ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • 2010-2014  (3,084,839)
  • 2005-2009  (2,103,029)
Collection
Language
Years
Year
  • 101
    Call number: S 97.0188(22, 1) / Mag. 38
    In: 22e Conférence Générale des Poids et Mesures (CGPM)
    In: Comptes rendus des séances de la ... Conférence Générale des Poids et Mesures (CGPM)
    Type of Medium: Series available for loan
    Pages: 449 S.
    ISBN: 9282222098
    Series Statement: 22e Conférence Générale des Poids et Mesures (CGPM) / Bureau International des Poids et Mesures, Organisation Intergouvernementale de la Convention du Mètre [1]
    Location: Magazine - must be ordered
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 102
    Series available for loan
    Series available for loan
    Bremerhaven : Alfred-Wegener-Inst. für Polar- und Meeresforschung
    Associated volumes
    Call number: ZS-090(533) ; ZSP-168-533
    In: Berichte zur Polar- und Meeresforschung
    Type of Medium: Series available for loan
    Pages: 246 S. , Ill., graph. Darst., Kt.
    ISSN: 1618-3193
    Series Statement: Berichte zur Polar- und Meeresforschung 533
    Classification:
    Oceanology
    Location: Lower compact magazine
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 103
    Monograph available for loan
    Monograph available for loan
    Cambridge, Mass [u.a.] : MIT Press
    Call number: PIK D 024-06-0327
    Type of Medium: Monograph available for loan
    Pages: XVI, 319 S. , graph. Darst.
    ISBN: 0262511932 , 0-262-01227-8
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 104
    Monograph available for loan
    Monograph available for loan
    Cambridge [u.a.] : Cambridge Univ. Press
    Call number: IASS 16.90120
    Type of Medium: Monograph available for loan
    Pages: X, 188 S. , graph. Darst.
    Edition: 1. publ. 2007, 11. print. 2014
    ISBN: 9780521873208 ((hardback)) , 9780521694810 ((paperback))
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 105
    Monograph available for loan
    Monograph available for loan
    Helsinki : Avain Publ.
    Call number: IASS 16.89649
    Type of Medium: Monograph available for loan
    Pages: 200 S. , Ill., graph. Darst.
    Edition: 2nd edition
    ISBN: 9789516928466
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 106
    Monograph available for loan
    Monograph available for loan
    Berlin : Springer
    Call number: 6/M 16.89656
    Description / Table of Contents: Geodetic datum (including coordinate datum, height datum, depth datum, gravimetry datum) and geodetic systems (including geodetic coordinate system, plane coordinate system, height system, gravimetry system) are the common foundations for every aspect of geomatics. This course book focuses on geodetic datum and geodetic systems, and describes the basic theories, techniques, methods of geodesy. The main themes include: the various techniques of geodetic data acquisition, geodetic datum and geodetic control networks, geoid and height systems, reference ellipsoid and geodetic coordinate systems, Gaussian projection and Gaussian plan coordinates and the establishment of geodetic coordinate systems. The framework of this book is based on several decades of lecture noted and the contents are developed systematically for a complete introduction to the geodetic foundations of geomatics.
    Description / Table of Contents: REVIEW: "The present work integrates both classical materials and modern developments in geodesy, it describes pure theoretical approaches and recent practical applications. The book can be used as a general textbook for undergraduates studying geomatics and survejing and mapping in higher education institutions. For technicians who are engaged in geomatic and surveying engineering, the book is strongly recommended as a basic and useful reference guide."
    Type of Medium: Monograph available for loan
    Pages: XXI, 401 S.
    ISBN: 9783642412455 , 9783642412448
    Classification:
    Geodesy
    Language: English
    Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 107
    Call number: M 16.89708
    Type of Medium: Monograph available for loan
    Pages: 60 S.
    ISBN: 9783831644964
    Series Statement: acatech IMPULS
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 108
    Type of Medium: Monograph available for loan
    ISBN: 9783775727723
    Language: German , English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 109
    Monograph available for loan
    Monograph available for loan
    Cham [u.a.] : Springer
    Call number: PIK M 370-15-89030
    Type of Medium: Monograph available for loan
    Pages: XVIII, 445 S. , graph. Darst.
    ISBN: 978-3-319-10276-4
    Series Statement: Systems & Control: Foundations & Applications
    Language: English
    Note: Contents: Linear Control Systems ; The Dynamic Programming Approach ; Ellipsoidal Techniques: Reachability and Control Synthesis ; Solution Examples on Ellipsoidal Methods: Computation in High Dimensions ; The Comparison Principle: Nonlinearity and Nonconvexity ; Impulse Controls and Double Constraints ; Dynamics and Control Under State Constraints ; Trajectory Tubes State-Constrained Feedback Control ; Guaranteed State Estimation ; Uncertain Systems: Output Feedback Control ; Verification: Hybrid Systems
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 110
    Monograph available for loan
    Monograph available for loan
    Chantilly, Va. : Mineralogical Society of America
    Associated volumes
    Call number: 11/M 06.0469
    In: Reviews in mineralogy & geochemistry
    Description / Table of Contents: The importance of sulfide minerals in ores has long been, and continues to be, a major reason for the interest of mineralogists and geochemists in these materials. Determining the fundamental chemistry of sulfides is key to understanding their conditions of formation and, hence, the geological processes by which certain ore deposits have formed. This, in turn, may inform the strategies used in exploration for such deposits and their subsequent exploitation. In this context, knowledge of structures, stabilities, phase relations and transformations, together with the relevant thermodynamic and kinetic data, is critical. As with many geochemical systems, much can also be learned from isotopic studies. The practical contributions of mineralogists and geochemists to sulfide studies extend beyond areas related to geological applications. The mining of sulfide ores, to satisfy ever increasing world demand for metals, now involves extracting very large volumes of rock that contains a few percent at most (and commonly less than one percent) of the metal being mined. This is true of relatively low value metals such as copper; for the precious metals commonly occurring as sulfides, or associated with them, the mineable concentrations (grades) are very much lower. The "as-mined" ores therefore require extensive processing in order to produce a concentrate with a much higher percentage content of the metal being extracted. Such mineral processing (beneficiation) involves crushing and grinding of the ores to a very fine grain size in order to liberate the valuable metal-bearing (sulfide) minerals which can then be concentrated. In some cases, the metalliferous (sulfide) minerals may have specific electrical or magnetic properties that can be exploited to enable separation and, hence, concentration. More commonly, froth flotation is used, whereby the surfaces of particles of a particular mineral phase are rendered water repellent by the addition of chemical reagents and hence are attracted to air bubbles pulsed through a mineral particle-water-reagent pulp. An understanding of the surface chemistry and surface reactivity of sulfide minerals is central to this major industrial process and, of course, knowledge of electrical and magnetic properties is very important in cases where those particular properties can be utilized. In the years since the publication of the first ever Reviews in Mineralogy volume (1974, at that time called MSA "Short Course Notes") which was entitled Sulfide Mineralogy, sulfides have become a focus of research interest for reasons centering on at least two other areas in addition to their key role in ore deposit studies and mineral processing technology. It is in these two new areas that much of the research on sulfides has been concentrated in recent years. The first of these areas relates to the capacity of sulfides to react with natural waters and acidify them; the resulting Acid Rock Drainage (ARD), or Acid Mine Drainage (AMD) where the sulfides are the waste products of mining, has the capacity to damage or destroy vegetation, fish and other aquatic life forms. These acid waters may also accelerate the dissolution of associated minerals containing potentially toxic elements (e.g., As, Pb, Cd, Hg, etc.) and these may, in turn, cause environmental damage. The much greater public awareness of the need to prevent or control AMD and toxic metal pollution has led to regulation and legislation in many parts of the world, and to the funding of research programs aimed at a greater understanding of the factors controlling the breakdown of sulfide minerals. We begin with a review of analytical methods for measuring and calibrating water contents in nominally anhydrous minerals by George Rossman. While infrared spectroscopy is still the most sensitive and most convenient method for detecting water in minerals, it is not intrinsically quantitative but requires calibration by some other, independent analytical method, such as nuclear reaction analysis, hydrogen manometry, or SIMS. A particular advantage of infrared spectroscopy, however, is the fact that it does not only probe the concentration, but also the structure of hydrous species in a mineral and in many cases the precise location of a proton in a mineral structure can be worked out based on infrared spectra alone. The methods and principles behind this are reviewed by Eugen Libowitzky and Anton Beran, with many illustrative examples. Compared to infrared spectroscopy, NMR is much less used in studying hydrogen in minerals, mostly due to its lower sensitivity, the requirement of samples free of paramagnetic ions such as Fe2+ and because of the more complicated instrumentation required for NMR measurements. However, NMR could be very useful under some circumstances. It could detect any hydrogen species in a sample, including such species as H2 that would be invisible with infrared. Potential applications of NMR to the study of hydrogen in minerals are reviewed by Simon Kohn. While structural models of "water" in minerals have already been deduced from infrared spectra several decades ago, in recent years atomistic modeling has become a powerful tool for predicting potential sites for hydrogen in minerals. The review by Kate Wright gives an overview over both quantum mechanical methods and classical methods based on interatomic potentials. Joseph Smyth then summarizes the crystal chemistry of hydrogen in high-pressure silicate and oxide minerals. As a general rule, the incorporation of hydrogen is not controlled by the size of potential sites in the crystal lattice; rather, the protons will preferentially attach to oxygen atoms that are electrostatically underbonded, such as the non-silicate oxygen atoms in some high-pressure phases. Moreover, heterovalent substitutions, e.g., the substitution of Al3+ for Si4+, can have a major effect on the incorporation of hydrogen. The second reason for even greater research interest in sulfide minerals arose initially from the discoveries of active hydrothermal systems in the deep oceans. The presence of life forms that have chemical rather than photosynthetic metabolisms, and that occur in association with newly-forming sulfides, has encouraged research on the potential of sulfide surfaces in catalyzing the reactions leading to assembling of the complex molecules needed for life on Earth. These developments have been associated with a great upsurge of interest in the interactions between microbes and minerals, and in the role that minerals can play in biological systems. In the rapidly growing field of geomicrobiology, metal sulfides are of major interest. This interest is related to a variety of processes including, for example, those where bacteria interact with sulfides as part of their metabolic activity and cause chemical changes such as oxidation or reduction, or those in which biogenic sulfide minerals perform a specific function, such as that of navigation in magnetotactic bacteria. The development of research in areas such as geomicrobiology and environmental mineralogy and geochemistry, is also leading to a greater appreciation of the role of sulfides (particularly the iron sulfides) in the geochemical cycling of the elements at or near the surface of the Earth. For example, the iron sulfides precipitated in the reducing environments beneath the surface of modern sediments in many estuarine areas may play a key role in the trapping of toxic metals and other pollutants. In our understanding of "Earth Systems," geochemical processes involving metal sulfides are an important part of the story. The main objective of the present text is to provide an up-to-date review of sulfide mineralogy and geochemistry. The emphasis is, therefore, on such topics as crystal structure and classification, electrical and magnetic properties, spectroscopic studies, chemical bonding, high and low temperature phase relations, thermochemistry, and stable isotope systematics. In the context of this book, emphasis is on metal sulfides sensu stricto where only the compounds of sulfur with one or more metals are considered. Where it is appropriate for comparison, there is brief discussion of the selenide or telluride analogs of the metal sulfides. When discussing crystal structures and structural relationships, the sulfosalt minerals as well as the sulfides are considered in some detail (see Chapter 2; also for definition of the term "sulfosalt"). However, in other chapters there is only limited discussion of sulfosalts, in part because there is little information available beyond knowledge of chemical composition and crystal structure. Given the dramatic developments in areas of research that were virtually non-existent at the time of the earlier reviews, major sections have been added here on sulfide mineral surface chemistry and reactivity, formation and transformation of metal-sulfur clusters and nanoparticles, modeling of hydrothermal precipitation, and on sulfides in biosystems. However, it should be emphasized that the growth in the literature on certain aspects of sulfide mineralogy over the past 20 years or so has been such that comprehensive coverage is not possible in a single volume. Thus, the general area of "sulfides in biosystems" is probably worthy of a volume in itself, and "environmental sulfide geochemistry" (including topics such as oxidative breakdown of sulfides) is another area where far more could have been written. In selecting areas for detailed coverage in this volume, we have been mindful of the existence of other relatively recent review volumes, including those in the RiMG series. It has also been our intention not to cover any aspects of the natural occurrence, textural or paragenetic relationships involving sulfides. This is published information that, although it may be supplemented by new observations, is likely to remain useful for a long period and largely not be superceded by later work. In the following chapters, the crystal structures, electrical and magnetic properties, spectroscopic studies, chemical bonding, thermochemistry, phase relations, solution chemistry, surface structure and chemistry, hydrothermal precipitation processes, sulfur isotope geochemistry and geobiology of metal sulfides are reviewed. Makovicky (Chapter 2) discusses the crystal structures and structural classification of sulfides and other chalcogenides (including the sulfosalts) in terms of the relationships between structural units. This very comprehensive survey, using a rather different and complementary approach to that used in previous review volumes, shows the great diversity of sulfide structures and the wealth of materials that remain to be characterized in detail. These materials include rare minerals, and synthetic sulfides that may represent as yet undescribed minerals. Pearce, Pattrick and Vaughan (Chapter 3) review the electrical and magnetic properties of sulfides, discussing the importance of this aspect of the sulfides to any understanding of their electronic structures (chemical bonding) and to applications ranging from geophysical prospecting and mineral extraction to geomagnetic and palaeomagnetic studies. Rapidly developing new areas of interest discussed include studies of the distinctive properties of sulfide nanoparticles. Wincott and Vaughan (Chapter 4) then outline the spectroscopic methods employed to study the crystal chemistry and electronic structures of sulfides. These range from UV-visible through infrared and Raman spectroscopies, to X-ray emission, photoemission and absorption, and to nuclear spectroscopies. Chemical bonding (electronic structure) in sulfides is the subject of the following chapter by Vaughan and Rosso (Chapter 5), a topic which draws on knowledge of electrical and magnetic properties and spectroscopic data as experimental input, as well as on a range of rapidly developing computational methods. Attention then turns to the thermochemistry of sulfides in a chapter by Sack and Ebel (Chapter 6) which is followed by discussion of phase equilibria at high temperatures in the review by Fleet (Chapter 7). Sulfides in aqueous systems, with emphasis on solution complexes and clusters, forms the subject matter of the chapter written by Rickard and Luther (Chapter 8). Sulfide mineral surfaces are the focus of the next two chapters, both by Rosso and Vaughan. The first of these chapters (Chapter 9) addresses characterization of the pristine sulfide surface, its structure and chemistry; the second (Chapter 10) concerns surface reactivity, including redox reactions, sorption phenomena, and the catalytic activity of sulfide surfaces. Reed and Palandri (Chapter 11) show in the next chapter how much can now be achieved in attempting to predict processes of sulfide precipitation in hydrothermal systems. The final chapters deal with two distinctive areas of sulfide mineralogy and geochemistry. Seal (Chapter 12) presents a comprehensive account of the theory and applications of sulfur isotope geochemistry; sulfur isotope fractionation can provide the key to understanding the natural processes of formation of sulfide deposits. In the final chapter, Posfai and Dunin-Borkowski (Chapter 13) review the rapidly developing area of sulfides in biosystems, discussing aspects of both sulfide mineral-microbe interactions and biomineralization processes involving sulfides.
    Type of Medium: Monograph available for loan
    Pages: XIII, 714 S. , Ill., graph. Darst., Tab.
    ISBN: 0-939950-73-1 , 978-0-939950-73-7
    ISSN: 1529-6466
    Series Statement: Reviews in mineralogy & geochemistry 61
    Classification:
    Mineralogy
    Note: Chapter 1. Sulfide Mineralogy and Geochemistry: Introduction and Overview by David J. Vaughan, p. 1 - 6 Chapter 2. Crystal Structures of Sulfides and other Chalcogenides by Emil Makovicky, p. 7 - 126 Chapter 3. Electrical and Magnetic Properties of Sulfides by Carolyn I. Pearce, Richard A.D. Pattrick, and David J. Vaughan, p. 127 - 180 Chapter 4. Spectroscopic Studies of Sulfides by Paul L. Wincott and David J. Vaughan, p. 181 - 230 Chapter 5. Chemical Bonding in Sulfide Minerals by David J. Vaughan and Kevin M. Rosso, p. 231 - 264 Chapter 6. Thermochemistry of Sulfide Mineral Solutions by Richard O. Sack and Denton S. Ebel, p. 265 - 364 Chapter 7. Phase Equilibria at High Temperatures by Michael E. Fleet, p. 365 - 420 Chapter 8. Metal Sulfide Complexes and Clusters by David Rickard and George W. Luther, III, p. 421 - 504 Chapter 9. Sulfide Mineral Surfaces by Kevin M. Rosso and David J. Vaughan, p. 505 - 556 Chapter 10. Reactivity of Sulfide Mineral Surfaces by Kevin M. Rosso and David J. Vaughan, p. 557 - 608 Chapter 11. Sulfide Mineral Precipitation from Hydrothermal Fluids by Mark H. Reed and James Palandri, p. 609 - 632 Chapter 12. Sulfur Isotope Geochemistry of Sulfide Minerals by Robert R. Seal, II, p. 633 - 678 Chapter 13. Sulfides in Biosystems by Mihaly Posfai and Rafal E. Dunin-Borkowski, p. 679 - 714
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 111
    Monograph available for loan
    Monograph available for loan
    Bonn : Galileo Press
    Call number: M 15.0311
    Type of Medium: Monograph available for loan
    Pages: 619 S.
    Edition: 4. Aufl.
    ISBN: 9783836228640
    Series Statement: SAP Press
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 112
    Call number: PIK F 252-16-89789
    Type of Medium: Monograph available for loan
    Pages: X, 752 Seiten
    Edition: 2. [völlig neu bearb.] Auflage
    ISBN: 9783811477247 (GB.)
    Series Statement: C.-F.-Müller-Wissenschaft
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 113
    Call number: S 92.0551(61, 1)
    Type of Medium: Series available for loan
    Pages: 103 Seiten , Illustrationen, Diagramme , 30 cm
    ISBN: 9783910006546
    Series Statement: Geologica Saxonica 61,1
    Language: German
    Note: Beiträge teilweise in deutscher, teilweise in englischer Sprache
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 114
    Call number: IASS 16.90356
    Type of Medium: Monograph available for loan
    Pages: xviii, 1140 Seiten , Illustrationen
    ISBN: 9781849712354
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 115
    Call number: M 06.0236
    In: Kartographische Schriften
    Description / Table of Contents: Contents: virtuelle 3D-Stadt- und Landschaftsmodelle. - Augmented reality. - Gefahren- und Risikokarten. - Mobile Kartennutzung. - Explorative Visualisierung. - Ausgewählte Anwendungen.
    Type of Medium: Monograph available for loan
    Pages: ii, 148 S.
    ISBN: 3781216462
    Series Statement: Kartographische Schriften 10
    Classification:
    Cartography, Geographical Information Systems, GIS
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 116
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 117
    Call number: PIK P 037-15-89078
    In: Elbegebiet, Teil I ; Von der Grenze zur CR bis zur Havelmündung
    Type of Medium: Series available for loan
    Pages: 222 S., 1 Karte
    ISSN: 0948-9126
    Series Statement: Elbegebiet, Teil I Von der Grenze zur CR bis zur Havelmündung
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 118
    Call number: M 15.89080
    Type of Medium: Monograph available for loan
    Pages: 415 S , Ill., graph. Darst. , 240 mm x 168 mm
    Edition: 1. Aufl
    ISBN: 3836219697 (kart.) , 9783836219693 (kart.)
    Series Statement: SAP Press
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 119
    Call number: M 15.89082
    Type of Medium: Monograph available for loan
    Pages: 460 S , Ill , 24 cm
    Edition: 1. Aufl
    ISBN: 3836226154 (kart.) , 9783836226158 (kart.)
    Series Statement: SAP press
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 120
    Call number: M 15.89083
    Type of Medium: Monograph available for loan
    Pages: 773 S , Ill., graph. Darst , 25 cm
    Edition: 2., aktualisierte und erw. Aufl
    ISBN: 3836218259 (Geb.) , 9783836218252 (Geb.)
    Series Statement: SAP Press
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 121
    Call number: 2015/8
    Type of Medium: 11
    ISBN: 9783060207602
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 122
    Call number: IASS 16.89805
    Description / Table of Contents: Chronicles the efforts of nature photographer James Balog to document the receding of the Solheim glacier in Iceland, a consequence of climate change and global warming, in which strategically placed cameras would take one picture every hour for three years
    Type of Medium: Non-book medium
    Pages: 1 DVD (ca. 75 Min)
    Language: English
    Note: Extra features: Film festival Q&AsMaking chasing ice -- Science update-- Original theatrical trailer.. , DVD; NTSC, Region 1; widescreen presentation; Dolby Digital 5.1 Surround , In English with optional subtitles in German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 123
    Call number: 9/90.0095(407)
    Type of Medium: Monograph available for loan
    Pages: X, 359 S. , Ill., graph. Darst., Kt. , 28 cm
    ISBN: 0813724074 , 9780813724072
    Series Statement: Special paper / Geological Society of America 407
    Language: English
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 124
    Call number: IASS 16.89860
    Type of Medium: Monograph available for loan
    Pages: 238 S. , graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9783896917683
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 125
    Monograph available for loan
    Monograph available for loan
    Basingstroke, Hampshire [u.a.] : Palgrave Macmillan
    Call number: IASS 15.89607
    Type of Medium: Monograph available for loan
    Pages: XXII, 347 S. , graph. Darst.
    ISBN: 9780230277014 , 9781403996282
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 126
    Call number: IASS 15.89620
    Keywords: Deutschland ; Großbritannien ; Klimaänderung ; Klimaschutz ; Technikbewertung ; Politische Auseinandersetzung
    Type of Medium: Monograph available for loan
    Pages: 263 S. , Ill., graph. Darst. , 210 mm x 148 mm, 351 g
    ISBN: 3658053658 (pbk.) , 9783658053659 (pbk.)
    Language: German
    Note: Univ., Diss.--Heidelberg, 2013
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 127
    Monograph available for loan
    Monograph available for loan
    Chicago [u.a.] : Univ. of Chicago Press
    Call number: PIK A 190-15-89224
    Type of Medium: Monograph available for loan
    Pages: XI, 152 S. , Ill., graph. Darst
    ISBN: 0226902021 (cloth) , 9780226902029 (cloth) , 0226902048 (pbk.) , 9780226902043 (pbk.)
    Language: English
    Note: Introduction -- Sanctioning models : theories and their scope -- Methodology for a virtual world -- A tale of two methods -- When theories shake hands -- Models of climate : values and uncertainties -- Reliability without truth -- Conclusion..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 128
    Monograph available for loan
    Monograph available for loan
    Bern [u.a.] : Haupt
    Call number: AWI S6-16-90058
    Type of Medium: Monograph available for loan
    Pages: 295 S. , graph. Darst.
    Edition: 2. Aufl.
    ISBN: 9783825231545 (Kt.)
    Series Statement: UTB 3154
    Language: German
    Note: Inhaltsverzeichnis: 1 Vorwort: ein Backrezept?. - 2 Das Drama mit dem Gugelhupf. - 2.1 Thema Ihrer Bachelorarbeit: „Backen Sie einen Gugelhupf!". - 2.2 „Scientific Googlehoopf": Erfolgsfaktoren einer wissenschaftlichen Arbeit. - 2.3 Jetzt ganz neu „Gugelhupfrezept mit Backblockadenblocker!". - 2.3.1 Piemont-Kirschen, Königsnüsse, Megaperls - und Schreibkrisen. - 2.3.2 „Schreibprobleme" lösen - aber wie?. - 3 Der Inhalt einer wissenschaftlichen Arbeit (Teil I): SIE bestimmen, welchen Gugelhupf Sie servieren. - 3.1 Die Suche nach dem generellen Thema: Welchen Kuchen wollen Sie backen?. - 3.1.1 Hilfe bei der Themensuche. - 3.1.2 Was tun, wenn es Ihren Kuchen bereits gibt?. - 3.2 Die Suche nach der zentralen Forschungsfrage: Welches Rezept soll's denn sein?. - 3.2.1 Beschreibung (Deskription). - 3.2.2 Erklärung (Explikation). - 3.2.3 Prognose. - 3.2.4 Gestaltung. - 3.2.5 Kritik (Bewertung) und Utopie. - 3.3 Formulieren Sie Ihr Thema möglichst präzise!. - 4 Der Inhalt einer wissenschaftlichen Arbeit (Teil II): Verarbeiten Sie nur Zutaten, die man für einen Gugelhupf benötigt!. - 4.1 Das Leid mit der Literatur. - 4.1.1 Qualität ist das beste Rezept. - 4.1.2 Die besten Zutaten finden: Strategien der Literaturrecherche. - 4.1.2.1 Methode der konzentrischen Kreise. - 4.1.2.2 Systematische Suche. - 4.1.2.3 Vorwärts gerichtete Suche. - 4.1.3 Kaufen Sie Ihre Zutaten nicht im nächstbesten Internetshop. - 4.2 Die Zutaten bereitlegen: Lesen und Exzerpieren von Texten. - 4.3 Nicht zu wenige und nicht zu viele Zutaten: Quantität der verarbeiteten Literatur. - 4.4 Geriebene Zitronenschale und ein paar Rosinen: Nicht nur die Literatur macht's. - 5 Der Inhalt einer wissenschaftlichen Arbeit (Teil III): Rühren Sie Ihre Zutaten richtig zusammen!. - 5.1 Die Zutaten Schritt für Schritt dazugeben: Stellenwert der Gliederung. - 5.2 Die leidige „Einleitung" (=1. Kapitel). - 5.3 „Grundlagen und Definitionen" (=2. Kapitel). - 5.3.1 Eigentliche Bedeutung von „Grundlagen und Definitionen". - 5.3.2 Die Kurzgeschichte von der traurigen Definition mit ihren unendlich vielen Kindern. - 5.4 „Hauptteil": Das Herzstück Ihrer Arbeit (= 3. Kapitel). - 5.4.1 Die Zutaten stehen bereit - und nun?. - 5.4.2 Eigentliche Herausforderung: die Zutaten angemessen verarbeiten (= korrekter Umgang mit Hypothesen, Aussagen, Daten). - 5.4.2.1 Hypothesen. - 5.4.2.2 Aussagen. - 5.4.3 Analyse empirischer Daten. - 5.4.3.1 Mehr als nur Häufigkeiten. - 5.4.3.2 Mit univariaten Verfahren in die eigentliche Analyse einsteigen. - 5.4.3.3 Mit bivariaten Analyseverfahren einfache Zusammenhänge entdecken. - 5.4.3.4 Klarheit im Datenwust: Multivariate Analyseverfahren. - 5.5 Der vernachlässigte „Schluss" (=4. Kapitel). - 5.6 Die Zubereitung variieren: Mögliche Gliederungen einer wissenschaftlichen Arbeit. - 6 Der Stil wissenschaftlicher Arbeiten: Damit ihr Gugelhupf gelingt, brauchen Sie das richtige Händchen. - 6.1 Sie backen - schreiben - für Leser!. - 6.2 Verwenden Sie die richtigen Wörter - und verwenden Sie die Wörter richtig!. - 6.2.1 Verben . - 6.2.1.1 Leisten Sie Verzicht auf Funktionsverben!. - 6.2.1.2 Achten Sie auf die „Stilhöhe"!. - 6.2.1.3 Reanimieren Sie tote Verben!. - 6.2.1.4 Doppelt quält besser: Pleonasmen und Verben mit unnötigen Vorsilben. - 6.2.1.5 Beizeiten das Tempus beherrschen. - 6.2.1.6 Hätte da was im Konjunktiv stehen müssen?. - 6.2.1.7 Sollten Passivsätze seitens des Autors vermieden werden?. - 6.2.1.8 Infinitive ad infinitum?. - 6.2.2 Substantive. - 6.2.2.1 Nominalkonstruktionen? No!. - 6.2.2.2 Ein konkretes Substantiv für einen konkreten Sachverhalt. - 6.2.2.3 Zu Ihrer Rückerinnerung ein Testversuch als Gratisgeschenk: keine pleonastischen Substantive!. - 6.2.2.4 (Wort-)Blähungen der besonderen Art. - 6.2.2.5 Das Substantivaneinanderreihungsproblem. - 6.2.2.6 Geeignete Synonyme statt Wortwiederholungen. - 6.2.2.7 Männliche und/oder weibliche Ausdrucksform?. - 6.2.3 Adjektive. - 6.2.3.1 Misstrauen Sie Adjektiven!. - 6.2.3.2 Wählen Sie präzise Adjektive!. - 6.2.3.3 Sperren Sie schwarze Raben in die Vogelvoliere!. - 6.2.3.4 Adverb ≠ Adjektiv. - 6.2.3.5 Die maximalste Steigerungsstufe ist immer die optimalste! Oder etwa nicht?. - 6.2.3.6 Sie arbeiten nicht in der Kreativabteilung. - 6.2.4 „Simpel = unwissenschaftlich"? Zum Umgang mit Fachbegriffen, Fremdwörtern und Amerikanismen/Anglizismen. - 6.2.4.1 Muss man kasuistisch auf ein Kompendium extraordinärer Termini rekurrieren?. - 6.2.4.2 Fremdwort ≠ Fachbegriff. - 6.2.4.3 Weitere coole Infos. - 6.2.5 Präpositionen. - 6.2.6 Hinweise zur Wortwahl. - 6.2.6.1 Nicht journalistisch, nicht salopp. - 6.2.6.2 Der Kontext Ihrer Wörter ist wichtig. - 6.2.6.3 Versenken Sie Wortdreimaster!. - 6.2.6.4 Ich, wir oder man?. - 6.2.6.5 Anthropomor... was?. - 6.3 Sätze. - 6.3.1 Generelle Hinweise zur Formulierung von Sätzen. - 6.3.2 In der Kürze liegt die Würze!. - 6.3.3 Keine „russischen Puppen"!. - 6.3.4 Achten Sie auf den Satzbau!. - 6.3.5 Zeichnen Sie (Sprach-)Bilder!. - 6.3.6 Redewendungen sollten Sie korrekt aufs „Trapez" bringen!. - 6.3.7 War da was? Achten Sie auf Korrelationen!. - 6.4 Den Teig immer mal wieder probieren: Überarbeiten und korrigieren Sie Ihren Text gewissenhaft!. - 6.4.1 Machen Sie Ihre Arbeit zu einem eigenständigen Werk!. - 6.4.2 Stehlen Sie Ihren Lesern nicht die Zeit!. - 6.4.3 Lesen Sie den Inhalt Ihrer Arbeit laut vor!. - 6.4.4 Machen Sie den „Muttitest"!. - 7 Die Form wissenschaftlicher Arbeiten: Damit Ihr Gugelhupf wie ein echter Gugelhupf aussieht. - 7.1 Funktionen der Form. - 7.2 Stellenwert ausgewählter Formvorschriften. - 7.2.1 Rechtschreibung und Grammatik. - 7.2.2 Interpunktion: mehr als Punkt und Komma. - 7.2.2.1 Komma. - 7.2.2.2 Doppelpunkt. - 7.2.2.3 Gedankenstrich. - 7.2.2.4 Semikolon. - 7.2.3 Korrekte Zitierweise der verarbeiteten Literatur. - 7.2.3.1 Belegen der Literatur im Text. - 7.2.3.2 Ergänzende Hinweise zur korrekten Zitierweise. - 7.2.3.3 Angabe der Quellen im Literaturverzeichnis. - 7.2.4 Abbildungen, Tabellen, Grafiken. - 7.2.4.1 Stellenwert von Schaubildern. - 7.2.4.2 Hinweise zur Gestaltung von Schaubildern. - 7.2.4.3 Schaubildtypen. - 7.2.5 Mathematische Formeln und Gleichungen. - 7.2.6 Abkürzungen und Symbole. - 7.2.7 Zahlen, Zahlwörter und Einheiten. - 7.2.8 Kapitel, Absätze, Aufzählungen/Auflistungen, Hervorhebungen. - 8 Halten Sie sich an die Backzeit!. - Literatur. - Index.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 129
    Call number: PIK B 010-16-90321
    Description / Table of Contents: "Urban Economics and Urban Policy" pulls together cutting-edge developments in urban and regional economics and draws out their implications for urban policy. This new urban economics goes beyond simple comparative advantage and cost competitiveness of cities, and beyond simple views of capital and labor. It develops a much more complex and realistic view of what constitutes local advantage, due to the spatial sorting of different types of people and different types of firms, giving rise to a lumpy landscape of people, activities, and incomes. By taking seriously the new ways we understand the forces shaping the geography of economic development, the authors suggest fresh new ways to work with the grain of markets, but without letting them rip. It is a tour de force.'--Michael Storper, London School of Economics, UK. In this bold, exciting and readable volume, Paul Cheshire, Max Nathan and Henry Overman illustrate the insights that recent economic research brings to our understanding of cities, and the lessons for urban policy-making. The authors present new evidence on the fundamental importance of cities to economic wellbeing and to the enrichment of our lives. They also argue that many policies have been trying to push water uphill and have done little to achieve their stated aims; or, worse, have had unintended and counterproductive consequences. It is remarkable that our cities have been so successful despite the many shortcomings of urban policies and governance. These shortcomings appear in both rich and poor countries. Many powerful policies intended to influence urban development and spatial differences have been developed since the late 1940s, but they have been subject to little rigorous economic evaluation. The authors help us to understand why economic growth has emerged so unevenly across space and why this pattern persists. The failure to understand the forces leading to uneven development underlies the ineffectiveness of many current urban policies. The authors conclude that future urban policies need to take better account of the forces that drive unevenness and that their success should be judged by their impact on people, not on places - or buildings. This groundbreaking book will prove to be an invaluable resource and a rewarding read for academics, practitioners and policymakers interested in the economics of urban policy, urban planning and development, as well as international studies and innovation.
    Type of Medium: Monograph available for loan
    Pages: XII, 238 Seiten , Diagramme, Karten
    Edition: Paperback edition reprint
    ISBN: 9781783475254 , 9781781952511 ((hdb.)) , 9781781952528 (electronic)
    Language: English
    Note: Contents: Contents: Foreword by Ed Glaeser ; 1. Introduction ; 2. Urban Economic Performance ; 3. Residential Segregation and People Sorting Within Cities ; 4. Planning for a Housing Crisis: Or the Alchemy by Which We Turn Houses into Gold ; 5. Planning and Economic Performance ; 6. Planning: Reforms that Might Work and Ones that Won’t ; 7. Devolution, City Governance and Economic Performance ; 8. Urban Policies ; 9. Conclusions ; Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 130
    Series available for loan
    Series available for loan
    Wien : Naturhistorisches Museum
    Associated volumes
    Call number: S 93.0602(118A)
    In: Annalen des Naturhistorischen Museums in Wien
    Type of Medium: Series available for loan
    Pages: 288 S., Ill., graph. darst.
    ISBN: 9783903096011
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 131
    Call number: M 16.89676
    Type of Medium: Monograph available for loan
    Pages: vi, 792 S. : Ill., graph. Darst., Kt.
    ISBN: 978997968370-4
    Classification:
    Geothermal Energy
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 132
  • 133
    Non-book medium
    Non-book medium
    Zürich : Verl. Inst. für Atmosphäre und Klima ETH
    Associated volumes
    Call number: NBM ZS-272(84)
    In: Zürcher Klima-Schriften [Elektronische Ressource]
    Type of Medium: Non-book medium
    Pages: 1 CD-ROM + Booklet (Abstract)
    ISBN: 3906148327
    Series Statement: Zürcher Klima-Schriften 84
    Classification:
    Ecology
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 134
    Monograph available for loan
    Monograph available for loan
    Leiden : Brill
    Call number: IASS 16.90084
    Description / Table of Contents: In a social world whose pace continues to accelerate the future becomes an increasingly difficult terrain. While the focus of social life is narrowing down to the present, the futures we create on a daily basis cast ever longer shadows. This book addresses this paradox and its deep ethical implications
    Type of Medium: Monograph available for loan
    Pages: xvii, 218 Seiten , Illustrationen , 25 cm
    ISBN: 9004161775 , 9789004161771
    Series Statement: Supplements to The study of time v. 3
    Language: English
    Note: List of Figures; Acknowledgements; Prologue; Chapter One Introduction; Chapter Two The Future Told; Chapter Three The Future Tamed; Chapter Four Futures Traded; Chapter Five Futures Transformed; Chapter Six Futures Traversed; Chapter Seven Futures Thought; Chapter Eight Futures Tended; Chapter Nine Futures Transcended; Epilogue; Glossary of Key Terms; Bibliography; Name Index; Subject Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 135
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: M 16.89755
    Description / Table of Contents: Provides a deeper understanding of earthquake processes, based on laboratory-derived physical laws and formulae, for researchers, professionals and graduate students
    Type of Medium: Monograph available for loan
    Pages: x, 270 S.
    Edition: Online-Ausg. 2013
    ISBN: 9781107030060
    Classification:
    Seismology
    Parallel Title: Print version: The Physics of Rock Failure and Earthquakes
    Language: English
    Note: Contents; Preface; 1 Introduction; 2 Fundamentals of rock failure physics; 2.1 Mechanical properties and constitutive relations; 2.1.1 Elastic deformation; 2.1.2 Ductile deformation; 2.1.3 Fracture; 2.1.4 Friction; 2.2 Basics of rock fracture mechanics; 2.2.1 Energy release rate and resistance to rupture growth; 2.2.2 Stress concentration and cohesive zone model; 2.2.3 Breakdown zone model for shear failure; 2.2.4 j-integral and energy criterion for shear failure; 2.2.5 Relation between resistance to rupture growth and constitutive relation parameters. , 3 Laboratory-derived constitutive relations for shear failure3.1 Shear failure of intact rock; 3.1.1 Method and apparatus used; 3.1.2 Constitutive relations derived from data on the shear failure of intact rock; 3.1.3 Geometric irregularity of shear-fractured surfaces and characteristic length; 3.2 Frictional slip failure on precut rock interface; 3.2.1 Method and apparatus used; 3.2.2 Geometric irregularity of precut fault surfaces and characteristic length; 3.2.3 Constitutive relations derived from data on frictional stick-slip failure. , 3.2.4 Laboratory-derived relationships between physical quantities observed during dynamic slip rupture propagation3.3 Unifying constitutive formulation and a constitutive scaling law; 3.3.1 Unification of constitutive relations for shear fracture and for frictional slip failure; 3.3.2 A constitutive scaling law; 3.3.3 Critical energy required for shear fracture and for frictional stick-slip failure; 3.3.4 Stabilityinstability of the breakdown process; 3.3.5 Breakdown zone size; 3.4 Dependence of constitutive law parameters on environmental factors; 3.4.1 Introduction. , 3.4.2 Dependence of shear failure strength on environmental factors3.4.3 Dependence of breakdown stress drop on environmental factors; 3.4.4 Dependence of breakdown displacement on environmental factors; 4 Constitutive laws for earthquake ruptures; 4.1 Basic foundations for constitutive formulations; 4.2 Rate-dependent constitutive formulations; 4.3 Slip-dependent constitutive formulations; 4.4 Depth dependence of constitutive law parameters; 5 Earthquake generation processes; 5.1 Shear failure nucleation processes observed in the laboratory; 5.1.1 Introduction; 5.1.2 Experimental method. , 5.1.3 Nucleation phases observed on faults with different surface roughnessesRough fault; Smooth fault; Extremely smooth fault; 5.1.4 Scaling of the nucleation zone size; 5.2 Earthquake rupture nucleation; 5.2.1 Seismogenic background; 5.2.2 Physical modeling and theoretical derivation of the nucleation zone size; 5.2.3 Comparison of theoretical relations with seismological data; 5.2.4 Foreshock activity associated with the nucleation process; 5.3 Dynamic propagation and generation of strong motion seismic waves; 5.3.1 Slip velocity and slip acceleration in the breakdown zone. , 5.3.2 The cutoff frequency fs max of the power spectral density of slip acceleration at the source.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 136
    Monograph available for loan
    Monograph available for loan
    Dordrecht : Springer
    Call number: PIK N 319-16-89764
    Type of Medium: Monograph available for loan
    Pages: IX, 242 S. , Ill., graph. Darst., Kt
    ISBN: 1402043317 , 9781402043314
    Language: English
    Note: The Sun. The formation of the stars and the Sun ; The characteristics of the Sun ; A representation of the Sun ; The internal structure of the Sun ; The photosphere, solar radiation, the solar wind ; The thermal profile of the solar atmosphere ; Solar dynamics ; The Sun: the source of space weather -- The Earth. The Earth within the solar system ; The internal structure of the Earth : the geomagnetic field ; The atmosphere of the Earth ; The magnetosphere -- Toward a space weather. The consequences of solar agressions on our technological environment ; Other impacts of solar activity ; Space weather in order to forecast -- Appendices..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 137
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: PIK P 120-16-89806
    Description / Table of Contents: Deutschland wird seine bisher weitgehend auf fossilen Brennstoffen basierende Energieversorgung bis zum Jahr 2050 auf großtenteils regenerative Energien umstellen. Die Burgerinnen und Burger dieses Landes kennen dieses weltweit einzigartige Projekt unter dem Namen Energiewende. Von ihren gesellschaftlichen Wurzeln, dem Beginn ihrer Umsetzung und ihrer rasanten Entwicklung in den letzten Jahren berichtet Klaus-Dieter Maubach. Er beschreibt, wie das deutsche Energiesystem der Zukunft aussehen muss, und schlagt einen kurzfristigen Aktionsplan vor, der die volkswirtschaftlichen Kosten eindammt und
    Type of Medium: Monograph available for loan
    Pages: XX, 293 Seiten
    Edition: 2. Auflage
    ISBN: 3658054735 , 9783658054731
    Language: German
    Note: Vorwort zur zweiten Auflage; Vorwort; Inhalt; Abkürzungen; Einführung; Teil I; Eine kurze Geschichte der Energiewende; Fukushima und Ausstieg (2011); Fundamente der Energiewende (1980 - 1998); EnWG und EEG (1998 - 2003); Emissionshandel und Energiepreise (2003 - 2008); Netzregulierung und EEG (2004 - 2008); Krise in Europa (2009 - 2012); Teil II; Die Zukunft der Energiewende; Standortbestimmung (2013); 2050: Energiewende; Fossile Primärenergien; Die Regenerativen; Energiesystem der Zukunft; Politik für die Energiewende; 1 Braunkohle und Erdgas; 2 Auslaufbetrieb der Kernenergie ; 3 Energieeffizienz ; 4 Emissionshandel ; 5 EEG Reform ; 6 Regulierung der Stromnetze ; 7 Strommarktgestaltung ; 8 Koordinierung der Energiewende ; Zusammenfassung.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 138
    Monograph available for loan
    Monograph available for loan
    Farnham, Surrey [u.a.] : Ashgate
    Call number: IASS 16.90321
    Type of Medium: Monograph available for loan
    Pages: XVIII, 244 Seiten , Illustrationen
    ISBN: 9781409454359 (hbk.)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 139
    Call number: PIK 16-89825
    Type of Medium: Monograph available for loan
    Pages: Getr. Zählung , Ill., graph. Darst.
    Edition: Online-Ausg. Berlin Humboldt-Universität zu Berlin, Universitätsbibliothek 2011 〈〈Nach einem Exemplar der Humboldt-Universität zu Berlin, Universitätsbibliothek mit der Signatur: 〉〉Diss Geo11 P134
    Language: German
    Note: Berlin, Humboldt-Univ., Diss., 2011
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 140
    Monograph available for loan
    Monograph available for loan
    Washington, DC : National Academies Press
    Call number: PIK N 071-06-0286
    Type of Medium: Monograph available for loan
    Pages: XIV, 207 S. , Ill., graph. Darst., Kt.
    ISBN: 0309095069 , 0-309-54688-5
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 141
    Monograph available for loan
    Monograph available for loan
    London : House of Lords
    Call number: PIK N 454-06-0272
    Type of Medium: Monograph available for loan
    Pages: 160 S. + CD
    ISBN: 0104008717
    Series Statement: HL Paper 191-1
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 142
    Monograph available for loan
    Monograph available for loan
    New York, NY [u.a.] : Routledge
    Call number: IASS 16.90505
    Type of Medium: Monograph available for loan
    Pages: VIII, 227 S.
    ISBN: 0415800412 (hbk.) , 9780415800419 (hbk.) , 0203872770 (electronic) , 9780203872772 (electronic)
    Series Statement: Routledge studies in rhetoric and communication 1
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 143
    Call number: AWI G8-17-90378
    Type of Medium: Monograph available for loan
    Pages: IV, 552, XXV S.
    Language: English
    Note: Table of Contents: SESSION 1: DIELECTRIC PROPTERTIES OF AQUEOUS MATERIALS. - 1 Polymer Chains Linked by Water Molecules. A Dielectric Spectrometry Study. - 2 Accurate Determination of Debye Relaxation Data of Polar Liquids by a Multistep Retro-modelling Technique. - 3 Admittance Derivative Spectrometry of Conducting Liquids. - 4 Accurate Dielectric Properties of Liquid Water from -15 to +40 °C as Determined by Retromodelling of a Dual Resonant Applicator. - 5 Dielectric Study of Temperature-Dependent Behavior of Bound Water in Grain. - SESSION 2: DIELECTRIC PROPTERTIES OF BIOLOGICAL SUBSTANCES AND TISSUES. - 1 Computation of Electromagnetic Fields within a Stratified Structure of Human Head. - 2 Water Effects in Hydrogels Studied by Dielectric Techniques. - 3 Dielectric Relaxation Study on Water Structure Restricted in Rice Kernel. - 4 Dielectric Properties of Water Solutions with Small Content of Sugar and Glucose in the Millimeter Wave Band and the Determination of Glucose in Blood. - 5 Research of the Complex Spectrum Interaction with Surface of Biological Tissue. - 6 Dielectric Properties of Human Semen at Microwave Frequencies. - SESSION 3: APPLICATIONS OF MODEL SYSTEMS, MIXING RULES, CALIBRATION, AND RECONSTRUCTION ALGORITHM. - 1 The Relation between Fractal Dimension and Microwave Parameters. - 2 A Unified Moisture Algorithm for Improved RF Dielectric Grain Moisture Measurements. - 3 Development of TDR-Sensors for Moist Materials Using HFSS. - 4 Modelling of Electromagnetic Wave Propagation along Transmission Lines in Inhomogeneous Media. - 5 The Theoretical Model of the Microwave Complex Permittivity of Grain. - 6 Enhanced Integral Equation Modelling for Moisture Sensors. - 7 Spatial Time Domain Reflectometry with Rod Probes. - SESSION 4: ELECTROMAGNETIC WAVE PROPGAGATION IN LOSSY DIELECTRICS RELATED TO SENSORS. - 1 Electromagnetic Wave Propagation in Polarizable Wet Media. - 2 Radiofrequency Measurement of a Lossy Dielectric Liquid Content in Water. - 3 Measurement of Moisture Content in a Highly Electrical Lossy Material using Time Domain Reflectometry. - 4 Some Topics of Measurement of Complex Permittivity for Lossy Dielectric Materials with Wide-Range of tanδ. - 5 Material Parameter Measurement of Soils and Liquids with a Waveguide Setup. - SESSION 5: MEASUREMENT METHODS. - 1 High Moisture Content Measurement Using Microwave Free-Space Technique. - 2 Comparison of Free Space Reflection and Transmission Time-Domain Measurements for the Determination of the Moisture Content of Bulk Materials. - 3 Hydrous Profile Modeling in Porous Materials from Reflection Coefficient Measurements at 2.45 GHz. - 4 Combined Frequency and Time Domain Moisture Sensing by an Ultra Wideband IQ-M-Sequence Approach. - 5 A Compact Network Analyzer for Resonant Microwave Sensors. - SESSION 6: ELECTROMAGNETIC SENSORS IN TIME- and FREQUENCY DOMAIN FOR MOISTURE CONTENT DETERMINATION IN SOLIDS AND LIQUIDS. - 1 Universal Microwave Moisture Sensor. - 2 Dual Frequency Moisture Sensor Based on Circular Microstrip Antenna. - 3 Characterization and Comparative Evaluation of Novel Planar Electromagnetic Sensors. - 4 Trough Guide Ring Resonator for Precision Microwave Moisture and Density Measurements. - 5 Simple Soil Moisture Probe for Low-Cost Measurement Applications. - SESSION 7: APPLICATIONS IN CIVIL ENGINEERING, PHARMACEUTIAL INDUSTRY, OIL INDUSTRY AND QUALITY INSPECTIONS. - 1 Non-Contact Moisture Sensor for Fresh Concrete. - 2 Application of Microwave Impulse Method for Measuring Moisture Profiles in Building Materials. - 3 Microwave Scanning Technology for Dielectric Material Testing. - 4 Measurement of Continuous Drying out of Subterranean Concrete Walls. - 5 TDR Technique for Measuring the Moisture Content in Brick. - 6 Measuring Moisture Profiles in FGD Gypsum Using the TDR Method. - 7 Advanced Monitoring of Wetness in Pharmaceutical Powder Processes Using In-Situ Dielectric Probe Measurements. - 8 Non-Destructive Microstrip Resonator Technique for the Measurement of Moisture / Permittivity in Crude Oil. - 9 A Novel Application of Planar Electromagnetic Sensing Technique - Quality Inspection of Saxophone Reeds. - SESSION 8: APPLICATION OF METHODS AND SENSORS TO FOODSTUFFS AND AGRICULTURAL PRODUCTS. - 1 New Sensor for High Moist Leaves in Green Tea Production. - 2 Intangible but not Intractable: The Prediction of Food 'Quality' Variables Using Dielectric Spectroscopy. - 3 Microwave Sensing for Food Structure Evaluation. - 4 Effective Microwave Dielectric Properties of Food Materials Consisting of Large Particulates. - 5 RF Impedance Method for Nondestructive Moisture Content Determination in In-Shell Peanuts. - 6 Automatic Control of Moisture in Agricultural Products by Methods of Microwave Aquametry. - 7 High resolution, Non-destructive and In-process Time Domain Aquametry for FMCG and other products using Microstrip sensors. - 8 Frequency and Temperature Dependence of the Permittivity of Fresh Fruits and Vegetables. - 9 A Theoretical Relationship Between the Fractal Dimension and Moisture Content in Grains. - SESSION 9: MOISTURE CONTENT DETERMINATION IN SOIL, SNOW AND WASTE DISPOSALS. - 1 Development of a Sensor for In-situ Determination of Snow, Moisture and Density. - 2 Water Content Measurements in Soil Column Tests with a New Electromagnetic Moisture Sensor. - 3 Alternative Surface Covering of Landfill Using the TAUPE Sealing Control System. - 4 Measurement Method for Detection of Moisture Profiles in a Saline Environment. - SESSION 10: MULTI-PARAMETER MEASUREMENTS FOR DETERMINATION OF PROPERTIES SUCH AS CONDUCTIVITY, MOISTURE, DENSITY, ETC. - 1 Density-independent Moisture Measurements in Polymer Powders Using Millimeter Wave Quasi-optical Resonator. - 2 Granular and Powdered Material Permittivity-density Relationships. - 3 Moisture and Ion Measurement Using Microstripline. - 4 Comparing Near-Field and Far-Field Dielectric Properties Measurements for Accuracy of Bulk Density and Moisture Content Determination in Grain. - POSTER SESSION. - P1 States of Water after the Ionising Radiation on Different Substituted Starches. - P2 Calibration Transfer for the Unified Grain Moisture Algorithm. - P3 Dielectric Properties of Bulk Materials and Restrictions to the Application of Two-Parameter Microwave Aquametry. - P4 Scattering of Electromagnetic Waves by Short Thin Wire and Application to the Modeling of Composites. - P5 Temperature Corrections for a VHF Unified Grain Moisture Algorithm. - P6 Large-scale Sensing of Snow Pack Properties. - P7 Comparing Time Domain Reflectometry and Electrical Resistivity Tomography Measurements for Estimating Soil Water Distribution. - P8 Detecting and Monitoring Frozen Ground and Unfrozen Water Content Using Electric and Electromagnetic Techniques. - P9 Improved Process Control of the Water Content in Biological Filtration Plants. - P10 Experience with Detectors for Infrared Moisture Measuring. - P11 TAUPE Sealing Monitoring System (SMS) for Landfills. - Soil Moisture Group Karlsruhe - Current Work and Future Prospects of a New Research Group. - Applications and Developments of Measurement Methods - an Overview. - Author Index. - Exhibition.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 144
    Call number: 12/M 06.0541
    Description / Table of Contents: Radio Occultation with CHAMP: Mission Status, Retrieval, Validation, and Error Analysis.- Stellar Occultation with GOMOS: Retrieval, Validation and Error Analysis.- Wave Optics Algorithms for the Processing of Radio Occultation Data.-Future GNSS Occultation Missions and the LEO-LEO Occultation Concept.- Use of GNSS Occultation Data in Numerical Weather Predicion and in Atmospheric Studies.- Use of GNSS Occultation Data for Climate Monitoring and Climate Change Studies.
    Type of Medium: Monograph available for loan
    Pages: X, 336 S. , 134 schw.-w. Ill., 113 schw.-w. graph. Darst., 21 farb. graph. Darst.
    ISBN: 3540341161
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 145
    Monograph available for loan
    Monograph available for loan
    Oxford : Blackwell
    Call number: 2/N 07.0136
    Description / Table of Contents: Contents: The peer-review process - how to get going. Manuscript submission and initial checks on completeness and suitability. The full review process. The decision-making process for reviewed manuscripts. Moving to online submission and review. Reviewers: a precious resource. The obligations and responsibilities of the people involved in peer review. Misconduct in scientific research and publishing - what it is and how to deal with it.The Golden Rules and the Peer Review Good Practice Checklist. Other models of peer review.
    Type of Medium: Monograph available for loan
    Pages: 128 S.
    ISBN: 1405131594
    Classification:
    E.7.
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 146
    Monograph available for loan
    Monograph available for loan
    Joensuu : European Forest Institute
    Call number: PIK W 510-16-89956
    Type of Medium: Monograph available for loan
    Pages: 172 S. , graph. Darst.
    ISBN: 9525453103
    Series Statement: EFI proceedings 53
    Language: English
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 147
    Monograph available for loan
    Monograph available for loan
    Joensuu : European Forest Institute
    Call number: PIK W 510-16-89960
    Type of Medium: Monograph available for loan
    Pages: 195 S. , graph. Darst.
    ISBN: 9789525453270
    Series Statement: EFI proceedings 57
    Language: English
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 148
    Unknown
    New Brunswick (U.S.A.) and London (U.K.) :Transaction Publishers,
    Call number: IASS 16.89965
    Pages: xviii, 307 pages ; , 23 cm
    ISBN: 9781412847483
    Uniform Title: Art de la conjecture.
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 149
    Call number: NBM 17.90424
    In: Geophysical research abstracts [Elektronische Ressource]
    Type of Medium: Non-book medium
    Pages: 1 CD-ROM
    ISSN: 1029-7006
    Series Statement: Geophysical research abstracts 5
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 150
    Monograph available for loan
    Monograph available for loan
    Cambridge [u.a.] : Polity Press
    Call number: IASS 16.90433
    Type of Medium: Monograph available for loan
    Pages: VIII, 269 S
    ISBN: 0745642004 (hbk) , 9780745642000 (hbk) , 0745642012 (pbk) , 9780745642017 (pbk)
    Uniform Title: Weltrisikogesellschaft 〈engl.〉
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 151
    Monograph available for loan
    Monograph available for loan
    Frankfurt am Main : Fischer-Taschenbuch-Verl.
    Call number: IASS 16.90436
    Type of Medium: Monograph available for loan
    Pages: 93 S.
    Edition: Erw. Ausg., 13. Aufl.
    ISBN: 9783596100835
    Series Statement: Fischer-Taschenbücher 10083
    Uniform Title: L' ordre du discours 〈dt.〉
    Language: German
    Note: Die Vorlage enth. insgesamt 2 Werke
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 152
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 91.0021(34)
    In: Mainzer geowissenschaftliche Mitteilungen
    Type of Medium: Series available for loan
    Pages: 340 S.
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 153
    Monograph available for loan
    Monograph available for loan
    Göttingen : Vandenhoeck & Ruprecht
    Call number: IASS 16.90478
    Type of Medium: Monograph available for loan
    Pages: 176 S.
    ISBN: 9783525367889
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 154
    Monograph available for loan
    Monograph available for loan
    Princeton, NJ [u.a.] : Princeton Univ. Press
    Call number: IASS 16.90619
    Type of Medium: Monograph available for loan
    Pages: LIV, 391 S. , Ill.
    Edition: Paperback reissue, with a new introd.
    ISBN: 0691150206 (pbk.) , 9780691150208 (pbk.)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 155
    Monograph available for loan
    Monograph available for loan
    Köln : Luchterhand
    Call number: PIK B 405-17-90623
    Type of Medium: Monograph available for loan
    Pages: XXXIV, 2474 S.
    Edition: 9. Aufl.
    ISBN: 9783472084273
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 156
    Call number: AWI G3-17-90622
    In: Lecture Notes in Earth Sciences, 118
    Type of Medium: Monograph available for loan
    Pages: XXIX, 387 S. , Ill., graph. Darst., Kt. , 24 cm
    ISBN: 9783642002878 (GB.) , 9783642002885 (electronic)
    Series Statement: Lecture notes in earth sciences 118
    Language: English
    Note: Contents: PART I GEOLOGICAL AND PALEOECOLOGICAL EVENTS OF THE LATE PLEISTOCENE AND HOLOCENE IN NORTHERN EURASIA. - 1 Geological and Paleoecological Events of the Late Pleistocene along Eurasian Coastal Areas of the Arctic Ocean. - General Upper Pleistocene Stratigraphie Scheme for Northern Eurasia. - Duration of the Mikulino Interglaciation. - Correlation of the Natural Events Correlative with MIS 5d-5a in Northern West Europe and Northwestern Russia. - 2 Late Pleistocene Geologic-Paleoecological Events in the North of European Russia. - Relationship between Land and Sea Areas during the Mikulino Interglacial in Northern Eurasia. - Genetic Types of Continental Sediments. - Marine Sediments of the Boreal Transgression in the North of European Russia. - 3 Main Geologic-Paieoecoioglcal Events of the Late Pleistocene in the North of Western Siberia. - 4 Geologic-Paleoecological Events of the late Pleistocene in the Northern-Siberian Lowland and Taimyr Peninsula. - 5 The Late Glacial Time and Holocene of Northern Eurasia. - 6 Outlines of the Late Pleistocene and Holocene History of the East Arctic Seas. - 7 The Deglaciation Time and Holocene of Northern Eurasia. - PART II MARINE SEDIMENTATION IN THE ARCTIC OCEAN AND SUBARCTIC SEAS. - 8 The Seas of West Subarctic Region. - Geologic and Oceanographic Setting. - History of Sedimentation. - History of Sedimentation Rates. - History of Sedimentation on the Vøring Plateau During the Last 25 ka. - History of Sedimentation at the Continental Margin of Eastern and South-Eastern Greenland During the Last 130 ka. - 9 The Arctic Ocean. - Recent Environment. - Morphostructure, Oceanographic and Sea-Ice Setting, Recent Sediments and Their Mineral Composition. - Facies Variations of Holocene Sediments on the Yermak Plateau (According to Study Data of 〉 63 mkm Fraction). - History of Sedimentation. - History of Sedimentation Rates During the Last 130 ka. - History of Sedimentation on the Yermak Plateau During the Last 190 ka. - Organic-Geochemical Sediment Studies of the Eastern Part of the Central Arctic. - 10 The Western Arctic Seas. - Recent Sedimentation Environment. - The Barents Sea. - The Kara Sea. - Surface Sediments of the Pechora Sea. - Surface Sediments of St. Anna Trough. - Facies Zonality of Surface Sediments in the Eastern Kara Sea. - History of Sedimentation. - Late- and Post-Glacial History of Sedimentation in the Eastern Part of the Barents Sea. - Holocene Sedimentation History in the Southern Novaya Zemlya Trough. - History of Sedimentation in the Pechora Sea During the Late Pleistocene and Holocene. - Light Fraction Mineralogy of the Upper Quaternary Sediments from the Saint Anna Trough and Its Paleoceanographic Interpretation. - Holocene History of Yenisei River Discharge. - Holocene History of Ob River Discharge. - 11 Eastern Arctic Seas. - Recent Sedimentation Environment. - The Laptev Sea. - The East Siberian Sea. - The Chukchi Sea. - History of Sedimentation. - History of Sedimentation in the Laptev Sea During the Late Weichselian to Holocene by Geophysical and Geochemical Data. - Holocene History of the Lena and Other Rivers Discharge in the Laptev Sea. - Organic Geochemical Data About Sedimentation History Along the Continental Slope of the East Siberian Sea During the Last Climatic Cycle. - Preliminary Data About Accumulation of Diatom-Bearing Clayey Silts at the Chukchi Sea Shelf. - 12 Seas of the Eastern Subarctic. - Recent Sedimentation Environment. - History of Sedimentation. - History of Sedimentation in the Deep-Water Part of the Shirshov Ridge (Bering Sea) During the Last Three Marine-Isotope Stages. - History of Sedimentation in the Northern Sea of Okhotsk During the Last 1.1 Ma. - PART III THE LATE PLEISTOCENE PALEOGEOGRAPHIC EVENTS OF NORTHERN EURASIA AND HISTORY OF SEDIMENTATION IN THE SUBARCTIC SEAS AND THE ARCTIC OCEAN IN RELATION TO THE NORTHERN HEMISPHERE GLACIATION DURING THE LAST CLIMATIC CYCLE. - 13 Characteristic Features of the Mikulino Landscapes. - 14 Results of Paleoclimate Studies. - 15 Particularities of Sedimentation Processes Within the Continental Blocks and Marine Basins. - Deglaciation Peculiarities. - Facies Variability during Glaciations, Deglaciations, Interglacials. - Geological History of the Arctic Ocean Sea Ice during the Last 60 ka. - Intercoupling of Atmo-, Hydro-, Cryo-, Bio-, and Lithospheres. - References. - Index.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 157
    Monograph available for loan
    Monograph available for loan
    Bonn : Galileo Press
    Call number: M 15.0309
    Type of Medium: Monograph available for loan
    Pages: 653 S.
    Edition: 5., aktualisierte und erw. Aufl.
    ISBN: 9783836220330
    Series Statement: SAP Press
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 158
    Monograph available for loan
    Monograph available for loan
    Berlin [u.a.] : Springer-Verlag
    Call number: M 15.24701
    Type of Medium: Monograph available for loan
    Pages: xxxi, 382 p. : Ill., graph. Darst., Kt.
    ISBN: 9783540207252
    Classification:
    Geography and Geomorphology
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 159
    Monograph available for loan
    Monograph available for loan
    Göttingen : Optimus-Verl.
    Call number: M 17.90710
    Type of Medium: Monograph available for loan
    Pages: V, 162 S. , Ill., graph. Darst. , 21 cm, 290 g
    Edition: 2. Aufl.
    ISBN: 9783863760175
    Series Statement: Espresso-Tutorials
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 160
    Monograph available for loan
    Monograph available for loan
    Princeton, NJ [u.a.] : Princeton Univ. Press
    Call number: PIK D 020-15-0141
    Description / Table of Contents: "Rethinking Private Authority examines the role of non-state actors in global environmental politics, arguing that a fuller understanding of their role requires a new way of conceptualizing private authority. Jessica Green identifies two distinct forms of private authority--one in which states delegate authority to private actors, and another in which entrepreneurial actors generate their own rules, persuading others to adopt them.Drawing on a wealth of empirical evidence spanning a century of environmental rule making, Green shows how the delegation of authority to private actors has played a small but consistent role in multilateral environmental agreements over the past fifty years, largely in the area of treaty implementation. This contrasts with entrepreneurial authority, where most private environmental rules have been created in the past two decades. Green traces how this dynamic and fast-growing form of private authority is becoming increasingly common in areas ranging from organic food to green building practices to sustainable tourism. She persuasively argues that the configuration of state preferences and the existing institutional landscape are paramount to explaining why private authority emerges and assumes the form that it does. In-depth cases on climate change provide evidence for her arguments.Groundbreaking in scope, Rethinking Private Authority demonstrates that authority in world politics is diffused across multiple levels and diverse actors, and it offers a more complete picture of how private actors are helping to shape our response to today's most pressing environmental problems"--
    Description / Table of Contents: Rethinking Private Authority examines the role of non-state actors in global environmental politics, arguing that a fuller understanding of their role requires a new way of conceptualizing private authority. Jessica Green identifies two distinct forms of private authority--one in which states delegate authority to private actors, and another in which entrepreneurial actors generate their own rules, persuading others to adopt them.Drawing on a wealth of empirical evidence spanning a century of environmental rule making, Green shows how the delegation of authority to private actors has played a small but consistent role in multilateral environmental agreements over the past fifty years, largely in the area of treaty implementation. This contrasts with entrepreneurial authority, where most private environmental rules have been created in the past two decades. Green traces how this dynamic and fast-growing form of private authority is becoming increasingly common in areas ranging from organic food to green building practices to sustainable tourism. She persuasively argues that the configuration of state preferences and the existing institutional landscape are paramount to explaining why private authority emerges and assumes the form that it does. In-depth cases on climate change provide evidence for her arguments.Groundbreaking in scope, Rethinking Private Authority demonstrates that authority in world politics is diffused across multiple levels and diverse actors, and it offers a more complete picture of how private actors are helping to shape our response to today's most pressing environmental problems.
    Type of Medium: Monograph available for loan
    Pages: XII, 215 S. , graph. Darst.
    ISBN: 9780691157580 (hardback) , 9780691157597 (paperback)
    Language: English
    Note: A theory of private authorityAgents of the state : a century of delegation in international environmental lawGovernors of the market : the evolution of entrepreneurial authorityAtmospheric police : delegated authority in the clean development mechanismAtmospheric accountants : entrepreneurial authority and the greenhouse gas protocol..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 161
    Call number: M 15.89463
    Type of Medium: Monograph available for loan
    Pages: 503 S. , Ill., graph. Darst. , 25 cm
    Edition: 1. Aufl.
    ISBN: 3836218054 (Gb.) , 9783836218054 (Gb.)
    Series Statement: SAP Press
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 162
    facet.materialart.11
    Barsinghausen : Binomi
    Call number: Block 2015/9
    Type of Medium: 11
    Pages: F1, 237 S., S. F2 - F4 , graph. Darst.
    Edition: 7. Aufl.
    ISBN: 9783923923366
    Parallel Title: Früh. Aufl. u.d.T.: Formeln + Hilfen zur höheren Mathematik
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 163
    Call number: IASS 16.90101
    Description / Table of Contents: In Theoriediskussion und Forschungspraxis hat das Erkenntnisinteresse an der sprachvermittelten Konstitution gesellschaftlicher Wirklichkeit in den Sozial- und benachbarten Wissenschaften zugenommen. Die Diskursanalyse spielt dabei heute eine zentrale Rolle, nachdem in unterschiedlichen Akzentuierungen bspw. die Gesprächsforschung, die Foucaultsche Diskurstheorie sowie die Habermassche Diskursethik den Diskursbegriff bekannt gemacht haben. Vor diesem Hintergrund hat sich in den letzten Jahren ein vielfältiges, aber auch unübersichtliches transdisziplinäres Feld von diskurstheoretischen und diskursanalytischen Ansätzen entwickelt. Das Handbuch bietet mit Beiträgen aus Soziologie, Psychologie, Politik-, Sprach- und Geschichtswissenschaften einen Überblick zu zentralen diskurstheoretischen Ansätzen und methodischen Fundamenten. Es richtet sich an das Fachpublikum, das den Diskussionsstand innerhalb der eigenen und der verwandten Disziplinen rezipieren möchte, sowie an Studierende und Forschende, die für eigene empirische Arbeiten Orientierung suchen.
    Type of Medium: Monograph available for loan
    Pages: 535 S. , Ill., graph. Darst.
    Edition: 3., erw. Aufl.
    ISBN: 9783531173511 (kart.)
    Series Statement: Interdisziplinäre Diskursforschung
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 164
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : VS, Verl. für Sozialwiss.
    Associated volumes
    Call number: IASS 16.90102
    Description / Table of Contents: Das Handbuch Sozialwissenschaftliche Diskursanalyse stellt in Einzelbeiträgen aus unterschiedlichen Disziplinen theoretische und methodologische Grundlagen sowie exemplarische Vorgehensweisen der Diskursforschung vor. Es wendet sich an Studierende und WissenschaftlerInnen, die sich mit der Diskursanalyse vertraut machen wollen. Der erste Teilband präsentiert theoretische Grundlagen und allgemeine methodische Zugänge unterschiedlicher Ansätze der Diskursforschung. Der vorliegende Teilband 2 versammelt in 16 Einzelbeiträgen exemplarische diskursanalytische Studien aus Soziologie, Geschichts- und Politikwissenschaft, Diskursiver Psychologie, Kritischer Diskursanalyse, linguistischer Diskursgeschichte und Korpuslinguistik. Im Vordergrund stehen nicht die jeweiligen Fragestellungen der Einzeluntersuchungen, sondern der Zusammenhang von Fragestellung, empirischem Design, Detailanalyse und Formulierung des Gesamtergebnisses. Die Erläuterung des methodischen Vorgehens an Beispielen eignet sich für den Einsatz in der Lehre wie für die Orientierung in Bezug auf Planung und Durchführung eigener Forschungsprojekte.
    Type of Medium: Monograph available for loan
    Pages: 533 S. , Ill., graph. Darst.
    Edition: 4. Aufl.
    ISBN: 9783531166513 (kart.)
    Series Statement: Interdisziplinäre Diskursforschung
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 165
    Monograph available for loan
    Monograph available for loan
    Oxford : Oxford Univ. Press
    Call number: PIK N 071-15-89127
    Type of Medium: Monograph available for loan
    Pages: XXIII, 317 S.
    Edition: 1. ed.
    ISBN: 0199686394 , 9780199686391
    Language: English
    Note: Introduction.EU energy law and the approach taken in this studyThe regulatory history of EU energy : the evolution of EU energy law from 1957 onwardsThe evolution of the sector-specific regulatory frameworkTreaty law and the energy sectorEnvironment and energy : on a bumpy road towards a clean energy futureThe international dimension of EU energy law and policyFrom state to market and back : the changing role(s) of markets and states in the EUConclusion.European energy law under the impact of globalization : from state to market, from plan to contract, from public ownership to economic regulation and beyond..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 166
    Monograph available for loan
    Monograph available for loan
    [Edgecumbe, N.Z.] : A. Muller
    Call number: M 15.89146
    Description / Table of Contents: An account of the results of the 2 March 1987 earthquake in the eastern Bay of Plenty and the aftermath's effects on the people and places on the Rangitaiki Plains
    Type of Medium: Monograph available for loan
    Pages: 223 S., , Ill.
    Language: English
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 167
    Monograph available for loan
    Monograph available for loan
    London : Thistle Publishing
    Call number: IASS 17.90724
    Type of Medium: Monograph available for loan
    Pages: i, 116 Seiten , Illustrationen
    ISBN: 9781910198179
    Language: English
    Note: Introduction -- A brief detour: 10 reasons why politicians fail to represent us (and always will) -- Delegation and irreflection: the twin roots of failed political representation -- #1 Discovering citizen deliberation in the Pacific Northwest -- #2 Voting like the Irish while campaigning like the French -- #3 Keeping a tight grip: the Swiss-Oregonian lock -- #4 Learning from the British tabloid press -- #5 Recovering our distance vision in Saint Petersburg -- Conclusion -- Postscript.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 168
    Call number: IASS 17.90836
    Description / Table of Contents: "Climate change is an issue that transcends and exceeds formal political and geographical boundaries. Social scientists are increasingly studying how effective policies on climate change can be enacted at the global level, 'beyond the state'. Such perspectives take into account governance mechanisms with public, hybrid and private sources of authority. Studies are raising questions about the ways in which state authority is constituted and practiced in the climate arena, and the implications for how we understand the potential and limits for addressing the climate problem. This book focuses on the rationalities and practices by which a carbon-constrained world is represented, categorized and ordered. The book will enable investigations into a range of sites (e.g., the body, home, shopping centre, firm, city, forests, streets, international bureaucracies, financial flows, migrants and refugees) where subjectivities around climate change and carbon are formed and contested. Despite a growing interest in this area of work, the field remains fragmented and diffuse. This edited collection brings together the leading scholarship in the field to cast new light on the question of how, why, and with what implications climate governance is taking place. It is the first volume to collect this body of scholarship, and provides a key reference point in the growing debate about climate change across the social sciences"--
    Type of Medium: Monograph available for loan
    Pages: XXIV, 270 S. , Ill., graph. Darst.
    ISBN: 9781107046269 (hardback) , 9781107624603 (paperback)
    Language: English
    Note: Machine generated contents note: Introduction J. Stripple and H. Bulkeley; Part I. Governmentality, Critical Theory and Climate Change: 1. Bringing governmentality to the study of global governance E. Lavbrand and J. Stripple; 2. Experimenting on climate governmentality with actor-network theory A. Blok; 3. Third side of the coin: hegemony and governmentality in global climate politics B. Stephan, D. Rothe and C. Methman; 4. The limits of climate governmentality C. Death; Part II. Cases of Climate Government: Theorising Practice: 5. Neuro-liberal climatic governmentalities M. Whitehead, R. Jones and J. Pykett; 6. Making carbon calculations S. Eden; 7. Smart meters and the governance of energy use in the household T. Hargreaves; 8. Translation loops and shifting rationalities of transnational bioenergy governance J. Kortelainen and M. Albrecht; 9. Governing mobile species in a climate-changed world J. Fall; 10. Measuring forest carbon H. Lovell; 11. Climate security as governmentality: from precaution to preparedness A. Oels; Part III. Future Directions: 12. The rise and fall of the global climate polity O. Corry; 13. Climate change multiple S. Randalls; 14. Reflections and way forward H. Bulkeley and J. Stripple..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 169
    Monograph available for loan
    Monograph available for loan
    Darmstadt : WBG (Wiss. Buchges.)
    Call number: 9/M 17.90844 ; 9/M 17.90844(2. Ex.)
    Type of Medium: Monograph available for loan
    Pages: 264 S. , zahlr. Ill., graph. Darst., Kt.
    Edition: 4., unveränd. Aufl.
    ISBN: 9783534262458
    Parallel Title: Erscheint auch als Vulkanismus
    Language: German
    Location: Reading room
    Location: Reading room
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 170
    Call number: 21/STR 17/03
    In: Scientific technical report
    Type of Medium: GFZ publications
    Pages: 204 Seiten , Illustrationen
    Series Statement: Scientific technical report / Deutsches GeoForschungsZentrum GFZ 17/03
    Classification:
    Ecology
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 171
    facet.materialart.12
    Potsdam : LGB (Landesvermessung und Geobasisinformation Brandenburg)
    Call number: 978-3-7490-4187-9 ; 21/M 18.90871 ; 21/M 18.90871 ; 21/M 18.90871
    Description / Table of Contents: Die Broschüre informiert zu 17 bedeutsamen Orten und stellt jedes Thema mit Hintergrundinformationen und zahlreichen anschaulichen Bildern vor. U.A. wird über die Geschichte des Geodätischen Instituts auf dem Potsdamer Telegrafenberg, die Standardbasis Potsdam von 1931 sowie die großen Geodäten Johann Jacob Baeyer, Friedrich Robert Helmert und Friedrich Gustav Gauß berichtet. Natürlich werden auch das im Land Berlin noch „aktive“ Soldnersystem Müggelberg, der deutsche Fundamentalpunkt Rauenberg, der Preußische Normal-Höhenpunkt 1879 sowie der deutsche Normalhöhenpunkt 1912 in Hoppegarten behandelt. Ein Beitrag über Meilensteine als Denkmale der Vermessungsgeschichte rundet die Broschüre thematisch ab. Die Broschüre wurde gleichzeitig als Fachpublikation und geodätischer Reiseführer konzipiert. Sie soll anregen, sich regional auf die Spuren der Landesvermessung zu begeben, und verdeutlicht gleichzeitig die Leistungen der Geodäsie in der Region und den Wandel der Landesvermessung in den letzten 150 Jahren. Die Standorte sind in Übersichtskarten dargestellt und mit Adressangaben versehen; für GPS-Enthusiasten sind die Koordinaten angegeben. Zusätzlich werden Informationen zur Zugänglichkeit und zur ÖPNV-Anbindung zur Verfügung gestellt.
    Type of Medium: 12
    Pages: 63 S. , Ill., Kt. , 30 cm
    Edition: Stand: März 2014
    ISBN: 9783749041879
    Language: German
    Note: Inhalt --- Geodätisches Institut auf dem Potsdamer Telegrafenberg --- Standardbasis Potsdam von 1931 --- Voglersches Schiebekathetometer und eine "fast vergessene" Messtrecke --- Denkmal für einen Pionier der Geodäsie - Joahnn Jacob Baeyer --- Grabstätte Frierich Robert Helmert --- Grabstätte Friedrich Gustav Gauß --- Soldnersystem Müggelberg - ein vermessungstechnisches Denkmal? --- Denkmal Trigonometrischer Punkt I. Ordnung Rauenberg --- Aussichtsturm auf dem Götzer Berg --- Denkmal Preußischer Normal-Höhenpunkt 1879 --- Normalhöhenpunkt 1912 in Hoppegarten --- Landeshaupthöhenpunkt in Berlin --- Satellitenbeobachtungsstation auf den Großen Ravensberg, Potsdam --- Baudenkmal Geodätenstand Berlin --- Historische Landesgrenzsteine Brandenburg - Sachsen --- Geographische Mittelpunkte --- Meilensteine als Denkmale der Vermessungsgeschichte
    Location: Reading room
    Location: Reading room
    Location: Reading room
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 172
    Monograph available for loan
    Chichester [u.a.] :Wiley-Blackwell,
    Call number: M 17.90737
    Type of Medium: Monograph available for loan
    Pages: XVI, 443 S. : , Ill., graph. Darst., Kt.
    Edition: 1. publ.
    ISBN: 9780470510322 , 9780470510315
    URL: Cover
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 173
    Monograph available for loan
    Monograph available for loan
    Bonn : Gemeinsame Wissenschaftskonferenz (GWK)
    Call number: PIK A 130-17-90903
    Type of Medium: Monograph available for loan
    Pages: 223 Seiten
    ISBN: 9783942342414
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 174
    Monograph available for loan
    Monograph available for loan
    Fairbanks, Alas. : Institute of Northern Engineering, University of Alaska
    Associated volumes
    Call number: AWI G3-16-90316-1
    In: Ninth International Conference on Permafrost, extended abstracts
    Type of Medium: Monograph available for loan
    Pages: 372 Seiten , Illustrationen
    Series Statement: Ninth International Conference on Permafrost extended abstracts
    Language: English
    Note: Contents: Preface. - NICOP Sponsors. - Deep Permafrost Studies at the Lupin Mine: Hydrogeological and Geochemical Information for Nuclear Waste Disposal / L. Ahonen, T. Ruskeeniemi, R. Stotler, S. Frape, K. Lehto, I. Puigdomenech, M. Hobbs, and P. Degnan. - Effect of Fire on Pond Dynamics in Regions of Discontinuous Permafrost: A State of Change Following the Fires of 2004 and 2005? / G. Altmann, D. Verbyla, K. Yoshikawa, and J. Fox. - Cryological Status of Russian Soils: Cartographic Assessment / T.V. Ananko, D.E. Konyushkov, and E.M. Naumov. - Acoustical Surveys of Methane Plumes Using the Quantitative Echo Sounder in the Japan Sea / C. Aoyama, R. Matsumoto, M. Hiromatsu, and G. Snyder. - Permafrost Delineation Near Fairbanks, Alaska, Using Geophysical Techniques / B.N. Astley and A.J. Delaney. - Preparatory Work for a Permanent Geoelectrical Measurement Station for Permafrost Monitoring at the Hoher Sonnblick, Austria / M. Avian, A. Kellerer-Pirklbauer, A. Römer, and R. Supper. - A Provisional Soil Map of the Transantarctic Mountains, Antarctica / M.R. Balks, M. McLeod, and J.G. Bockheim. - Martian Permafrost Depths from Orbital Neutron and Temperature Measurements / J.L. Bandfield and W.C. Feldman. - Time Series Analyses of Active Microwave Satellite Data for Monitoring of Hydrology at High Latitudes / A. Bartsch. - Impact of Permafrost Degradation on Carbon and Nitrogen Stocks Related to Pedogenesis and Ecosystem Functioning / F. Baumann, J-S. He, P. Kühn, and T. Scholten. - DC Resistivity Soundings Across a Pebbly Rock Glacier, Kapp Linné, Svalbard / I. Berthling and H. Juliussen. - Modeling Thermal and Moisture Regimes of Permafrost with New Deep Soil Configuration in CLASS / J-P. Blanchette, L. Sushama, and R. Laprise. - A Provisional Permafrost Map of the Transantarctic Mountains / J.G. Bockheim, M. McLeod, and M.R. Balks. - Alpine Permafrost Distribution at Massif Scale: Assessment of Mean Surface Temperatures During the Winter Equilibrium Period Thanks to Topoclimatic and Geomorphological Data (Combeynot Massif, French Alps) / X. Bodin, P. Schoeneich, and M. Fort. - Cryogenic Formations of the Caucasus and the Significance of Their Impact on the Natural Phenomena of the Region / I.V. Bondyrev. - Modeling Potential Climatic Change Impacts on Mountain Permafrost Distribution, Wolf Creek, Yukon, Canada / P.P. Bonnaventure and A.G. Lewkowicz. - A Hypothesis: A Condition of Growth of Thick Ice Wedges / A. Brouchkov. - Modeled Continual Surface Water Storage Change of the Yukon River Basin / R. Bryan, L.D. Hinzman, and R.C. Busey. - Freeze/Thaw Properties of Tundra Soils, with Applications to Trafficability on the North Slope, Alaska / C.F. Bryant, R.F. Paetzold, and M.R. Lilly. - Discontinuous Permafrost Distribution and Groundwater Flow at a Contaminated Site in Fairbanks, Alaska / A.E. Carlson and D.L. Barnes. - Thermal Regime Within an Arctic Waste Rock Pile: Observations and Implications / J.W. Cassie and L.U. Arenson. - Seasonal and Interannual Variability of Active Layer Development in Permafrost Wetland Systems / C.M. Chiu and L.C. Bowling. - Twelve-Year Thaw Progression Data from Zackenberg, Northeast Greenland / H.H. Christiansen and C. Sigsgård. - Continued Permafrost Warming in Northwest Alaska as Detected by the DOI/GTN-P Borehole Array / G.D. Clow. - Landsliding Following Forest Fire on Permafrost Slopes, Klondike Area, Yukon, Canada / J. Coates and A.G. Lewkowicz. - A Permafrost Model Incorporating Dynamic Variable Soil Depth and Properties / R. Coppell and S. Venevsky. - Seasonal Sources of Soil Respiration from High Arctic Landscapes Dominated by Polar Stripes / C.I. Czimczik, S.E. Trumbore, and J. Welker. - Greenland Permafrost Temperature Simulations / R.P. Daanen, V.E. Romanovsky, S.S. Marchenko, J.H. Christensen, M. Stendel, and T. Ingeman-Nielsen. - The Importance of Snow Cover Evolution in Rock Glacier Temperature Modeling / M. DallAmico, S. Endrizzi, R. Rigon, and S. Gruber. - The Account of Long-Term Air Temperature Changes for Building Design in Permafrost / I.V. Davidova and L.N. Khroustalev. - The Combined Isotopic Analysis of Late Quaternary Ice Wedges and Texture Ice at the Lena-Anabar Lowland, Northern Siberia / A. Dereviagin, H. Meyer, A. Chizhov, and D. Magens. - Adaptating and Managing Nunavik’s Transportation Infrastructure / G. Doré, A. Guimond, and G. Grondin. - Human Experience of Cryospheric Change in Nunavut, Canada: Preliminary Findings / N. Doubleday, S. Donaldson, T. Vlasova, A. Kushwaha, and M. Ip. - HiRISE Observations of Fractured Mounds in the Martian Mid-Latitudes / C.M. Dundas and A.S. McEwen. - A Soil Freeze-Thaw Model Through the Soil Water Characteristic Curve / S. Endrizzi, R. Rigon, and M. DallAmico. - Mapping and Modeling the Distribution of Permafrost in the Nordic Countries / B. Etzelmüller, H. Farbrot, O. Humlum, H. Christiansen, H. Juliussen, K. Isaksen, T.V. Schuler, R.S. Ødegård, and H. Ridefelt. - First Results of Ground Surface Temperature Modeling in Finnmark, Northern Norway / H. Farbrot, B. Etzelmüller, K. Isaksen, T.V. Schuler, O.E. Tveito, and H.H. Christiansen. - Historical Changes in the Seasonally Frozen Ground Regions of the Russian Arctic / O.W. Frauenfeld, T. Zhang, A.J. Etringer, R.G. Barry, and D. Gilichinsky. - Rock Glaciers in the Kåfjord Area, Troms, Northern Norway / R. Frauenfelder, J. Tolgensbakk, H. Farbrot, and T.R. Lauknes. - Snowpack Evolution on Permafrost, Non-Permafrost Soils, and Glaciers in the Monte Rosa Massif (Northwest Alps, Italy) / M. Freppaz, M. Maggioni, S. Gandino, and E. Zanini. - Climate Change in Permafrost Regions in North America / M.K.Gavrilova. - Maximizing Construction Season in a Subarctic Environment, Fort Wainwright, Alaska / Q. Gehring and F.J. Wuttig. - Pleistocene Sand-Wedge, Composite-Wedge, and Complex-Wedge Growth in Flanders, Belgium / G. Ghysels, I. Heyse, J.-P. Buylaert, A.S. Murray, D. Vandenberghe, F. De Corte, and P. Van den haute. - Response of Arctic and Subarctic Soils in a Changing Earth (RASCHER) – Project of IPY: Methodology, Activity, Results / S.V. Goryachkin, J.M. Kimble, N.B. Badmaev, M. Drewnik, D.G. Fedorov-Davydov, S.A. Iglovski, E.M. Lapteva, G.M., Mazhitova, N.S. Mergelov, V.E. Ostroumov, and E-M. Pfeiffer. - Monitoring of the Floodplain Talik Downstream from the Ust’-Srednekan Reservoir / S.A. Guly and V.M. Mikhailov. - Retrogressive Thaw Slump Impacts on Inconnu Spawning Habitat in the Selawik River, Alaska / R. Hander, K. Yoshikawa, and N. OlsonClimatic Change and Permafrost Stability in the Eastern Canadian Cordillera / S.A. Harris. - Idealized Modeling of the Impact of Atmospheric Forcing Variables on Mountain Permafrost Degradation / C. Hauck and N. Salzmann. - A Method for the Analysis of the Thermal Permafrost Dynamics / M.A. Hidalgo, J.J. Blanco, M. Ramos, D. Tomé, and G. Vieira. - Ground Truth Observations of the Interior of a Rock Glacier as Validation for Geophysical Monitoring Datasets / C. Hilbich, I. Roer, and C. Hauck. - Internal Structure of Rock Glacier Murtèl Delineated by Electrical Resistivity Tomography and Forward/Inverse Modeling / C. Hilbich. - Permafrost Degradation Beneath a Heat-Producing Coal Waste Rock Pile, Svalbard (78°N) / J. Hollesen and B. Elberling. - Patterns in Soil Carbon Distribution in the Usa Basin (Russia): Linking Soil Properties to Environmental Variables in Constrained Gradient Analysis / G. Hugelius and P. Kuhry. - Total Storage and Landscape Distribution of Soil Carbon in the Central Canadian Arctic Using Different Upscaling Tools / G. Hugelius, P. Kuhry, C. Tarnocai, and T. Virtanen. - Liquid Water Destabilizes Frozen Debris Slope at the Melting Point: A Case Study of a Rock Glacier in the Swiss Alps / A. Ikeda and N. Matsuoka. - TSP NORWAY – Thermal Monitoring of Mountain Permafrost in Northern Norway / K. Isaksen, H. Farbrot, B. Etzelmüller, H.H. Christiansen, L.H. Blikra, K. Midttømme, and J.S. Rønning. - Mapping the Mountain Permafrost in Areas Surrounding
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 175
    Call number: PIK D 029-17-90802
    Description / Table of Contents: Examines how knowledge regimes are organized, operate, and have changed over the last thirty years in the United States, France, Germany, and Denmark. They show how there are persistent national differences in how policy ideas are produced. Some countries do so in contentious, politically partisan ways, while others are cooperative and consensus oriented. They find that while knowledge regimes have adopted some common practices since the 1970s, tendencies toward convergence have been limited and outcomes have been heavily shaped by national contexts.
    Type of Medium: Monograph available for loan
    Pages: XVIII, 401 Seiten , graph. Darst.
    ISBN: 9780691161167 (pbk) , 9780691150314 (cloth)
    Language: English
    Note: Contents: Preface ; Chapter 1: Knowledge Regimes and the National Origins of Policy Ideas ; Part I: The Political Economy of Knowledge Regimes ; Chapter 2: The Paradox of Partisanship in the United States ; Chapter 3: The Decline of Dirigisme in France ; Chapter 4: Coordination and Compromise in Germany ; Chapter 5: The Nature of Negotiation in Denmark ; Reprise: Initial Reflections on the National Cases ; Part II: Issues of Similarity and Impact ; Chapter 6: Limits of Convergence ; Chapter 7: Questions of Influence ; Part III: Conclusions ; Chapter 8: Summing Up and Normative Implications ; Postscript: An Agenda for Future Research ; Appendix: Research Design and Methods
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 176
    Call number: M 17.90805
    Type of Medium: Monograph available for loan
    Pages: 232 S. , Ill., Kt. , 30 cm
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 177
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 00.0652(2013-2015
    In: Erdbebenbeobachtung im Freistaat Sachsen
    Type of Medium: Series available for loan
    Pages: 54 Seiten , farbige Illustrationen und graphische Darstellungen
    Series Statement: Erdbebenbeobachtung in Mitteldeutschland
    Classification:
    Seismology
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 178
    Monograph available for loan
    Monograph available for loan
    Chichester [u.a.] : The British Psychological Society/BPS Blackwell
    Call number: IASS 17.90810
    Description / Table of Contents: "Explores the environment's effects on human wellbeing and behaviour, factors influencing environmental behaviour and ways of encouraging pro-environmental action"--
    Type of Medium: Monograph available for loan
    Pages: XXIX, 376 S. , Ill., graph. Darst.
    ISBN: 9780470976388 (pbk)
    Series Statement: BPS textbooks in psychology
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 179
    Unknown
    Oxford : Oxford University Press
    Call number: 22/M 15.89566 (1. Ex.) ; 22/M 15.89566 (2. Ex.) ; 22/M 15.89566 (3. Ex.) ; 22/M 15.89566 (4. Ex.) ; 22/M 15.89566 (5. Ex.) ; 22/M 15.89566 (6. Ex.) ; 22/M 15.89566 (7. Ex.) ; 22/M 15.89566 (8. Ex.) ; 22/M 15.89566 (9. Ex.) ; 22/M 15.89566 (10. Ex.)
    Description / Table of Contents: Completely revised and updated, this new edition of the Oxford Guide to Plain English is an essential tool for clear communication. It provides authoritative help on how to get your message across effectively. In 25 easy-to-follow chapters, it covers straightforward language, punctuation, grammar, writing emails, and much more.
    Pages: xxxii, 288 S. , Ill. , 20 cm
    Edition: 4. edition
    ISBN: 0199669171 ((pbk.) £7.99) , 9780199669172 ((pbk.) £7.99)
    Language: English
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 180
    Call number: PIK W 200-16-89600 ; M 19.89600
    Type of Medium: Monograph available for loan
    Pages: 367 S. , farb. Ill. + graph. Darst.
    ISBN: 9783361007017
    Classification:
    Meteorology and Climatology
    Location: Upper compact magazine
    Branch Library: PIK Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 181
    Call number: PIK D 025-16-89602
    Type of Medium: Monograph available for loan
    Pages: IX, 283 S. , graph. Darst. , 240 mm x 168 mm
    ISBN: 3658062754 , 9783658062750 , 9783658062767
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 182
    Monograph available for loan
    Monograph available for loan
    New Brunswick [u.a.] : Aldine
    Call number: IASS 16.90431
    Type of Medium: Monograph available for loan
    Pages: X, 271 S.
    Edition: 3. paperback print.
    ISBN: 9780202302607
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 183
    Monograph available for loan
    Monograph available for loan
    Boston, Mass. : Mariner | Boston [u.a.] : Houghton Mifflin Harcourt
    Call number: IASS 16.90441
    Type of Medium: Monograph available for loan
    Pages: 262 S.
    ISBN: 9780618990610 , 9780547520230 (pbk.)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 184
    Call number: IASS 16.90149
    Description / Table of Contents: Dieses Buch ist die bislang einzige deutschsprachige Einführung in das Statistikprogramm Stata und zugleich das einzige Buch über Stata, das auch Anfängern eine ausreichende Erklärung der Datenanalysetechnik liefert. Dabei handelt es sich um kein reines Befehls-Handbuch, vielmehr werden alle Schritte einer Datenanalyse an praktischen Beispielen vorgeführt und erläutert. Diese Beispiele beziehen sich auf Themen der öffentlichen Diskussion oder der direkten Umgebung der meisten Leser. Dies erlaubt den Verzicht auf wissenschaftliche Theorien zur Begründung der Analysebeispiele und erleichtert eine interdisziplinäre Anwendung. Die Neuauflage enthält nicht nur Anpassungen an die neueste Stata Programmversion (Version 12) sondern auch ein komplett neues Kapitel zur Inferenzstatistik und der Analyse von Survey Daten. Des Weiteren werden neue Entwicklungen zur grafischen Darstellung von Regressionsergebnissen berücksichtigt.
    Type of Medium: Monograph available for loan
    Pages: IX, 467 S. , Ill., graph. Darst. , 24 cm
    Edition: 4., aktualisierte und überarb. Aufl.
    ISBN: 3486709216 (Pb.) , 9783486709216 (Pb.)
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 185
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 91.0021(43)
    In: Mainzer geowissenschaftliche Mitteilungen
    Type of Medium: Series available for loan
    Pages: 240 S. : z.T. farb. Ill., graph. Darst., Kt.
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 186
    Call number: 3/S 91.1097(2015)
    In: BGR report
    Type of Medium: Series available for loan
    Pages: 84 S. : zahlr. farb. Ill. + 1 CD-ROM
    Series Statement: BGR-Report 2015
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 187
    Call number: IASS 16.89630/1
    Type of Medium: Monograph available for loan
    Pages: 107 S. , zahlr. Ill., graph. Darst. , 1 Bl. Bauanleitung - 1 Bl. Entwurf , 28 cm
    Language: German , English
    Note: Text dt. und engl. - Text in Faltbl. [1] dt.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 188
    Monograph available for loan
    Monograph available for loan
    Oxford [u.a.] : Oxford Univ. Press
    Call number: IASS 16.90503
    Type of Medium: Monograph available for loan
    Pages: XIII, 269 S
    Edition: repr
    ISBN: 0198292260 , 019829509X , 9780198295099
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 189
    Monograph available for loan
    Monograph available for loan
    Basingstoke [u.a.] : Palgrave Macmillan
    Call number: IASS 16.90510
    Type of Medium: Monograph available for loan
    Pages: XI, 216 S , graph. Darst
    ISBN: 0230019870 (pbk) , 9780230019874 (pbk) , 0230019862 (hbk) , 9780230019867 (hbk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 190
    Series available for loan
    Series available for loan
    Potsdam : IASC
    Associated volumes
    Call number: AWI P5-16-89748
    In: IASC ... bulletin
    Type of Medium: Series available for loan
    Pages: 118 S. , Ill., graph. Darst., Kt.
    ISBN: 978-3-9813637-9-1
    ISSN: 1654-7594
    Note: Content: Preface. - 1. IASC Internal Development. - IASC Organization. - IASC Council. - Executive Committee. - Secretariat. - IASC Review. - New Member Country Portugal. - ISIRA. - 2. IASC Working Groups. - Atmosphere Working Group. - Cryosphere Working Group. - Marine Working Group. - Social and Human Working Group. - Terrestrial Working Group. - 3. IASC Networks. - Arctic Coastal Dynamics Network (ACD). - Arctic Freshwater System Synthesis Network (AFS). - Arctic in Rapid Transition Network (ART). - Circum-Arctic Lithosphere Evolution Network (CALE). - INTERACT. - Network on Arctic Glaciology (NAG). - Polar Archaeology Network (PAN). - Palaeo-Arctic Spatial and Temporal Gateways Network (PAST Gateways). - 4. Arctic Science Summit Week 2015. - ICARP III / ISAR-4 Opening Session. - Toyama Conference Statement. - IASC's 25th Anniversary. - IASC Award for Service. - Indigenous participants. - Upcoming ASSWs 2016-2018. - 5. Data and observations. - Arctic Data Committee (ADC). - Sustaining Arctic Observing Networks (SAON). - Arctic Observing Summit (AOS). - 6. Partnerships. - Ice Sheet Mass Balance and Sea Level (ISMASS). - 7. Capacity Building. - IASC Fellowship Program. - Overview of supported Early Career Scientists. - 8. Publications. - IASC History Publication. - Arctic Freshwater Synthesis. - Emerging Questions in Arctic Geosciences. - Annex. - List of Acronyms and Abbreviations.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 191
    Call number: IASS 16.91044
    Type of Medium: Monograph available for loan
    Pages: XVI, 267 S , Ill., graph. Darst. , 235 mm x 155 mm
    ISBN: 364238594X (hbk) , 9783642385940 (hbk) , 3662522225 (pbk) , 9783662522226 (pbk) , 9783642385957 (eBook)
    Language: English
    Note: Foreword; Preface; Acknowledgments; Contents; Abbreviations; Part I The Arctic Environment; 1 Introduction to the Arctic ,; Abstract; 1.1 Arctic Marine Area; 1.2 Law of the Sea in the Arctic Marine Area; 1.3 Arctic Council; 1.4 Arctic Policies of the EU and US; 1.4.1 EU Arctic Policy and Competences; 1.4.2 US Arctic Policy; 1.5 EU and US Marine Policy; 1.5.1 EU Maritime Policy; 1.5.2 US Ocean Policy; 1.6 Conclusion; References; 2 The Arctic Marine Environment; Abstract; 2.1 Introduction; 2.2 The Arctic Environment; 2.2.1 Marine Environment; 2.2.2 Land-Based Impacts on the Marine Environment. , 2.3 Specific Threats2.3.1 Climate Change; Sea Ice Reduction; Melting Glaciers and Rising Sea Levels; Greenhouse Gas Release by Melting Permafrost; Ocean Acidification; 2.3.2 Chemicals and Air Pollution; 2.3.3 Fisheries; 2.3.4 Shipping; 2.3.5 Oil and Gas Extraction; 2.3.6 Tourism; 2.3.7 Nuclear and Radioactive Waste (Including Military Use); 2.4 Conclusion; References; 3 Environmental Governance in the Marine Arctic ,; Abstract; 3.1 Introduction; 3.2 Environmental Governance; 3.3 Legal and Policy Framework; 3.3.1 Global Agreements and Institutions; 3.3.2 Regional and Sub-Regional Regimes. , 3.3.3 Informal Approaches and Initiatives3.4 Analysis of Governance Shortcomings; 3.5 Perspectives on the Way Forward: Policy Pathways; 3.5.1 Principles of Environmental Governance; 3.5.2 Conclusion and Questions for Discussion; References; 4 Arctic Indigenous Peoples and the Challenge of Climate Change ,; Abstract; 4.1 Introduction; 4.2 Arctic Indigenous Peoples; 4.2.1 Traditional Harvesting and Mixed Economies; 4.2.2 Challenges for Indigenous Societies and Culture; 4.2.3 Political and Legal Framework; 4.2.4 Arctic Cooperation. , 4.3 Climate Change Impacts, Stressors, and Indigenous Vulnerability4.3.1 Primary Impacts on Livelihoods, Harvesting, Health, and Infrastructure; 4.3.2 Impacts on Northern Economies, Societies, Cultures and Health; 4.4 Adaptive Capacity and Proposed Responses to Climate Change; 4.4.1 The Concepts of Adaptation and Adaptive Capacity; 4.4.2 Autonomous Adaptations; 4.4.3 Adaptation Planning and Governance; 4.4.4 Barriers to Adaptation; 4.5 Criticism Towards Vulnerability and Adaptation Approaches; 4.5.1 Crisis Narrative and Resilience Language; 4.5.2 Adaptation Governance as Intervention. , 4.5.3 Using Traditional Knowledge4.6 Empowerment as a Primary Response; 4.6.1 Co-management, Participatory Capacities, and Clear Outcomes of Participatory Engagement; 4.6.2 Indigenous Rights; 4.7 Conclusion: A Holistic Response; References; Part II Impacts and Activities in the Marine Arctic; 5 Status and Reform of International Arctic Fisheries Law; Abstract; 5.1 Introduction; 5.2 Arctic Fish Stocks, Fisheries, and Climate Change; 5.3 International Legal and Policy Framework for Arctic Fisheries Management; 5.3.1 Interests, Rights, Obligations, and Jurisdiction. , 5.3.2 Substantive Fisheries Standards.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 192
    Call number: IASS 17.91052
    In: Incerto
    Type of Medium: Monograph available for loan
    Pages: XI, 156 Seiten
    ISBN: 9780141985022
    Series Statement: Incerto / Nassim Nicholas Taleb
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 193
    Monograph available for loan
    Monograph available for loan
    Bonn ;Boston : Galileo Press
    Call number: M 16.89804
    Type of Medium: Monograph available for loan
    Pages: 432 Seiten , zahlreiche Illustrationen , 1 Referenzkarte , 25 cm
    Edition: 3., aktualisierte und erweiterte Auflage
    ISBN: 9783836217422 (Pp.)
    Series Statement: SAP Press
    Parallel Title: Früh. Aufl. u.d.T.: Hellberg, Torsten: Einkauf mit SAP MM
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 194
    Monograph available for loan
    Monograph available for loan
    London [u.a.] : Routledge
    Call number: IASS 16.90357
    Keywords: Sozialanthropologie ; Ethnologie ; Humanökologie ; Ökologische Psychologie ; Umweltwahrnehmung ; Entwicklungsbiologie ; Soziale Evolution ; Humanökologie ; Umweltwahrnehmung ; Umweltveränderung ; Technologie
    Type of Medium: Monograph available for loan
    Pages: XIX, 465 S. , Ill., graph. Darst. , 25 cm
    Edition: reissued with a new preface
    ISBN: 9780415617475 , 9780415228312
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 195
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: M 16.89855
    Description / Table of Contents: The first global overview of intraplate earthquakes, their mechanical models and investigative geophysical techniques, for academic researchers, professionals and engineers
    Type of Medium: Monograph available for loan
    ISBN: 9781107040380
    Parallel Title: Print version: Intraplate Earthquakes
    Language: English
    Note: Cover; Half title; Title; Copyright; Contents; Contributors; Preface; 1 Introduction; 2 Intraplate earthquakes in Australia; 2.1 Introduction; 2.2 Two centuries of earthquake observations in Australia; 2.2.1 Mechanism, geographic distribution, and strain rate; 2.2.2 Seismogenic depth; 2.2.3 Attenuation and scaling relations; 2.3 A long-term landscape record of large (morphogenic) earthquakes; 2.3.1 Variation in fault scarp length and vertical displacement; 2.3.2 The influence of crustal type and character on seismic activity rates; 2.4 Patterns in earthquake occurrence. , 2.5 Maximum magnitude earthquake2.5.1 Scarp length as a proxy for paleo-earthquake magnitude; 2.6 Implications for SCR analogue studies: factors important in earthquake localisation; 2.6.1 Mechanical and thermal influences; 2.6.2 Structural architectural influences; 2.7 Conclusions; Acknowledgements; 3 Intraplate seismicity in Brazil; 3.1 Introduction; 3.2 Earthquake catalogue; 3.3 Seismicity map; 3.4 Seismotectonic correlations; 3.4.1 Lower seismicity in Precambrian cratonic provinces; 3.4.2 Intraplate seismicity and cratonic roots; 3.4.3 Passive margin seismicity. , 3.4.4 Influence of neotectonic faults3.4.5 Flexural stresses; 3.5 Discussion and conclusions; Acknowledgments; 4 Earthquakes and geological structures of the St. Lawrence Rift System; 4.1 Introduction; 4.2 Historical earthquakes and their impact; 4.3 Seismic zones of the SLRS; 4.3.1 Charlevoix; 4.3.2 Lower St. Lawrence; 4.3.3 Western Quebec; 4.3.4 Background seismicity; 4.4 The St. Lawrence Rift System; 4.5 The rift hypothesis and the SLRS: discussion and conclusions; Acknowledgments; 5 Intraplate earthquakes in North China; 5.1 Introduction; 5.2 Tectonic background; 5.2.1 Geological history. , 5.2.2 Lithospheric structure5.2.3 Major seismogenic faults; 5.3 Active tectonics and crustal kinematics; 5.4 Strain rates and seismicity; 5.5 Seismicity; 5.5.1 Paleoseismicity; 5.5.2 Large historic events; 1303 Hongdong earthquake (M 8.0); 1556 Huaxian earthquake (M 8.3); 1668 Tancheng earthquake (M 8.5); 1679 Sanhe earthquake (M 8.0); 1695 Linfen earthquake (M 7.5-8.0); 5.5.3 Large instrumentally recorded earthquake; The 1966 Xingtai earthquake (Ms 7.2); The 1975 Haicheng earthquake (Ms 7.3); The 1976 Tangshan earthquake (Ms 7.8); 5.6 Spatiotemporal patterns of large earthquakes. , 5.6.1 Long-distance roaming of large earthquakes5.6.2 Fault coupling and interaction; 5.6.3 A conceptual model for mid-continental earthquakes; 5.7 Implications for earthquake hazards; Acknowledgements; 6 Seismogenesis of earthquakes occurring in the ancient rift basin of Kachchh, Western India; 6.1 Introduction; 6.2 Tectonic framework, structure, and tectonic evolution of Kachchh Rift basin; 6.2.1 Structure and tectonics; 6.2.2 Tectono-volcanic events; 6.2.3 Tectonic evolution and existing earthquake generation models of the Kachchh Rift zone. , 6.2.4 Identification of magmatic intrusive bodies.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 196
    Monograph available for loan
    Monograph available for loan
    Baden-Baden : Nomos
    Call number: IASS 17.91105
    Type of Medium: Monograph available for loan
    Pages: 243 S.
    Edition: 1. Aufl.
    ISBN: 9783848705153
    Series Statement: Zeitschrift für Politikwissenschaft 2013
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 197
    Monograph available for loan
    Monograph available for loan
    Oxford : Oxford University Press
    Call number: IASS 17.91114
    Type of Medium: Monograph available for loan
    Pages: XI, 353 S.
    ISBN: 9780198713708
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 198
    Call number: AWI G3-17-91084-1
    In: Kvarter vo vsem ego mnogoobrazii, Tom 1
    Type of Medium: Monograph available for loan
    Pages: 319 S. , Ill., graph. Darst., Kt.
    ISBN: 978-5-91918-123-1
    Language: Russian , English
    Note: TABLE OF CONTENTS: Predislovie. - Problems of absolute chronology and correlation of the Pleistocene glaciations in Gorny Altai / A. R. Agatova, R. K. Nepop. - Ecological and geomorphological consequences of mineral deposits development in conditions of the arid zone of Kazakhstan / K. M. Akpambetova. - Forming conditions of bottom sediments of Prokopievskoe Lake (Northern Karelia) according to the diatoms data / A. N. Alekseeva, O. P. Korsakova. - Lithostratigraphy of the quaternary deep sea sediments / T. N. Alekseeva, V. N. Sval'nov. - Climatic records from sediments of Elgygytgyn Lake (Polar Chukotka) / P. M. Anderson, A. V. Lozhkin. - First records of environmental change from lake sediments of the Kuril Archipelago / P. M. Anderson, A. V. Lozhkin, P. S. Minuyk, A. Yu. Pakhomov, T. B. Solomatkina, M. V. Cherepanova. - Late Pliocene / early Pliocene environments of the North-Eastern Siberian Arctic inferred from Lake El'gygytgyn pollen record / A. A. Andreev, M. Melles, V. Wennrich, J. Brigham-Grette. - The middle Neopleistocene of the Timan-Pechora-Vychegda Region / L. N. Andreicheva. - Kargian megainterstadial of the Prebaikalia: geochronology and paleogeography / Kh. A. Arslanov, N. E. Berdnikova, S. B. Chernov, G. A. Vorobioba, I. V. Enuschenko, D. V. Kobylkin, R. E. Maksimov, Yu. V. Ryzhov, A. A. Starikova. - The human and environment of Southeast Baltic on the boundary of the Pleistocene and the Holocene / Kh. A. Arslanov, O. A. Druzhinina, M. A. Kulkova, T. V. Sapelko, D. A. Subetto, I. N. Skhodnov. - Age of soil-pyroclastic sequences and chronology of volcanic activity on Matua Island (Central Kurils) during the Holocene / Kh. A. Arslanov, I. V. Melekestsev, N. G. Razjigaeva, A. V. Degterev, A. V. Rybin. - Summary of the Upper Pleistocene correlations in the Russian North / V. I. Astakhov. - Holocene climatic events in Amur River Basin and their correlation / V. B. Bazarova, L. M. Mokhova, T. A. Grebennikova. - About a western boundary of Dnieper glaciation on the southern east-european platform / M. Bargl. - On the causes of two most significant events of the Holocene / A. A. Barenbaum. - On the issue of the construction of the quaternary stratigraphy scale and frequency of the meteoric impacts / A. A. Barenbaum. - Stratigraphy of the sediments from the Mendeleev Rise, (Central Arctic Ocean), based on benthic foraminifera and ostracoda / V. A. Basov, N. V. Kupriyanova, E. S. Novikhina. - Paleosecular geomagnetic variations and late Weichselian Holocene magnetochronology in N-W Russia / V. G. Bakhmutov. - Biostratigraphy of sediments middle and late Holocene in the basin downstream Ussuri / P. S. Belyanin. - The palynology characteristic of loess loam sediments of Ussuri-Khankarazdolnaya depression in the middle and late Neopleistocene / P. S. Belyanin, N. I. Belyanina. - Glacio-marine deposits on the Northern Prinze Charls Mountains (East Antarctica) / A. S. Birjukov, M. S. Egorov. - Features of environmental and climatic changes in the Northern Caspian Sea Region and Caspian Sea Level fluctuations controlled by climate during the Holocene / N. S. Bolikhovskaya. - "Milankovitch Theory" - What does it mean? / V. A. Bolshakov. - MIS 11 problem and supposed 400-kyr Pleistocene climate cycle / V. A. Bolshakov, I. A. Karevskaya. - Sedimentation in the Kamennoe Lake (Kanin Peninsula) and climate changes during the Holocene according to the lake sediments / D. Yu. Bolshiyanov, P. S. Vakhrameeva, G. B. Fedorov, N. A. Bakunov, T. V. Sapelko, A. V. Ludikova, A. S. Makarov, M. V. Pavlov. - Relief and quaternary deposits of the South-Eastern Part of Taimyr Peninsula / D. Yu. Bolshiyanov, G. B. Fedorov, A. V. Krylov, Kh. A. Arslanov, J. Tide. - Last glaciation of the Russian Arctic / B. A. Borisov, E. A. Minina. - Short-term landscape and climatic oscillations in the late glacial: the main steps, results and future prospects of research / O. K. Borisova. - Late Quaternary Plankton biostratigraphy in the Knipovich Ridge Area (North Atlantic) / M. E. Bylinskaya, L. A. Golovina, E. P. Radionova. - Palaeolimnological investigations in the Laptev Sea Region / P. S. Vakhrameeva, D. A. Subetto, B. Diekmann, B. Biskaborn, L. Heinecke, G. Muller. - Strucute and genesis of Gorodok elevation in North-East Belarus / A. Vashkov. - Present problems in the Quaternary (Postapsheronskii) stratigraphy and geochronology of the Caspian Sea Sediments / S. S. Veliev, E. N. Tagieva. - Problem of paleogeography of East Europe in late Pliocene and early Pleistocene / A. A. Velichko, V. V. Pisareva, M. A. Faustova. - Regularities of modern relief organization of Kolyma lowland tundra landscapes (Northeast Siberia) - Remote sensing and GIS Studies / A. A. Veremeeva. - The joint German-Russian Polygon Project - Environmental studies in East Siberian Tundra wetlands / S. Wetterich, A. Bobrov, U. Herzschuh, H. Joosten, L. Pestryakova, E.-M. Pfeijfer, L. Kutzbach, L. Schirrmeister, D. Subetto, V. Tumskoy. - Interglacial environments of Oyogos Yar (Dmitry Laptev Strait) / S. Wetterich, R. Kienast, S. Kuzmina, A. A. Andreev, L. Nazarova, L. Schirrmeister, V. V. Kunitsky. - Geological significance of section "Ogurtsovo" in district of Novosibirsk / I. A. Volkov, S. P. Kazmin. - Present problems of the Quaternary period stratigraphy of the West and Middle Siberia / V. S. Volkova. - New data on the evolution and age of sediments, enclosing the cultural horizon of middle Paleolithic Site Khotylevo-1 (River Desna Basin) / E. V. Voskresenskaya, L. B. Vishniytskiy, I. S. Zuganova, E. U. Novenko, A. K. Ocherednoy. - The Lake Sedimentogenez and features of the Paleogeography Prihankayskoy depression in Late Cenozoic / T. N. Voskresenskaya. - Relief and loose desposits of the Russian Plain main watershed protected areas in the South-East Onega / A. I. Voskresenskiy, I. S. Voskresenskiy, A. N. Kichigin. - Distribution of cryogenic micro relief in low mountainous massifs of the Kola Peninsula / E. V. Garankina. - Change of landscapes in early Pleistocene histories of East European Plane / N. I. Glushankova. - Some structural and mapping features of water-glacial deposits of the Don horizon / B. V. Glushkov, G. V. Kholmovoy. - Using dem for tasks of Quaternary geology and geomorphology of Siberia / N. V. Glushkova, V. A. Lyamina, I. D. Zolnikov, N. N. Dobretsov, V. P. Afanas'ev, D. A. Samdanov, I. I. Boldirev, S. A. Semenova. - Reference horizons of volcanic ash in Quaternary deposits of the Northern Coast of Okhotsk Sea / O. Yu. Glushkova, V. N. Smirnov. - Problems of the Eopleistocene volumes in the South-Eastern West Siberian Plate in the context of the Quaternary bottom lowering / A. G. Golovina, V. S. Volkova. - An influence of coastal processes on sedimentogenesis in the Tsymlyanskoye reservoir / N. V. Golubova. - Environments during the time of initial human settlement of the Kola Peninsula / I. M. Grekov, E. A. Kosheleva. - Mesostratigraphy of middle- and late valdai loess-like loams as the marker of low-range ecosystematic rearrangements / L. A. Gugalinskaya, V. M. Alifanov. - Relief and quaternary sediments from outer part of East Siberian Sea: new data / E. A. Gusev, A. G. Zinchenko, N. Yu. Anikina, L. G. Derevyanko, V. V. Popov. - The Middle Holocene parastratotype old Kieshki Site and its palaeobotanic characteristic (Southern Foreurals) / G. A. Danukalova, E. G. Lapteva, O. M. Korona. - Results of the Mollusc study of the late Pliocene early Quaternary Novosultanbekovo Site (Southern Foreurals) / G. A. Danukalova, E. M. Osipova. - Natural and anthropogenic factors of formation of chemical composition of sediments of lakes of North Fennoscandia / V. A. Dauvalter, N. A. Kashulin, S. S. Sandimirov. - Difficulties of long-term air temperature time series finding for climatological problems / V. I. Demin. - Diatom complexes changes in academicheskoe lake sediments (Khibiny Massif, Kola Peninsula) / D. B. Denisov. - Natural features of sedimentogenesis in the lake of the Eastern slope o , In kyrill. Schr. , In engl. und rus. Sprache
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 199
    Monograph available for loan
    Monograph available for loan
    Berkeley, CA : Apress
    Call number: PIK M 034-17-90826
    Description / Table of Contents: Pro Git (Second Edition) is your fully-updated guide to Git and its usage in the modern world. Git has come a long way since it was first developed by Linus Torvalds for Linux kernel development. It has taken the open source world by storm since its inception in 2005, and this book teaches you how to use it like a pro. Effective and well-implemented version control is a necessity for successful web projects, whether large or small. With this book you’ll learn how to master the world of distributed version workflow, use the distributed features of Git to the full, and extend Git to meet your every need. Written by Git pros Scott Chacon and Ben Straub, Pro Git (Second Edition) builds on the hugely successful first edition, and is now fully updated for Git version 2.0, as well as including an indispensable chapter on GitHub. It’s the best book for all your Git needs
    Type of Medium: Monograph available for loan
    Pages: XXV, 426 Seiten , Illustrationen, Diagramme
    Edition: Second Edition
    ISBN: 9781484200766 , 9781484200773 (print)
    Language: English
    Note: Contents: Getting Started ; Git Basics ; Git Branching ; Git on the Server ; Distributed Git ; Github ; Git Tools ; Customizing Git ; Git and Other Systems ; Git Internals ; Git in Other Environments ; Embedded Git in Your Applications ; Git Commands
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 200
    Call number: M 16.89961
    Type of Medium: Monograph available for loan
    Pages: xix, 694, [7] p. : , ill., maps ; , 27 cm.
    Edition: Shohan.
    ISBN: 9784130607599 , 4130607596
    Classification:
    Seismology
    Language: Japanese
    Note: In Japanese.
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...