation and adaptation of our socio-ecological systems to climate change. Difficult questions are asked. What have been some of the impacts of climate change on our natural and managed ecosystems? How do we manage for resilient socio-ecological systems? How do we predict the future? What are relevant climatic change and management scenarios? How can we shape management regimes to increase our adaptive capacity to climate change? These themes are visited across broad spatial and temporal scales, touch on important and relevant ecological patterns and processes, and represent broad geographic regions, from the tropics, to temperate and boreal regions, to the Arctic.
    Pages: Online-Ressource (486 Seiten)
    ISBN: 9789533071442
    URL: http://www.intechopen.com/books/show/title/climate-change-and-variability
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 71
    Unknown
    Astrobiology : and The Search for Life on Mars (2011)
    Open Humanities Press
    Details
    Keywords: astrobiology ; Mars ; life
    Description / Table of Contents: INTRODUCTION: WHAT IS LIFE? I’m not going to answer this question. In fact, I doubt if it will ever be possible to give a full answer. (Haldane, 1949: 58) What Is Life? J. B. S. Haldane (1949) and Erwin Schrödinger (1944), two of the twentieth century’s most influential scientists, posed the direct question, ‘what is life?’ and declared that it was a question unlikely to find an answer. Life, they suggested, might exceed the ability of science to represent it and even though the sciences of biology, physics and chemistry might usefully describe life’s structures, systems and processes, those sciences should not seek to reduce it to the sum of its parts. While Schrödinger drew attention to the physical structure of living matter, including especially the cell, Haldane asserted that ‘what is common to life is the chemical events’ (1949: 59) and so therefore life might be defined, though not reduced, to ‘a pattern of chemical processes’ (62) involving the use of oxygen, enzymes and so on. Following Schrödinger and Haldane, Chris McKay’s article, published in 2004 and included in this collection, asks again ‘What is Life – and How Do We Search For It in Other Worlds?’. For him, the still open and unresolved question of life is intrinsically linked to the problem of how to find it (here, or elsewhere) since, he queries, how can we search for something that we cannot adequately define? It should be noted that this dilemma did not deter the founders of Artificial Life, a project that succeeded Artificial Intelligence and that sought to both simulate ‘life-as-we-know-it’ and synthesise ‘life-as-it-could-be’ by reducing life to the informational and therefore computational criteria of self-organisation, self-replication, evolution, autonomy and emergence (Langton, 1996: 40; Kember, 2003). McKay concedes that certain characteristics of life, such as metabolism and motion, can occur without biology, but rather than pursuing contestable (re)definitions of life that could not, for him, constitute the basis for a search, he prefers to ask a more pragmatic question: ‘what does life need?’. The elements that support life – energy, carbon, liquid water, nitrogen, sulphur and phosphorus – are not contested and, barring only liquid water, they are abundant in the Solar System. It seems logical then, McKay argues, to search for life indirectly, by looking at where the water is. The case for liquid water on Mars has, as we will see, a long and argumentative history. In as far as the current case is, as McKay maintains, ‘tight’, then there is justification for his upbeat assessment that, with the correct instruments, it should be possible to find life-as-we-know-it – and even life-as-it-could-be. He writes: ‘while it could be similar at the top (ecological) and bottom (chemical) levels, life on Mars could be quite alien in the middle, in the realm of biochemistry’ (2004: 1261).
    URL: http://www.livingbooksaboutlife.org/books/Astrobiology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 72
    Unknown
    The Systemic Dimension of Globalization (2011)
    Rijeka : InTech
    Details
    Keywords: globalization ; business ; management ; economics
    Description / Table of Contents: Today science is moving in the direction of synthesis of the achievements of various academic disciplines. The idea to prepare and present to the international academic milieu, a multidimensional approach to globalization phenomenon is an ambitious undertaking. The book The Systemic Dimension of Globalization consists of 14 chapters divided into three sections: Globalization and Complex Systems; Globalization and Social Systems; Globalization and Natural Systems. The Authors of respective chapters represent a great diversity of disciplines and methodological approaches as well as a variety of academic culture. This is the value of this book and this merit will be appreciated by a global community of scholars.
    Pages: Online-Ressource (288 Seiten)
    ISBN: 9789533073842
    URL: http://www.intechweb.org/books/show/title/the-systemic-dimension-of-globalization
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 73
    Unknown
    The Future Internet : Future Internet Assembly 2012: From Promises to Reality (2012)
    Berlin, Heidelberg : Springer
    Details
    Keywords: Computer science ; Computer communication systems ; Data mining ; Multimedia information systems ; Computers and civilization ; Management information systems ; Computer Science ; Computer Communication Networks ; Information Systems Applications (incl. Internet) ; Management of Computing and Information Systems ; Multimedia Information Systems ; Data Mining and Knowledge Discovery ; Computers and Society
    Description / Table of Contents: Irrespective of whether we use economic or societal metrics, the Internet is one of the most important technical infrastructures in existence today. It will serve as a catalyst for much of our innovation and prosperity in the future. A competitive Europe will require Internet connectivity and services beyond the capabilities offered by current technologies. Future Internet research is therefore a must. The Future Internet Assembly (FIA) is a successful and unique bi-annual conference that brings together participants of over 150 projects from several distinct but interrelated areas in the EU Framework Programme 7. The 20 full papers included in this volume were selected from 40 submissions, and are preceded by a vision paper describing the FIA Roadmap. The papers have been organized into topical sections on the foundations of Future Internet, the applications of Future Internet, Smart Cities, and Future Internet infrastructures
    Pages: Online-Ressource (XXV, 252 pages)
    ISBN: 9783642302411
    URL: https://link.springer.com/openurl?genre=book&isbn=978-3-642-30241-1
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 74
    Unknown
    Climate Change : Realities, Impacts Over Ice Cap, Sea Level and Risks (2013)
    Rijeka : InTech
    Details
    Keywords: climate change
    Description / Table of Contents: The Earth is the only planet in our solar system that supports life. The complex process of evolution occurred on Earth only because of some unique environmental conditions that were present: water, an oxygen-rich atmosphere, and a suitable surface temperature. Climate change refers to a statistically significant variation in either the mean state of the climate or in its variability, persisting for an extended period (typically decades or longer). Thus, it requires field of attention towards reduction in the rise in atmospheric temperature, by controlling emitted greenhouse gases into the atmosphere in order to preserve natural resources and by introducing new technologies on alternative fuels. This book presents the fundamental effect on the origin of climate change, impacts over ice cap, melting of Arctic ice, rise in sea level and related technologies that can be implemented to cultivate our land for agriculture, growing forestation to reduce the impact of temperature rise and disaster on human being as well as on other livelihood. This also need to strive for novel policies that world leader should adopt.
    Pages: Online-Ressource (508 Seiten)
    ISBN: 9789535109341
    URL: http://www.intechopen.com/books/climate-change-realities-impacts-over-ice-cap-sea-level-and-risks
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 75
    Unknown
    Organic Pollutants : Monitoring, Risk and Treatment (2013)
    Rijeka : InTech
    Details
    Keywords: environmental pollution ; environmental sciences
    Description / Table of Contents: Organic pollutants cause several environmental problems if discharged to air or water body. The occurrence of organic pollutants in the ecosystem, their risk and removal methods are very important issues .This book deals with several aspects of organic pollutants, especially in the light of organic pollutants monitoring, risk assessment as well as the practical application of different techniques for removing it from the environment. The book is divided into three sections contains 9 chapters. The first section explains monitoring of organic pollutants in soil and water. The second section discusse its risk to human, soil and plants. The third section focuse on the different treatment process for the removal of organic pollutants.
    Pages: Online-Ressource (229 Seiten)
    ISBN: 9789535109488
    URL: http://www.intechopen.com/books/organic-pollutants-monitoring-risk-and-treatment
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 76
    Unknown
    Technologies for Climate Change Adaptation : Coastal Erosion and Flooding (2010)
    Roskilde : UNEP Risø Centre
    Details
    Keywords: climate change ; adaptation technologies
    Description / Table of Contents: Sea level rise, more intense storm surges, and other climate change impacts will pose serious threats to large number of people living along the worlds coasts. This guidebook covers thirteen main adaptation technologies for coastal erosion and flooding due to climate change. For each technology, the authors present a technology description, its advantages and disadvantages, costs and benefits, institutional organisation requirements and detailed examples about its application. This guidebook is co-authored by Matthew M. Linham and Robert J. Nicholls from the University of Southampton. Professor Nicholls is one of the top international experts on coastal impacts and adaptation to climate change, with an emphasis on seal level rise. This guidebook will be a useful handbook for policy makers and coastal zone project planners. This publication is one of the adaptation and mitigation technology guidebooks produced as part of the GEF-funded Technology Needs Assessment (TNA) project. This project is undertaken by UNEP and URC in 36 developing countries.
    Pages: Online-Ressource (XII, 150 Seiten)
    ISBN: 9788755038554
    URL: http://www.unep.org/publications/contents/pub_details_search.asp?ID=6189
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 77
    Unknown
    Salt Tectonics, Sediments and Prospectivity (2012)
    London : The Geological Society
    Details
    Description / Table of Contents: In this timely volume, geoscientists from both industry and academia present a contemporary view of salt at a global scale. The studies examine the influence of salt on synkinematic sedimentation, its role in basin evolution and tectonics, and ultimately in hydrocarbon prospectivity. Recent improvements in seismic reflection, acquisition and processing techniques have led to significant advances in the understanding of salt and sediment interactions, both along the flanks of vertical or overturned salt margins, and in subsalt plays such as offshore Brazil. The book is broadly separated into five major themes covering a variety of geographical and process-linked topics. These are: halokinetic sequence stratigraphy, salt in passive margin settings, Central European salt basins, deformation within and adjacent to salt, and salt in contractional settings and salt glaciers.
    Pages: Online-Ressource (VII, 624 Seiten)
    ISBN: 9781862393417
    URL: http://sp.lyellcollection.org/content/363/1
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 78
    Unknown
    Ubuntu GNU/Linux : das umfassende Handbuch, aktuell zu Ubuntu 10.04 LTS "Lucid Lynx" (2010)
    Bonn : Galileo Press
    Details
    Keywords: Ubuntu
    Description / Table of Contents: Umfassender geht es nicht! Hier erfahren Sie alles, was man mit Ubuntu anstellen kann, aktuell zur Version 10.04 LTS 'Lucid Lynx'. Von der Installation, der Paketverwaltung über Optimierung, Programmierung, Migration und Kernelkompilierung bis hin zur Virtualisierung und Netzwerktechnik finden Sie alle wichtigen Fragen zu Ubuntu Linux in diesem Buch beantwortet. Darüber hinaus profitieren Sie von mehr als 250 eigens gekennzeichneten Tipps und Tricks sowie von zahlreichen Praxisworkshops. Dieses Buch macht Sie zum Ubuntu-Profi!
    Pages: Online-Ressource (1104 Seiten)
    Edition: 5., akt. und erw. Aufl.
    ISBN: 9783836216548
    URL: http://openbook.galileocomputing.de/ubuntu_1004/
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 79
    Unknown
    Military Aspects of Hydrogeology (2012)
    London : The Geological Society
    Details
    Description / Table of Contents: This book, generated under the auspices of the Geological Society of London's History of Geology and Hydrogeological Groups, contains 20 papers from authors in the UK, USA, Germany and Austria. Historically, it gives examples of the influence of groundwater on battlefield tactics and fortress construction; describes how groundwater was developed for water supply and overcome as an obstacle to military engineering and cross-country vehicular movement by both sides in World Wars I and II; and culminates with examples of the application of hydrogeology to site boreholes in recent conflicts, notably in Afghanistan. Examples of current research described include hydrological model development; the impact of variations in soil moisture on explosive threat detection and cross-country vehicle mobility; contamination arising from defence sites and its remediation; privatization of water supplies; and the equitable allocation of resources derived from an international transboundary aquifer.
    Pages: Online-Ressource (VIII, 374 Seiten)
    ISBN: 9781862393400
    URL: http://sp.lyellcollection.org/content/362/1.toc
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 80
    Unknown
    Sustainable Low-Carbon City Development in China / Part 2 (2012)
    Washington, D. C. : The World Bank
    Details
    Keywords: energy ; lowcarbon city ; solid waste management ; sustainable development ; urban development ; urban transport
    Description / Table of Contents: The continuing rapid growth and development of China’s cities brings many complex challenges. Tasked with supporting strong economic development that provides jobs and a good quality of life for its growing number of residents, China’s cities also must ensure sustainable development in line with national efforts to transition to a less carbon-intensive economy, as outlined in China’s 12th Five-Year Plan. Sustainable Low-Carbon City Development in China summarizes, through the specific lens of low-carbon development, the lessons of the World Bank’s activities related to sustainable urban development in China. The various chapters present overall approaches and achievements in low-carbon city developments and highlight specific experiences across all urban sectors, including energy, transport, solid waste, water, and waste water. The book also explores cities’ role in climate adaptation and opportunities presented by carbon finance and other global mechanisms to finance low-carbon city development. The World Bank project data and experience combined with the national and international experience presented in this edited book deliver both a broad picture and actionable steps for China’s urban development. The chapters argue that China’s cities not only need to, but also have an opportunity and the ability to integrate sustainable low-carbon development in their urban development. Low-carbon efforts align closely with the sustainable urbanization agenda and the book points to multiple benefits, such as improved air quality and urban livability, that can be derived from implementing this urgent agenda. The intended audience of this edited book is government officials of municipalities, cities, and townships in China who will be defining policies and programs to achieve the targets of economic growth and carbon emission reductions emerging from the 12th Five-Year Plan. The lessons presented may also be of interest to other countries and development partners supporting low-carbon urban programs.
    Pages: Online-Ressource (LXVII, 516 Seiten)
    ISBN: 9780821389881
    URL: http://issuu.com/world.bank.publications/docs/9780821389874_part_2
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 81
    Unknown
    Handbook of Climate Change Mitigation (2012)
    New York, Dordrecht, Heidelberg, London : Springer
    Details
    Keywords: climate change ; mitigation ; fossil energy ; alternative energy ; renewable energy ; solar energy ; biofuel ; atmospheric carbon ; energy conservation ; advanced combustion ; emission ; fuel cells ; precipitation ; sustainability
    Description / Table of Contents: There is a mounting consensus that human behavior is changing the global climate and its consequence could be catastrophic. Reducing the 24 billion metric tons of carbon dioxide emissions from stationary and mobile sources is a gigantic task involving both technological challenges and monumental financial and societal costs. The pursuit of sustainable energy resources, environment, and economy has become a complex issue of global scale that affects the daily life of every citizen of the world. The present mitigation activities range from energy conservation, carbon-neutral energy conversions, carbon advanced combustion process that produce no greenhouse gases and that enable carbon capture and sequestion, to other advanced technologies. From its causes and impacts to its solutions, the issues surrounding climate change involve multidisciplinary science and technology. This handbook will provide a single source of this information. The book will be divided into the following sections: Scientific Evidence of Climate Change and Societal Issues, Impacts of Climate Change, Energy Conservation, Alternative Energies, Advanced Combustion, Advanced Technologies, and Education and Outreach.
    Pages: Online-Ressource (XXVII, 2130 Seiten)
    ISBN: 9781441979919
    URL: http://link.springer.com/referencework/10.1007/978-1-4419-7991-9
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 82
    Unknown
    Doppler Radar Observations : Weather Radar, Wind Profiler, Ionospheric Radar, and Other Advanced Applications (2012)
    Rijeka : InTech
    Details
    Keywords: Doppler technique ; earth observation ; radar ; earth and planetary sciences
    Description / Table of Contents: Doppler radar systems have been instrumental to improve our understanding and monitoring capabilities of phenomena taking place in the low, middle, and upper atmosphere. Weather radars, wind profilers, and incoherent and coherent scatter radars implementing Doppler techniques are now used routinely both in research and operational applications by scientists and practitioners. This book brings together a collection of eighteen essays by international leading authors devoted to different applications of ground based Doppler radars. Topics covered include, among others, severe weather surveillance, precipitation estimation and nowcasting, wind and turbulence retrievals, ionospheric radar and volcanological applications of Doppler radar. The book is ideally suited for graduate students looking for an introduction to the field or professionals intending to refresh or update their knowledge on Doppler radar applications.
    Pages: Online-Ressource (470 Seiten)
    ISBN: 9789535104964
    URL: http://www.intechopen.com/books/doppler-radar-observations-weather-radar-wind-profiler-ionospheric-radar-and-other-advanced-applications
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 83
    Unknown
    Earthquake Research and Analysis : Statistical Studies, Observations and Planning (2012)
    Rijeka : InTech
    Details
    Keywords: earthquake ; seismology ; geology ; geophysics
    Description / Table of Contents: The study of earthquakes plays a key role in order to minimize human and material losses when they inevitably occur. Chapters in this book will be devoted to various aspects of earthquake research and analysis. The different sections present in the book span from statistical seismology studies, the latest techniques and advances on earthquake precursors and forecasting, as well as, new methods for early detection, data acquisition and interpretation. The topics are tackled from theoretical advances to practical applications.
    Pages: Online-Ressource (460 Seiten)
    ISBN: 9789535101345
    URL: http://www.intechopen.com/books/earthquake-research-and-analysis-statistical-studies-observations-and-planning
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 84
    Unknown
    Climate Models (2012)
    Rijeka : InTech
    Details
    Keywords: climate change ; oceanography ; atmospheric sciences
    Description / Table of Contents: Climate Models offers a sampling of cutting edge research contributed by an international roster of scientists. The studies strive to improve our understanding of the physical environment for life on this planet. Each of the 14 essays presents a description of recent advances in methodologies for computer-based simulation of environmental variability. Subjects range from planetary-scale phenomena to regional ecology, from impacts of air pollution to the factors influencing floods and heat waves. The discerning reader will be rewarded with new insights concerning modern techniques for the investigation of the natural world.
    Pages: Online-Ressource (336 Seiten)
    ISBN: 9789535101352
    URL: http://www.intechopen.com/books/climate-models
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 85
    Unknown
    Global Warming Impacts : Case Studies on the Economy, Human Health, and on Urban and Natural Environments (2011)
    Rijeka : InTech
    Details
    Keywords: climate change ; global warming
    Description / Table of Contents: This book addresses the theme of the impacts of global warming on different specific fields, ranging from the regional and global economy, to agriculture, human health, urban areas, land vegetation, marine areas and mangroves. Despite the volume of scientific work that has been undertaken in relation to each of each of these issues, the study of the impacts of global warming upon them is a relatively recent and unexplored topic. The chapters of this book offer a broad overview of potential applications of global warming science. As this science continues to evolve, confirm and reject study hypotheses, it is hoped that that this book will stimulate further developments in relation to the impacts of changes in the global climate.
    Pages: Online-Ressource (290 Seiten)
    ISBN: 9789533077857
    URL: http://www.intechopen.com/books/show/title/global-warming-impacts-case-studies-on-the-economy-human-health-and-on-urban-and-natural-environments
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 86
    facet.materialart.
    Unknown
    Interconnection of the Trinity (Glen Rose) and Edwards Aquifers along the Balcones Fault Zone and Related Topics : Proceedings of the Karst Conservation Initiative Meeting held in February 17, 2011 at The University of Texas at Austin (2011)
    Austin, Texas : Zara Environmental LLC
    Details
    Keywords: edwards aquifer ; trinity aquifer ; hydraulic interaction
    Description / Table of Contents: The Edwards and Trinity Aquifers are critical water resources, supplying high-quality potable water to over two million people in the greater Austin-San Antonio region of central Texas, USA. These Cretaceous carbonate aquifers are hydrogeologically juxtaposed by extensive Miocene tectonic deformation associated with the Balcones Fault Zone, where the younger Edwards Group limestone has been downthrown relative to the older Trinity Group. The karstic aquifers are managed separately by regional water regulatory entities, and they have been historically treated as independent systems, both scientifically and from a water policy standpoint. Recent awareness of a significant interconnection between the Edwards and Trinity Aquifers has resulted in a number of hydrogeologic investigations documenting how they may actually operate as a single system. Studies related to upland recharge variability (spatial and temporal), stream loss, phreatic dye tracing, multi-port well monitoring, geochemistry, biologic habitat analysis, geophysics, and groundwater modeling indicate that the two are much less separated than previously observed. Summaries of these investigations conclude that changes in management strategies may be required to properly protect the quantity and quality of water in the Edwards and Trinity Aquifers. The proceedings volume contains nine contributions presented during the Karst Conservation Initiative Meeting held in February 17, 2011 at The University of Texas at Austin.
    Pages: Online-Ressource (45 Seiten)
    URL: http://www.speleogenesis.info/content/?vmode=article&id=9869
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 87
    Unknown
    Biomass : Detection, Production and Usage (2011)
    Rijeka : InTech
    Details
    Keywords: environmental remote sensing ; biomass
    Description / Table of Contents: Biomass has been an intimate companion of humans from the dawn of civilization to the present. Its use as food, energy source, body cover and as construction material established the key areas of biomass usage that extend to this day. Given the complexities of biomass as a source of multiple end products, this volume sheds new light to the whole spectrum of biomass related topics by highlighting the new and reviewing the existing methods of its detection, production and usage. We hope that the readers will find valuable information and exciting new material in its chapters.
    Pages: Online-Ressource (496 Seiten)
    ISBN: 9789533074924
    URL: http://www.intechopen.com/books/show/title/biomass-detection-production-and-usage
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 88
    Unknown
    The Formation and Evolution of Africa: A Synopsis of 3.8 Ga of Earth History (2011)
    London : The Geological Society
    Details
    Description / Table of Contents: The African continent preserves a long geological record that covers almost 75% of Earth's history. The Pan-Africanorogeny (c.600–500 Ma) brought together old continental kernels (West Africa, Congo, Kalahari and Tanzania) to form Gondwana and subsequently the supercontinent Pangaea by the late Palaeozoic. The break-up of Pangaea since the Jurassic and Cretaceous, primarily through opening of the Central Atlantic, Indian, and South Atlantic oceans, in combination with the complicated subduction history to the north, gradually shaped the African continent. This volume contains 18 contributions that discuss the geology of Africa from the Archaean to the present day. It celebrates African geology in two ways: first, it highlights multidisciplinary Earth science research by viewing the formation and evolution of Africa from 18 different angles; second, it celebrates the work of Kevin Burke and Lewis Ashwal and portrays the wide range of interests and research angles that have characterized these two scientists throughout their careers, working in Africa, and studying African geology.
    Pages: Online-Ressource (VI, 378 Seiten)
    ISBN: 9781862393356
    URL: http://sp.lyellcollection.org/content/vol357/issue1/
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 89
    Unknown
    Soil Erosion Issues in Agriculture (2011)
    Rijeka : InTech
    Details
    Keywords: soil science
    Description / Table of Contents: The book deals with several aspects of soil erosion, focusing on its connection with the agricultural world. Chapters’ topics are various, ranging from irrigation practices to soil nutrient, land use changes or tillage methodologies. The book is subdivided into fourteen chapters, sorted in four sections, grouping different facets of the topic: introductive case studies, erosion management in vineyards, soil erosion issue in dry environments, and erosion control practices. Certainly, due to the extent of the subject, the book is not a comprehensive collection of soil erosion studies, but it aims to supply a sound set of scientific works, concerning the topic. It analyzes different facets of the issue, with various methodologies, and offers a wide series of case studies, solutions, practices, or suggestions to properly face soil erosion and, moreover, may provide new ideas and starting points for future researches.
    Pages: Online-Ressource (334 Seiten)
    ISBN: 9789533074351
    URL: http://www.intechweb.org/books/show/title/soil-erosion-issues-in-agriculture
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 90
    Unknown
    Biomass and Remote Sensing of Biomass (2011)
    Rijeka : InTech
    Details
    Keywords: environmental remote sensing ; biomass
    Description / Table of Contents: Generally, the term biomass is used for all materials originating from photosynthesis. However, biomass can equally apply to animals. Conservation and management of biomass is very important. There are various ways and methods for biomass evaluation. One of these methods is remote sensing. Remote sensing provides information about biomass, but also about biodiversity and environmental factors estimation over a wide area. The great potential of remote sensing has received considerable attention over the last few decades in many different areas in biological sciences including nutrient status assessment, weed abundance, deforestation, glacial features in Arctic and Antarctic regions, depth sounding of coastal and ocean depths, and density mapping. The salient features of the book include: Several aspects of biomass study and survey Use of remote sensing for evaluation of biomass Evaluation of carbon storage in ecosystems Evaluation of primary productivity through case studies.
    Pages: Online-Ressource (262 Seiten)
    ISBN: 9789533074900
    URL: http://www.intechweb.org/books/show/title/biomass-and-remote-sensing-of-biomass
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 91
    Unknown
    Tsunamis in the World Ocean: Past, Present and Future, Volume I (2011)
    Basel, Boston, Berlin : Birkhäuser
    Details
    Keywords: Tsunami ; Natural Hazards
    Description / Table of Contents: The Tsunami from the 1960 Chilean earthquake affected the entire Pacific Ocean and motivated the international coordination on tsunami research and warning systems around the Pacific. However, the 2004 Indian Ocean tsunami affected the entire world, and reminded that tsunamis are not a local or regional problem but a global issue. This volume contains 18 papers, mostly presented at the 24th International Tsunami Symposium held in 14-16 July 2009. They reflect the current state of tsunami science, including case studies of earthquake-generated tsunamis, tsunami forecasting and hazard assessments, and theoretical and computational modeling of tsunami generation, propagation and coastal behavior.
    Pages: Online-Ressource (290 Seiten)
    ISBN: 9783034801874
    URL: http://link.springer.com/journal/24/168/6/
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 92
    Unknown
    Tsunamis in the World Ocean: Past, Present and Future, Volume II (2012)
    Basel, Boston, Berlin : Birkhäuser
    Details
    Keywords: Tsunami ; Natural Hazards
    Description / Table of Contents: The tsunami from the 1960 Chilean earthquake affected the entire Pacific Ocean and motivated the international coordination of tsunami research and warning systems around the Pacific. However, the 2004 Indian Ocean tsunami affected the entire world, and reminded that tsunamis are not a local or regional problem but a global issue. This volume contains 15 papers, mostly presented at the 24th International Tsunami Symposium held on 14-16 July 2009 in Novosibirsk, Russia. They reflect the current state of tsunami science, including studies of recent tsunamis, tsunami statistics and warning, and modeling tsunami runup and inundation.
    Pages: Online-Ressource (VI, 233 Seiten)
    ISBN: 9783034802338
    URL: http://link.springer.com/journal/24/168/11/
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 93
    Unknown
    Advanced Seismic Hazard Assessment, Part I : Seismic Hazard Assessment (2011)
    Basel, Boston, Berlin : Birkhäuser
    Details
    Keywords: Earthquake predition ; Ground motion prediction ; Neo-deterministic seismic hazard assessments ; Probabilistic seismic hazard assessments ; Seismic risk analysis ; Seismic wave propagation
    Description / Table of Contents: Issues pertaining to urban risks are a pressing concern for those involved in disasters mitigation. Development of effective mitigation strategies requires sound seismic hazard information that is commonly derived through a seismic hazard assessment (SHA). The purpose of SHA is to provide a scientifically consistent estimate of seismic hazard for engineering design and other considerations. The time is ripe to move beyond the old paradigms of the traditional Probabilistic Seismic Hazard Analysis (PSHA). This two-part volume advocates advanced methods for SHA that utilize up to date earthquake science and basic scientific principles to derive the seismic hazard in terms of a ground motion or related quantity and its occurrence frequency at a site, as well as the associated uncertainty. It aims to: 1) identify the issues in the current SHAs, 2) facilitate the development of a scientifically consistent approach for SHA and 3) disseminate, both in scientific and in engineering practice societies, advanced reliable tools for independent hazard estimates, like NDSHA (neo-deterministic SHA), which incorporates physically based ground motion models. It provides a fresh approach to seismic hazard analysis. Part 1 deals with the general issues of SHA methodology review and development, as well as with recent advances in earthquake science that may have relevant implications toward an improved SHA. It is addressed to seismologists, engineers and stake-holders, and aims to contribute to bridging between modern interdisciplinary research and practitioners.
    Pages: Online-Ressource (366 Seiten)
    ISBN: 9783034800396
    URL: http://link.springer.com/journal/24/168/1/
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 94
    Unknown
    Geodynamics of the Mexican Pacific Margin (2011)
    Basel, Boston, Berlin : Birkhäuser
    Details
    Description / Table of Contents: “Geodynamics of the Mexican Pacific Margin” presents the results of studies from various disciplines whose common goal is to better understand the complex geodynamic processes that exist along the Pacific margin of Mexico. The seventeen papers include contributions in the fields of seismology, marine geophysics, geomorphology, petrology, geodesy, and subductology presented by investigators from Mexico, France, Spain, and the USA. These contributions illustrate why the Mexican Pacific margin is fertile ground for investigating a wide and rare combination of current geodynamic processes such as subduction, continental rifting and associated seismicity, deformations and magmatism. The volume will be useful to a diverse group of investigators whose interests include the geodynamics of western Mexico in particular, and geodynamics in general.
    Pages: Online-Ressource (284 Seiten)
    ISBN: 9783034801966
    URL: http://link.springer.com/journal/24/168/8/
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 95
    Unknown
    Atmospheric Aerosols : Regional Characteristics - Chemistry and Physics (2012)
    Rijeka : InTech
    Details
    Keywords: oceanography ; atmospheric sciences ; aerosols
    Description / Table of Contents: The book is divided into two sections. The first section presents characterization of atmospheric aerosols and their impact on regional climate from East Asia to the Pacific. Ground-based, air-born, and satellite data were collected and analyzed. Detailed information about measurement techniques and atmospheric conditions were provided as well. In the second section, authors provide detailed information about the organic and inorganic constituents of atmospheric aerosols. They discuss the chemical and physical processes, temporal and spatial distribution, emissions, formation, and transportation of aerosol particles. In addition, new measurement techniques are introduced. This book hopes to serve as a useful resource to resolve some of the issues associated with the complex nature of the interaction between atmospheric aerosols and climatology.
    Pages: Online-Ressource (480 Seiten)
    ISBN: 9789535107286
    URL: http://www.intechopen.com/books/atmospheric-aerosols-regional-characteristics-chemistry-and-physics
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 96
    Unknown
    Advanced Aspects of Spectroscopy (2012)
    Rijeka : InTech
    Details
    Keywords: organic chemistry ; spectroscopy
    Description / Table of Contents: Spectroscopy is the study of absorption and emission of electromagnetic radiation due to the interaction between matter and energy that energy depends on the specific wavelength of electromagnetic radiation. This field has proven invaluable research tool in a number of areas including chemistry, physics, biology, medicine and ecology. The spectroscopic field of research is growing day-by-day and scientists are exploring new areas in this field by introducing new techniques. The main purpose of this book is to highlight these new spectroscopic techniques like Magnetic Induction Spectroscopy, Laser-Induced Breakdown Spectroscopy, X-ray Photoelectron Spectroscopy, Low Energy Electron Loss Spectroscopy, Micro- to Macro-Raman Spectroscopy, Liquid-Immersion Raman Spectroscopy, High-Resolution Magic Angle Spinning (HR-MAS) Nuclear Magnetic Resonance (NMR) Spectroscopy, Injection and Optical Spectroscopy, and Nano Spectroscopy. This book is divided into five sections including General Spectroscopy, Advanced Spectroscopy, Nano Spectroscopy, Organic Spectroscopy, and Physical Spectroscopy which cover topics from basic to advanced levels which will provide a good source of learning for teaching and research purposes.
    Pages: Online-Ressource (538 Seiten)
    ISBN: 9789535107156
    URL: http://www.intechopen.com/books/advanced-aspects-of-spectroscopy
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 97
    Unknown
    Increasing the Knowledge and Awareness of Carbon Capture and Storage: Capacity-Building in the APEC Region (Phase V) : Final Report ; Workshops in Viet Nam and Mexico (2012)
    Singapore : APEC Secretariat
    Details
    Description / Table of Contents: This report summaries two capacity-building workshops on Carbon Capture and Storage (CCS) were held: in Hanoi, Viet Nam, in December 2011, and in Mexico City, Mexico, in June 2012, as part of the Asia Pacific Economic Cooperation’s (APEC) ongoing series of CCS capacity building workshops in developing APEC economies.
    Pages: Online-Ressource (95 Seiten)
    URL: http://publications.apec.org/publication-detail.php?pub_id=1328
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 98
    Unknown
    Research on Soil Erosion (2012)
    Rijeka : InTech
    Details
    Keywords: soil science ; soil erosion ; soil loss ; soil dynamics
    Description / Table of Contents: Soil loss for erosion is a natural phenomenon in soil dynamics, influenced by climate, soil intrinsic properties, and morphology, that can both trigger and enhance the process. Anthropic activities, like inappropriate agricultural practices, deforestation, overgrazing, forest fires and construction activities, may exert a remarkable impact on erosion processes or, on the other hand, contribute to soil erosion mitigation through a sustainable management of natural resources. The book is the continuation of previously published "Soil Erosion Studies"; it is organized in a unique section collecting nine chapters focusing on a variety of aspects of the erosion phenomena.
    Pages: Online-Ressource (191 Seiten)
    ISBN: 9789535108399
    URL: http://www.intechopen.com/books/research-on-soil-erosion
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 99
    Unknown
    Biodiesel : Quality, Emissions and By-Products (2011)
    Rijeka : InTech
    Details
    Keywords: energy engineering ; renewable resources
    Description / Table of Contents: This book entitled "Biodiesel: Quality, Emissions and By-products" covers topics related to biodiesel quality, performance of combustion engines that use biodiesel and the emissions they generate. New routes to determinate biodiesel properties are proposed and the process how the raw material source, impurities and production practices can affect the quality of the biodiesel is analyzed. In relation to the utilization of biofuel, the performance of combustion engines fuelled by biodiesel and biodiesels blends are evaluated. The applications of glycerol, a byproduct of the biodiesel production process as a feedstock for biotechnological processes, and a key compound of the biorefinery of the future is also emphasized.
    Pages: Online-Ressource (380 Seiten)
    ISBN: 9789533077840
    URL: http://www.intechopen.com/books/show/title/biodiesel-quality-emissions-and-by-products
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 100
    Unknown
    Solar Cells : Silicon Wafer-Based Technologies (2011)
    Rijeka : InTech
    Details
    Keywords: energy engineering ; renewable resources
    Description / Table of Contents: The third book of four-volume edition of 'Solar Cells' is devoted to solar cells based on silicon wafers, i.e., the main material used in today's photovoltaics. The volume includes the chapters that present new results of research aimed to improve efficiency, to reduce consumption of materials and to lower cost of wafer-based silicon solar cells as well as new methods of research and testing of the devices. Light trapping design in c-Si and mc-Si solar cells, solar-energy conversion as a function of the geometric-concentration factor, design criteria for spacecraft solar arrays are considered in several chapters. A system for the micrometric characterization of solar cells, for identifying the electrical parameters of PV solar generators, a new model for extracting the physical parameters of solar cells, LBIC method for characterization of solar cells, non-idealities in the I-V characteristic of the PV generators are discussed in other chapters of the volume.
    Pages: Online-Ressource (364 Seiten)
    ISBN: 9789533077475
    URL: http://www.intechopen.com/books/show/title/solar-cells-silicon-wafer-based-technologies
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...