ALBERT

Note: Ersch. unregelmäßig , Beiträge teilweise in Englisch

Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.

Note: A stratigraphic concept for Middle Pleistocene Quaternary sequences in Upper Austria --- Magnetic excursions recorded in the Middle to Upper Pleistocene loess/palaeosol sequence Wels-Aschet (Austria) --- Paleopedological record along the loess-paleosol sequence in Oberlaab, Austria --- Grain size and mineralogical indicators of weathering in the Oberlaab loess-paleosol sequence, Upper Austria --- Last Interglacial paleosols with Argic horizons in Upper Austria and Central Russia --- Paudorf locus typicus (Lower Austria) revisited

Note: Beitr. teilw. in engl., teilw. in dt. Sprache

Note: Meditation: why bother? -- What meditation isn't -- What meditationis -- Attitude -- The practice -- What to do with your body -- What to do with your mind -- Structuring your meditation -- Set-up exercises -- Dealing with problems -- Dealing with distractions 1 -- Dealing with distractions II -- Mindfulness (Sati) -- Mindfulness versus concentration -- Meditation in everyday life -- What's in it for you.

Note: Table of Contents - Čast' 1.: Research by the pulsing method of a NRM of the metastable water formed at dissociation freonhydrate-12 in the field of negative temperatures / V. A. Vlasov, A. G. Zavodovsky, M. S. Madygulov, A. N. Nesterov, A. M. Reshetnikov. - Kinetics crystallization subcooling of the water contacting to surface gas hydrate / V. A. Vlasov, A. G. Zavodovsky, M. S. Madygulov, A. N. Nesterov, A. M. Reshetnikov. - Transformation of cryogenic structure of frozen clay soils at plain stamp test / S. S. Volokhov. - About influence of contact zone structure of frozen soils with materials on adfreezing strength / S. S. Volokhov, N. V. Solovyeva. - Possibilities of calculating the effective diffusion coefficient of water vapour in snow due to field observations data / R. I. Gavriliev. - Features of water's crystallization in dispersed rocks / V. N. Golubev, G. A. Rzhanitsyn. - Mass exchange in the system of atmosphere-snow cover-ground / V. N. Golubev, D. M. Frolov. - Physical and mechanical aspects of phase transition processes in frozen and freezing ground / J. B. Gorelik. - The experimental stadies of cryogenic preassure into water-saturated saline soils / S. E. Grechishchev, A. V. Brousehkov, Ark. V. Pavlov, O. V. Grechisheheva. - Phase composition of frozen saline ground with petroleum pollution / E. S. Grechishcheva, R. G. Motenko. - About plastic deformation of frozen rocks / M. M. Iudin. - Studies of Soil Moisture Transfer and ice extraction in clay loam Patterns Under External Pressure / O. A. Kazansky. - Isotopic content of interfacial water and ice frozen ground / V. N. Konischev, V. V. Rogov, V. N. Golubev, S. A. Sokratov. - On longevity and structured physical system organizations (on example of frozen soils and ice) / A. A. Konovalov. - On toughness and deforming the frozen ground / A. A. Konovalov. - The study of deformation characteristics of thawing soils / P. I. Kotov. - Thermal properties of volcanic ashes (Kamchatka) / E. P. Kuznetsova, R. G. Motenko. - About temperature extension coeffision of frozen soils / V. P. Merzlyakov. - Classification indicators of frost-susceptible soils / A. L. Nevzorov. - Separation of the pore solution compounds during mass transfer in disperse ice / V. Ye. Ostroumov, N. V. Ostroumova. - Achievements and problems of frozen soils mechanics / L. T. Roman. - Classification of frozen soils / L. T. Roman, V. I. Aksenov, A. V. Iospa. - Modification of frozen soils and ice by adding polyvinyl alcohol in order to facilitate construction / E. V. Safronov, V. V. Vialdin, V. G. Cheverev, V. E. Gagarin, D. V. Hvostikov. - Method of mass crystallization calculation for multiphased rheological mediums / N. I. Sidnyaev, D. A. Krylov. - The deflected mode of the freezing soils layer taking into account the creep and compliance of the boundary conditions / Z. G. Ter-Martirosyan, P. A. Gorbachev. - Study of deformation characteristics of thawing soils of Vankor oilfield / M. N. Tsarapov. - Influence of outer loading on frost heaving of freezing soils, according to theoretical and experimental researches / V. G. Cheverev, M. A. Minkin, E. V. Safronov, V. E. Gagarin, R. S. Bumaev. , Table of Contents - Čast' 2.: Investigation of glaciers and fumarolic activity of Mt Elbrus / V. A. Alekseev, N. G. Alekseeva, M. G. Daniyalov, P. A. Morozov, C. M. Pershin, P. V. Hlebopashev. - The study of impact craters near the Tunguska meteorite epicenter / V. A. Alekseev, V. V. Kopeykin, N. G. Alekseeva, V. V. Krivulin, L. G. Pelehan', V. A. Rukavishnikov, V. A. Chechin. - Engineering geophysical investigations to substantiate the investments for Nizhne-Timptonsk HPP construction / O. K. Voronkov, N. N. Sigatcheva, O. A. Semenov, Yu. Yu. Punin. - Essentials of technique for seismic hazard zoning of extended linear structures in cryolithic zone / V. I. Dzhurik, S. P. Serebrennikov, L. A. Usynin, E. V. Bryzhak. - Temperature dependence of seasonal changes of electrical resistance of frozen ground / V. N. Efremov. - Role and place geophysical methods at studying criolitozone / Y. D. Zykov, A. V. Koshurnikov, N. V. Paramonov, A. A. Pogorelov, R. D. Ostrovsky, A. Y. Gunar. - EM sounding technology's capability in long-term engineering-geological studies in transition zones (case study: transition of a pipeline Bovanenkovo-Ukhta through Baidaratskaya Bay) / Y. D. Zykov, Y. V. Kuleshov, S. V. Kulakov, A. V. Koshurnikov, E. I. Gorshkov, A. A. Pogorelov, E. M. Sizykh. - Experience using of aerospace infrared thermal data for characteristics of the permafrost / S. G. Kornienko. - Wave characteristics of permafrost in Western Yakutia / L. G. Neradovsky. - Geological-geophysical analysis of seismic events in the cryolithic zone of Mongolia / S. P. Serebrennikov, Ts. Batsaikhan, V. I. Dzhurik, A. Yu. Eskin, A. F. Drennov. - Seismic geocryological study of shallow waters in permafrost / A. G. Skvortsov, M. R. Sadurtdinov, A. M. Tsarev. - Features of seismic methods in engineering geocryological studies / A. G. Skvortsov, A. M. Tsarev, M. R. Sadurtdinov. - Descriptiveness of geophysical methods in the assessment of oil pollution / A. D. Skobelev, Y. D. Zykov, A. V. Koshurnikov, A. A. Pogorelov, P. D. Ostrovsky, A. Y. Gunnar. - Radiolocation of the upper frozen ground in Anadyr city: structure, interpretation, forecast / O. D. Tregubov. - Estimating of rock state and properties in long-tem physical weathering by an ultrasonic method / L. F. Ushakova, O. K. Voronkov. - The efficiency of geophysical methods in studies of cryolithic zone in the process of placer accumulation by dredge acquisition / I. M. Khasanov, N. L. Alevskaya, A. V. Koshumikov. - Impact assessment of cryolithic zone in geophysical explorations of gold minefields on a prospecting step, that arc disposed in background medium, consisted of finest sedimentary rock / I. M. Khasanov, V. M. Sharaphytdinov, A. V. Koshurnikov. - Engineering-geocryological research in offshore area of Kruzenshternsky field in Kara sea / V. A. Kholodilov, M. L. Tsemkalo, M. F. Savitskiy, N. V. Paramonov, A. V. Koshumikov, A. A. Pogorelov. - Using electrical resistivity tomography to investigate near-shore permafrost dynamics / P. Overduin, M. Grigoriev, T. Haberlau, S. Wetterich, S. Westermann, K. Yoshikawa. , Table of Contents - Čast' 3.: Cryogenic and seismogenic deormations in the Late Cenozoic deposits of Tunkinskaya depression in Baikal rift zone / S. V. Alexeev, L. P. Alexeeva, A. C. Gladkov, O. V. Lunina, A. M. Kononov, A. V. Andreev. - Coastal Permafrost evolution of Western Yamal in context of climate change / A. A. Vasiliev, I. D. Streletskaya, R. S. Shirokov, G. E. Oblogov. - Classification of massive ice /Yu. K. Vasil'chuk. - δ18O variation of Late Holocene ice-wedge of Aventdalen, Svalbard / Yu. K. Vasil'chuk, N. A. Budantseva, A. M. Zemskova. - Pollen spectra of massive ice of Yerkutayakha River valley, Southern Yamal Peninsula / A. C. Vasil'chuk, Yu. K. Vasi l'chuk, N. A. Budantscva. - Complex assessment of crioecolological and bioresource state of northern geosystems / L. I. Zotova, S. J. Dedjusova. - Study of Quaternary sediments and ground ice with detailed grane-size composition analysis at Yenisey North / M. S. Pavlov, I. D. Streletskaya, A. G. Matyukhin, G. E. Oblogov, A. V. Surkov. - On rock weathering in Cryolithozone / D. M. Shesternev. - Fossil organic matter in permafrost deposits of northern East Siberia - contents and characteristics / L. Schirrmeister, S. Wetterich, G. Grosse, J. Strauss, C. Siegert, P. P. Overduin, H.-W. Hubberten. , Table of Contents - Čast' 4.: The influence of reservoir parameters on hydrate formation in gas wells in permafrost / E. A. Bondarev, K. K. Argunova, I. I. Rozhin. - Research features of deposits wells with abnormal low field temperature / Z. A. Vasil'eva, D. S. Djafarov. - Technogenic indicators of natural gas hydrates presence in deposits of the western part of the Siberian Platform and Yenisei-Khatanga Depression / Z. A. Vasil'eva, D. S. Dzhafarov. - The commercially viable unconventional gas sources (gas hydrates, coalbed methane and shale gas) - experience of development and prospects in Russia / E. V. Perlova. - Gas hydrate of Yamal region (Yamal Peninsular, Kara Sea's shelf) - occurance, types, resources, technogenic challenges / E. V. Perlova, S. A. Leonov, E. S. Miklyaeva, S. D. Perlov. - Variation of thermal conductivity in gas-saturated sediments during hydrate accumulation and freezing / E. M. Chuvilin, B. A. Buhanov. - Sources of natural gas in cryolithozone of Yamal Pemnsula / V. S. Yakushev. , In kyrill. Schr.

Note: PART I: SETTING THE SCENE -- Public Deliberation in the Context of Interest Advocacy -- Worlds Apart or Connected? Interest Advocacy and Public Deliberation -- The Features and Principles of Citizens' Forums -- PART II: EMPIRICAL INSIGHTS -- CDL Case: Deliberation Waste -- GeneTech Case: Deliberation Digested -- Consumer Case: Deliberation Over-Protected -- Diagnostics Case: Deliberation Tested -- PART III: IMPLICATIONS -- The Challenges of Citizens' Forums -- Strategic Uses of Public Deliberation -- Accommodating Interest Advocacy in Public Deliberation -- References -- Index

Note: Contents: 1. A looming crisis Part I Status and challenges 2. Rising demand and dwindling per capita resources 3. Water and poverty 4. Governance and finance 5. Pollution and water-related disease 6. Water, land and wildlife 7. Dams and diversions 8. Trading water - real and virtual 9. Water, war and terrorism 10. The threat of global warming Part II Nature's resources 11. The restless water cycle 12. Shrinking freshwater stores Part III Towards sustainability 13. Cutting demand 14. Increasing supplies 15. Cleaning up and protecting the aquatic environment 16. Using seawater 17. Controlling the weather 18. Improved monitoring and data management 19. Improving prediction and risk assessment 20. Improving management and justice 21. Aid for the developing world Conclusions 22. Is sustainability achievable?

Note: Table of Contents - Čast' 7.: Oil and gas basins distribution in cryolithozone / L. S. Garagulya, G. I. Gordeeva, V. N. Zaitsev. - Exogenous geological processes on the main gas pipeline "Zapolamoe-New-Urengoy" / A. A. Gubarkov. - Feftures of engineering geological conditions of building of an elevated site of the oil pipeline "the Vankorsky deposit - "Purpe" / A. A. Goubarkov, S. N. Okunev, M. S. Maramigina, K. V. Zalesskiy. - Influence of anthropogenous activity on development of cryogenic processes and dynamics of the seasonal thawed layer on the gas pipeline "Nadym-Punga" / E. V. Elanzev, M. V. Andreeva, A. A. Gubarkov. - Experience using of the aerospace infrared thermal data for characteristics of the permafrost / S. G. Komienko. - Large-scale engineering-geocriological mapping of natural-technical systems of Jamburg OGCF / I. L. Kuznecova, E. A. Eremeeva, A. A. Erasov, M. V. Kasymskaya, T. V. Nikitina, A. I. Konichshev, M. A. Moiseeva. - Definition of enginering-geocryological parameters in complex ground conditions by statical probing (on example New Urengojsky gaz-chemical complex) / A. S. Kurbatov. - Taxonomic system of geotechnical monitoring gasfield and gas-transport objects / V. V. Lashin, A. V. Kryukov. - The technogeoekological analysis of gas-transport systems at the gas deposit Medvezhje / V. P. Marahtanov, M. A. Velikotskij, V. P. Chigir, S. A. Egurtsov, S. N. Menshikov, V. N. Polozov. - Field study of influence of oil pollution on the seasonal ground freezing oil deposit Samotlor / E. S. Miklyaeva, V. A. Soldatov. - Restriction to nature management in the southern cryolithozone of the Bolsheztmclskaya tundra / G. G. Osadchaya. - About long-term permafrost temperatures dynamics under the influence of climate changing at the north of West Siberia / A. B. Osokin. - The building technology for oil and gas fields of Yamal Peninsula / A. B. Osokin, E. Yu. Galaktionov, G. K. Smolov, A. P. Popov. - The influence of non-isothermal effects on gas production and determination of the area of possible hydrate formation in the bottom-hole zone of the gas-bearing reservoirs / I. I. Rozhin, E. A. Bondarev, K. K. Argunova. - Short-term forecasting of terrain evolution for Bovanenkovo gas condensate field territory (Yamal Peninsula) / V. I. Solomatin, M. A. Konjahin. - Destruction and recovery of permafrost along the gas pipeline Zapadno-Ozernoe gas field - Anadyr city in 2000 - 2008 / O. D. Tregubov, V. Yu. Razzhivin. , Table of Contents - Čast' 8.: The control of temperature conditions of permafrost ground and building foundations during the development of hydrocarbons in new regions / I. B. Baholdin, N. I. Sydnyaev, Y. S. Melnikova. - Thermal stabilization of permafrost soils at bases of structures with floors on the ground / R. M. Bayasan, A. R. Bayasan, G. P. Pustovoit, A. N. Tseeva. - Forecast of changing of bearing capacity and frost heaving of trapped foundation in west sektor of cryolithozone of Russia to 2050 / V. I. Grebenets, D. G. Shmelev. - Methodology of complex load tests of pile foundations in permafrost / I. E. Guryanov. - An analysis of land suitability for urban construction in permafrost regions / I. E. Guryanov. - Analysis of the effect of heat torch open on permafrost conditions of the site UPSV-South / G. M. Dolgih, S. N. Okunev, G. V. Anikin, V. N. Zaharova, M. S. Maramygina. - Natural researches deep heat pipe in experimental-industrial range / G. M. Dolgikh, S. N. Okunev, D. S. Pazderin, V. N. Feklistov. - Geocryological problems associated with railroads and highways on permafrost / V. G. Kondratiev. - Study stabilizations railway embankment on permafrost soil under thawing / S. A. Kudryavtsev, A. G. Polevichenko, A. V. Kazharskiy, Yu. B. Berestyanyy. - About anthropogenic influence on the stability of the buildigs and installations of the town construction in the north polar region / E. S. Maksimenko. - Permafrost conditions along proposed railway route in the northern Baffin Island and associated design considerations / V. E. Roujanski, K. W. Jones. - Experience of creation of the centralized system of gathering, processing and data storage of geotechnical monitoring / A. V. Ryazanov, V. D. Kaurkin, D. V. Manchukov, K. V. Zalessky. - The reliability of north infrastructure under changing climate conditions / L. N. Hrustalev, S. Yu. Parmuzin, L. V. Emelyanova. - Prognosis temperature conditions of soil beneath the foundations of football arena / A. N. Ceeva, Yu. A. Khokholov, M. V. Kaymonov, A. S. Kurilko. , Table of Contents - Čast' 9.: About the liability of geocryological factor account in the estimating of land condition within the confines of problem solution of Russian ecological safety / R. B. Bigeeva. - Reconversion of ecosystems under the influence of geocryological processes / L. S. Garagulja, G. I. Gordeeva, E. N. Ospennikov, V. Z. Hilimonjuk. - Hydrological and geo-ecological research in the Pechora river's delta / E. A. Dombrovskaya, N. G. Ukraintseva. - Estimation of possible influence of building of hydroelectric power station on the river Timpton (Southern Yakutia) on geological conditions and processes / A. A. Ermolov. - Cryoecological monitoring investigations of agricultural landscapes in central Yakutia / P. V. Efremov, I. S. Ugarov, A. N. Fedorov. - Theoretical and applied aspects of expert geoecological risk economic development within the new educational program / L. I. Zotova. - Permafrost - ecological mapping of cryolithozone of Russia / N. A. Koroleva, N. V. Tumel. - Impact of fire on vegetation and permafrost of northern taiga palsa pcatland in West Siberia / N. G. Moskalenko. - Long-term monitoring of cryogenic processes in the Russian North-West during global warming / N. G. Oberman. - The impact of man-made barrages on the surface and subpermafrost drainage in Yakutsk / N. A. Pavlova, S. I. Serikov. - Estimation of change of the condition of cryogenic landscapes of the northeast of Bolshezemelskaya tundra as a result of technogenic influence / E. S. Popova, J. V. Vlasova, N. V. Tumel. - Assessment of the dynamics of environmental permafrost conditions geocriological under varying conditions of heat-exchange on the earth surface / V. Z. Khilimonyuk, M. V. Filatova. , Table of Contents - Čast' 10.: The innovation technique and technology using for thermal stabilization of saline soils at Bovanenkovo oil and gas field on Yamal Peninsula / R. M. Bayasan, T. V. Bayasan, S. I. Golubin, A. V. Lyalin, G. P. Pustovoit. - Experience of planning, editing and exploitation of systems temperature stabilizing of ground base objects Vankor field / G. M. Dolgikh, S. N. Okunev, S. A. Stoyanov, K. V. Zalesskiy. - Method for carring permafrost area capacity assessment of ground and conditions of the building of development / A. V. lospa, A. A. Popova. - Statistic on accidents and safety of natural - technical systems on permafrost / Ja. A. Kronik. - Safety and standartization problems for designing and construction on permafrost / Ja. A. Kronik, M. A. Minkin. - Multipurpose mapping as informational support engineering survey, design and monitoring / F. Rivkin, I. Kuznetsova, N. lvanova, A. Popova, I. Parmuzin. - Engineering and geocryological monitoring of Obskaya-Bovanenkovo railway (Yamal Peninsula) / V. P. Chemyadyev, I. I. Shamanova, A. V. Maksimov, S. N. Titkov. , Table of Contents - Čast' 11.: Comparative analysis of radiative-heat parameters in Antarctic and Mars polar regions / O. N. Abramenko, I. A. Komarov, V. S. lsaev. - Cryophilic communities of lakes located in the Baikal rift zone / N. A. Bondarenko, O. I. Belykh, I. V. Tomberg, S. I. Genkal, I. V. Tikhonova, N. F. Logacheva, V. N. Alexandrov, O. A. Timoshkin. - Biogeochemistry of frozen soils of the Central Yakutia / A. V. Brouchkov, V. P. Melnikov, G. I. Griva, V. E. Repin, E. V. Brenner, M. Tanaka, M. V. Shchelchkova. - Exogenic cryogenic processes on Mars / V. S. lsaev, I. A. Komarov, O. N. Abramenko. - Underground ice as environment of microorganism / A. N. Kurchatova, V. V. Rogov. - Plant species indicating the depth of active layer on the Bely Island / O. V. Khitun, K. A. Ennokhina, M. O. Leibman, A. V. Khomutov. , Table of Contents - Čast' 12.: Actual problems of geocryology (permafrost science) / A. V. Brouchkov. - International Permafrost Field Courses TEPO-Yamburg (2007 - 2009) in the network International Polar Year / V. Grebenets, A. Boitsov, A. Kurchatova, D. Kaverin, E. M. Pfeiffer, N. Rueggen, A. Zschocke, N. Shiklomanov, D. Streletskiy, A. Klene. - Teaching academic discipline "geocryology" for students of building specialities / A. L. Nevzorov, V. V. Koptyaev. - Permafrost and periglacial geomorphology of Western Taymyr. The field courses on permafrost for graduate and phd student / I. D. Streletskaya, A. A. Vasiliev, G. A. Cherkashev, V. N. Konishchev. , In kyrill. Schr.

Note: Vulnerable Systems; Preface; Acknowledgements; Contents; Abbreviations; 1 Introduction and Definition of Key Terms; 2 Properties of Critical Infrastructures; 3 Challenges to Methods for the Vulnerability Analysis of Critical Infrastructures; 4 Basic Approaches; 5 Conceptual Frameworks for Vulnerability Assessment; 6 Methods of Analysis; 7 Concluding Considerations;.

Note: Contents: Part 1: Introduction ; Building the Global Adaptation Community ; Part 2: Describing Impacts at the Local Level ; Introduction: Describing Impacts at the Local Level ; Understanding Potential Climate Change Impacts and Adaptation Options in Indian Megacities ; Assessment of Climate Change-Induced Vulnerability to Floods in Hyderabad, India, Using Remote Sensing Data ; The Role of Community Resilience in Adaptation to Climate Change: The Urban Poor in Jakarta, Indonesia ; Ecohealth and Climate Change: Adaptation to Flooding Events in Riverside Secondary Cities, West Africa ; Climate Change and Adaptive Capacity of Women to Water Stress in Urban Centers of Nigeria: Emerging Concerns and Reactions ; Urban Climate Strategies Against Future Heat Stress Conditions ; Climate-Proof Urban Transport Planning: Opportunities and Challenges in Developing Cities ; Part 3: Frameworks for Local Action – Challenges and Proactive Recommendations ; Introduction: Frameworks for Local Action – Challenges and Proactive Recommendations ; Inclusive Adaptation: Linking Participatory Learning and Knowledge Management to Urban Resilience ; Urban Adaptation Planning and Governance: Challenges to Emerging Wisdom ; Urban Climate Change Adaptation in the Context of Transformation: Lessons from Vietnam ; Getting Ready for a Changing Climate: Supporting Councillor’s Leadership Role in Adaptation ; Environmental Learning from the Ivory Tower to the Town Square: The Case of Trondheim, Norway ; Plan B:altic: A Social–Ecological Approach to Climate Change Adaptation ; Governance Recommendations for Adaptation in European Urban Regions: Results from Five Case Studies and a European Expert Survey ; Creating Resilient Cities Through Empowered, Deliberative Participation ; Part 4: Local Strategies and Actions in Response to Climate Change ; Introduction: Local Strategies and Actions in Response to Climate Change ; Comparative Research on the Adaptation Strategies of Ten Urban Climate Plans ; Managing Regional Climate Mitigation and Adaptation Co-benefits and Co-costs ; Interdisciplinary and Multi-institutional Approaches to Climate Change Adaptation ; Climate Adaptation Strategies: Evidence from Latin American City-Regions ; Adaptation in UK Cities: Heading in the Right Direction? ; Finding the Balance: Challenges and Opportunities for Climate Change Adaptation at Different Levels of English Local Government ; Local Strategies for Climate Change Adaptation: Urban Planning Criteria for Municipalities of the Basque Country, Spain ; Climate Change Adaptation in Dutch Municipalities: Risk Perception and Institutional Capacity ; Toward a More Flood Resilient Urban Environment: The Dutch Multi-level Safety Approach to Flood Risk Management ; Climate Change and City Development: Resilience Strategies in Bonn ; Integrated Climate Adaptation in Dresden: Insights from Flood Prevention ; Integrated Climate Protection Program for the City of Chemnitz: Climate Diagnosis, Climate Change Prognosis, and Adaptation Measures in the Urban Area ; Adaptation Strategies for the City of Cape Town: Finding the Balance Within Social-Ecological Complexity ; Sharing the Lagos Megacity Experience in the Integrated Management of Sea Level Rise and Flooding ; Community-Based Vulnerability Assessment: Semarang, Indonesia ; Research News for Climate Compliant Cities: The Case of Ho Chi Minh City, Vietnam ; Building Resilience to Climate Change Through Adaptive Land Use Planning in Ho Chi Minh City, Vietnam ; Climate Change Risk Management for a Suburban Local Government: The Case of Kogarah, Australia ; Climate Change as a Survival Strategy: Soft Infrastructure for Urban Resilience and Adaptive Capacity in Australia’s Coastal Zones ; Curitiba, Brazil: A Model for Resilience in Latin America? ; Part 5: Approaches to Climate Change Adaptation in Cities ; Introduction: Approaches to Climate Change Adaptation in Cities ; Building Resilience to Climate Change in Asian Cities ; Local Vulnerability Assessment of Climate Change and Its Implications: The Case of Gyeonggi-Do, Korea ; Ecosystem-Based Adaptation in the Urban Environment ; Urban Agriculture and Climate Change Adaptation: Ensuring Food Security Through Adaptation ; Cooling the Public Realm: Climate-Resilient Urban Design ; The Role of Transport in Mitigation and Adaptation to Climate Change Impacts in Urban Areas ; Urban Green Spaces: Potentials and Constraints for Urban Adaptation to Climate Change ; Urban Climate Framework: A System Approach Towards Climate Proof Cities ; Part 6: Reality Check – Adaptation on the Ground ; Introduction: Reality Check – Adaptation on the Ground ; Preparing for Climate Change While Advancing Local ; Quito’s Climate Change Strategy: A Response to Climate Change in the Metropolitan District of Quito, Ecuador ; Climate Change Implications for Dhaka City: A Need for Immediate Measures to Reduce Vulnerability ; Adaptation in Practise: Durban, South Africa

Note: Aus dem Franz. übers.

Note: Includes bibliographical references and index

Note: Contents: Einleitung ; I Theorie ; 1 Typologie politischer Systeme ; 2 Die Stabilität politischer Systeme ; 3 Transformationsbegriffe ; 4 Transformationstheorien ; 5 Massen und Eliten in der Transformation ; 6 Transformationsphasen ; II Die Demokratisierungswellen des 20. Jahrhunderts ; 1 Die erste Demokratisierungswelle: Die Entstehung von Demokratien ; 2 Die erste autokratische Gegenwelle: Der Zusammenbruch von Demokratien ; 3 Die zweite Demokratisierungswelle: Die Nachkriegsdemokratien in Deutschland, Italien und Japan ; III Die Dritte Demokratisierungswelle: Südeuropa ; 1 Die Demokratisierung in Südeuropa ; IV Die dritte Demokratisierungswelle: Lateinamerika ; 1 Typen autoritärer Regime ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung ; 5 Fazit und Ausblick ; V Die dritte Demokratisierungswelle: Ost- und Südostasien ; 1 Typen autoritärer Regime ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung ; 5 Fazit: Die Konsolidierung im Vergleich ; 6 Gibt es eine "asiatische Form" der Demokratie? ; VI Die dritte Demokratisierungswelle: Osteuropa ; 1 Die besondere Transformationsproblematik in Osteuropa ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung: Ungarn, Polen, Russland und Belarus im Vergleich ; VII Externe Demokratisierung ; 1 Demokratieförderung ; 2 Demokratisierung "durch" Krieg? ; Ausblick: Kehren die Diktaturen zurück? ; 1 Theoretische Paradigmen und empirische Artefakte ; Gegenwartsdiagnose ; Zukunftsprognose

Note: Preface 1. Fire and brimstone: how volcanoes work 2. Eruption styles, hazards and ecosystem impacts 3. Volcanoes and global climate change 4. Forensic volcanology 5. Relics, myths and chronicles 6. Killer plumes 7. Human origins 8. The ash-giant/sulphur-dwarf 9. European volcanism in prehistory 10. The rise of Teotihuacan 11. Dark Ages: dark nature? 12. The Haze famine 13. The last great subsistence crisis in the western world 14. Volcanic catastrophe risk Appendix A. Volcano trumps: notable eruptions of the past 10,000 years Appendix B. Further reading Index.

Note: CONTENTS; List of Figures; List of Tables; List of Contributors; Introduction; PART I: ECONOMISTS ON TRIAL; 1. Who predicted the crisis and what can we learn from them? ; 2 A brief note on economic recessions, banking reform and the future of capitalism; 3 Understanding crisis: on the meaning of uncertainty and probability; 4 Financial crisis and risk measurement: the historical perspective and a new methodology; 5 Did economic analysis fail in the current financial crisis?; PART II: WHAT DOES HISTORY TELL US? ; 6 Does the current global crisis remind us of the Great Depression?. , 7 Innovation, growth, cycles and finance: three (or four or more) stories from the 1930s and their lessons8 Epic Recession and economic theory; 9 Did asset prices cause the current crisis?; 10 The role of the history of economic thought in the development of economic theory and policy; PART III: COUNTRY CASES IN A GLOBAL CRISIS; 11. Testimony to the Financial Crisis Inquiry Commission by Alan Greenspan; 12 Long-term depression and new markets: economists and the 2008 recession; 13 Manifestations of the global crisis in a small open economy. , 14 The aftermath of a long decade of real nil interest rates (Spain 1996-2008)Index.

Note: Univ., Diss., Hohenheim, 2009

Note: The basics -- Matching, covering and packing -- Connectivity -- Planar graphs -- Colouring -- Flows -- Extremal graph theory -- Infinite graphs -- Ramsey theory for graphs -- Hamilton cycles -- Random graphs -- Minors, trees, and WQO..

Note: Text dt. und engl. - Text in Faltbl. [1] dt.

Note: Table of Contents: EXECUTIVE SUMMARY. - KEY FINDINGS. - 1 INTRODUCTION. - 1.1 Background. - 1.2 The Circumpolar Arctic Coast. - 1.3 Rationale. - 1.4 Objectives and Organization of the Report. - 2 STATE OF THE ARCTIC COAST 2010 – A Thematic Assessment2.1. Physical State of the Circum-Arctic Coast. - 2.2. Ecological State of the Circum-Arctic Coast. - 2.3 Social, Economic and Institutional State of the Circum-Arctic Coast. - 3 INTEGRATED ASSESSMENT AND RESPONSE TO ARCTIC COASTAL CHANGE. - 3.1 Integrated Approaches to Coastal Change in the Arctic. - 3.2 Monitoring, Detecting and Modelling Coastal Change. - 3.3 Vulnerability, Adaptation, Adaptive Capacity and Resilience. - 3.4 Governance and Adaptation. - 4 SYNTHESIS AND FUTURE DIRECTION. - 4.1 Introduction. - 4.2 ICARP-II Science Plans. - 4.3 Knowledge Gaps and Research Priorities . - 4.4 Building a Road Map to Integrated Coastal Systems Research in the Arctic. - 4.5 Summary Discussion. - 5 REFERENCES. - List of Contributors. - Acknowledgements.

Note: Machine generated contents note: Introduction Jan Aart Scholte; 1. Global governance, accountability and civil society Jan Aart Scholte; 2. Civil society and accountability of the United Nations Kerstin Martens; 3. The World Bank and democratic accountability: the role of civil society Alnoor Ebrahim and Steven Herz; 4. Civil society and IMF accountability Jan Aart Scholte; 5. Civil society and the WTO: contesting accountability Marc Williams; 6. Civil society and accountability in the Commonwealth Timothy M. Shaw and Pamela K. Mbabazi; 7. The organisation of the Islamic conference, accountability and civil society Saied Reza Ameli; 8. Civil society and patterns of accountability in the OECD Morten Ougaard; 9. Civil society and G8 accountability Peter I. Hajnal; 10. Structuring accountability: the Asia-Europe meeting Julie Gilson; 11. Civil society and accountability in global governance of climate change Peter Newell; 12. Civil society and accountability promotion in the global fund Carolyn Long and Nata Duvvury; 13. Accountability in private global governance: ICANN and civil society Mawaki Chango; 14. Civil society and the World Fair Trade Organisation: developing responsive accountability Heidi Ullrich; Conclusion Jan Aart Scholte..

Note: In kyrill. Schr.

Note: Science after the end of science? An introduction to the "epochal break thesis" / Alfred Nordmann, Hans Radder, Gregor Schiemann -- The age of technoscience / Alfred Nordmann -- We are not witnesses to a new scientific revolution / Gregor Schiemann -- "Knowledge is power," or how to capture the relationship between science and technoscience / Martin Carrier -- Climbing the hill: seeing (and not seeing) epochal breaks from multiple vantage points / Cyrus C. M. Mody -- Breaking up with the epochal break: the case of engineering sciences / Mieke Boon, Tarja Knuuttila -- Science and its recent history: from an epochal break to novel, nonlocal patterns / Hans Radder -- Knowledge-making in transition: on the changing contexts of science and technology / Andrew Jamison -- Alliances between styles: a new model for the interaction between science and technology / Chunglin Kwa -- Experimenting with the concept of experiment: probing the epochal break / Astrid Schwarz, Wolfgang Krohn -- Intensification, not transformation: digital media's effects on scientific practice / Valerie Hanson -- Technologies of viewing: aspects of imaging in natural sciences / Angela Krewani -- Technoscience as popular culture: on pleasure, consumer technologies, and the economy of attention / Jutta Weber -- The good old days: medical research then and now / James Robert Brown -- Toward a new culture of prediction: computational modeling in the era of desktop computing / Ann Johnson, Johannes Lenhard -- Epilogue: the sticking points of the epochal break thesis / Hans Radder..

Note: TABLE OF CONTENTS: Predislovie. - Problems of absolute chronology and correlation of the Pleistocene glaciations in Gorny Altai / A. R. Agatova, R. K. Nepop. - Ecological and geomorphological consequences of mineral deposits development in conditions of the arid zone of Kazakhstan / K. M. Akpambetova. - Forming conditions of bottom sediments of Prokopievskoe Lake (Northern Karelia) according to the diatoms data / A. N. Alekseeva, O. P. Korsakova. - Lithostratigraphy of the quaternary deep sea sediments / T. N. Alekseeva, V. N. Sval'nov. - Climatic records from sediments of Elgygytgyn Lake (Polar Chukotka) / P. M. Anderson, A. V. Lozhkin. - First records of environmental change from lake sediments of the Kuril Archipelago / P. M. Anderson, A. V. Lozhkin, P. S. Minuyk, A. Yu. Pakhomov, T. B. Solomatkina, M. V. Cherepanova. - Late Pliocene / early Pliocene environments of the North-Eastern Siberian Arctic inferred from Lake El'gygytgyn pollen record / A. A. Andreev, M. Melles, V. Wennrich, J. Brigham-Grette. - The middle Neopleistocene of the Timan-Pechora-Vychegda Region / L. N. Andreicheva. - Kargian megainterstadial of the Prebaikalia: geochronology and paleogeography / Kh. A. Arslanov, N. E. Berdnikova, S. B. Chernov, G. A. Vorobioba, I. V. Enuschenko, D. V. Kobylkin, R. E. Maksimov, Yu. V. Ryzhov, A. A. Starikova. - The human and environment of Southeast Baltic on the boundary of the Pleistocene and the Holocene / Kh. A. Arslanov, O. A. Druzhinina, M. A. Kulkova, T. V. Sapelko, D. A. Subetto, I. N. Skhodnov. - Age of soil-pyroclastic sequences and chronology of volcanic activity on Matua Island (Central Kurils) during the Holocene / Kh. A. Arslanov, I. V. Melekestsev, N. G. Razjigaeva, A. V. Degterev, A. V. Rybin. - Summary of the Upper Pleistocene correlations in the Russian North / V. I. Astakhov. - Holocene climatic events in Amur River Basin and their correlation / V. B. Bazarova, L. M. Mokhova, T. A. Grebennikova. - About a western boundary of Dnieper glaciation on the southern east-european platform / M. Bargl. - On the causes of two most significant events of the Holocene / A. A. Barenbaum. - On the issue of the construction of the quaternary stratigraphy scale and frequency of the meteoric impacts / A. A. Barenbaum. - Stratigraphy of the sediments from the Mendeleev Rise, (Central Arctic Ocean), based on benthic foraminifera and ostracoda / V. A. Basov, N. V. Kupriyanova, E. S. Novikhina. - Paleosecular geomagnetic variations and late Weichselian Holocene magnetochronology in N-W Russia / V. G. Bakhmutov. - Biostratigraphy of sediments middle and late Holocene in the basin downstream Ussuri / P. S. Belyanin. - The palynology characteristic of loess loam sediments of Ussuri-Khankarazdolnaya depression in the middle and late Neopleistocene / P. S. Belyanin, N. I. Belyanina. - Glacio-marine deposits on the Northern Prinze Charls Mountains (East Antarctica) / A. S. Birjukov, M. S. Egorov. - Features of environmental and climatic changes in the Northern Caspian Sea Region and Caspian Sea Level fluctuations controlled by climate during the Holocene / N. S. Bolikhovskaya. - "Milankovitch Theory" - What does it mean? / V. A. Bolshakov. - MIS 11 problem and supposed 400-kyr Pleistocene climate cycle / V. A. Bolshakov, I. A. Karevskaya. - Sedimentation in the Kamennoe Lake (Kanin Peninsula) and climate changes during the Holocene according to the lake sediments / D. Yu. Bolshiyanov, P. S. Vakhrameeva, G. B. Fedorov, N. A. Bakunov, T. V. Sapelko, A. V. Ludikova, A. S. Makarov, M. V. Pavlov. - Relief and quaternary deposits of the South-Eastern Part of Taimyr Peninsula / D. Yu. Bolshiyanov, G. B. Fedorov, A. V. Krylov, Kh. A. Arslanov, J. Tide. - Last glaciation of the Russian Arctic / B. A. Borisov, E. A. Minina. - Short-term landscape and climatic oscillations in the late glacial: the main steps, results and future prospects of research / O. K. Borisova. - Late Quaternary Plankton biostratigraphy in the Knipovich Ridge Area (North Atlantic) / M. E. Bylinskaya, L. A. Golovina, E. P. Radionova. - Palaeolimnological investigations in the Laptev Sea Region / P. S. Vakhrameeva, D. A. Subetto, B. Diekmann, B. Biskaborn, L. Heinecke, G. Muller. - Strucute and genesis of Gorodok elevation in North-East Belarus / A. Vashkov. - Present problems in the Quaternary (Postapsheronskii) stratigraphy and geochronology of the Caspian Sea Sediments / S. S. Veliev, E. N. Tagieva. - Problem of paleogeography of East Europe in late Pliocene and early Pleistocene / A. A. Velichko, V. V. Pisareva, M. A. Faustova. - Regularities of modern relief organization of Kolyma lowland tundra landscapes (Northeast Siberia) - Remote sensing and GIS Studies / A. A. Veremeeva. - The joint German-Russian Polygon Project - Environmental studies in East Siberian Tundra wetlands / S. Wetterich, A. Bobrov, U. Herzschuh, H. Joosten, L. Pestryakova, E.-M. Pfeijfer, L. Kutzbach, L. Schirrmeister, D. Subetto, V. Tumskoy. - Interglacial environments of Oyogos Yar (Dmitry Laptev Strait) / S. Wetterich, R. Kienast, S. Kuzmina, A. A. Andreev, L. Nazarova, L. Schirrmeister, V. V. Kunitsky. - Geological significance of section "Ogurtsovo" in district of Novosibirsk / I. A. Volkov, S. P. Kazmin. - Present problems of the Quaternary period stratigraphy of the West and Middle Siberia / V. S. Volkova. - New data on the evolution and age of sediments, enclosing the cultural horizon of middle Paleolithic Site Khotylevo-1 (River Desna Basin) / E. V. Voskresenskaya, L. B. Vishniytskiy, I. S. Zuganova, E. U. Novenko, A. K. Ocherednoy. - The Lake Sedimentogenez and features of the Paleogeography Prihankayskoy depression in Late Cenozoic / T. N. Voskresenskaya. - Relief and loose desposits of the Russian Plain main watershed protected areas in the South-East Onega / A. I. Voskresenskiy, I. S. Voskresenskiy, A. N. Kichigin. - Distribution of cryogenic micro relief in low mountainous massifs of the Kola Peninsula / E. V. Garankina. - Change of landscapes in early Pleistocene histories of East European Plane / N. I. Glushankova. - Some structural and mapping features of water-glacial deposits of the Don horizon / B. V. Glushkov, G. V. Kholmovoy. - Using dem for tasks of Quaternary geology and geomorphology of Siberia / N. V. Glushkova, V. A. Lyamina, I. D. Zolnikov, N. N. Dobretsov, V. P. Afanas'ev, D. A. Samdanov, I. I. Boldirev, S. A. Semenova. - Reference horizons of volcanic ash in Quaternary deposits of the Northern Coast of Okhotsk Sea / O. Yu. Glushkova, V. N. Smirnov. - Problems of the Eopleistocene volumes in the South-Eastern West Siberian Plate in the context of the Quaternary bottom lowering / A. G. Golovina, V. S. Volkova. - An influence of coastal processes on sedimentogenesis in the Tsymlyanskoye reservoir / N. V. Golubova. - Environments during the time of initial human settlement of the Kola Peninsula / I. M. Grekov, E. A. Kosheleva. - Mesostratigraphy of middle- and late valdai loess-like loams as the marker of low-range ecosystematic rearrangements / L. A. Gugalinskaya, V. M. Alifanov. - Relief and quaternary sediments from outer part of East Siberian Sea: new data / E. A. Gusev, A. G. Zinchenko, N. Yu. Anikina, L. G. Derevyanko, V. V. Popov. - The Middle Holocene parastratotype old Kieshki Site and its palaeobotanic characteristic (Southern Foreurals) / G. A. Danukalova, E. G. Lapteva, O. M. Korona. - Results of the Mollusc study of the late Pliocene early Quaternary Novosultanbekovo Site (Southern Foreurals) / G. A. Danukalova, E. M. Osipova. - Natural and anthropogenic factors of formation of chemical composition of sediments of lakes of North Fennoscandia / V. A. Dauvalter, N. A. Kashulin, S. S. Sandimirov. - Difficulties of long-term air temperature time series finding for climatological problems / V. I. Demin. - Diatom complexes changes in academicheskoe lake sediments (Khibiny Massif, Kola Peninsula) / D. B. Denisov. - Natural features of sedimentogenesis in the lake of the Eastern slope o , In kyrill. Schr. , In engl. und rus. Sprache

Note: In kyrill. Schr., russ.

Note: Fundamental Concepts -- Introduction and overview -- Introduction to quantum mechanics -- Introduction to computer science -- Quantum Computation -- Quantum circuits -- The quantum Fourier transform and its applications -- Quantum search algorithms -- Quantum computers: physical realisation -- Quantum Information -- Quantum noise, open quantum systems, and quantum operations -- Distance measurement for quantum information -- Quantum error-correction -- Entropy and information -- Quantum information theory -- Notes on basic probability theory -- Group theory -- Approximating quantum gates: the Solovay-Kitaev theorem -- Number theory -- Public-key cryptography and the RSA cryptosystem -- Proof of Lieb's theorem.

Note: CONTENT Preface / M. Dergacheva, A. Makeev Description of study area and paleosol / M. Dergacheva, N. Mironycheva-Tokareva, S. Ponomarev, D. Gavrilov LECTURES Essentials of the paleopedology and a review of Quaternary paleosols of the Northern Hemisphere: main items, presented in the lectures / A. Makeev Paleosols in geologic history of the Earth / A. Makeev Possibilites and limits of pedohumus method used at investigations types and environment of ancient pedogenesis / M. Dergacheva Classification system of paleosols / I. Fedeneva Indicating function of pedogenic carbonates in paleoclimatic reconstruction of Holocene and Pleistocene / O. Khokhlova Miromorphological capacities for reseaching of palaeosoils / M. Lebedeva (Verba) Three-dimensional morphology of soil / A. V. Zakharchenko Paleomagnetic method for studing Pliocene and Quaternary deposits of Siberia (current status, problems, prospects) / Z. N. Gnibidenko Specific chemical state anthropogenic transformed soil of the ancient settlements / O. Yakimenko Geochemical peculiarities of soils as an indicator of specific of their formation and anthropogenic transformation / L. Rikhvanov REPORTS Problem of paleosols weed / A. Blagodatnova Spatial distribution of mobile phosphates in Kamennyi Ambar settlement (Chelyabinsk region) / K. Bojtsova Review of literature data for the study of humus horizon chernozem rate formation / E. Burnatova Pedogenic features in paleosols of Samara Volga region archaeological sites / D. Vassilieva Paleosols of Early Iron Age double kurgan of burial ground Kuigenzhar (Northern Kazakhstan) / D. Gavrilov, R. Ishmuratov, A. Toguzbaev Salt soils of Central-Tuva depression / Ch. Danchai-ool Humus composition of Zaural' e forest-steppe and steppe zones on example of archaeological sites / T. Zhdanova Properties variation of the upper part of the modern soils and surface paleosols of key site Volodarka (Barnaul Priobye) / H. Zhaharova Chernozems morphological properties of key area «Volodarka» / O. Kazachenok Comparative characteristics of the modern turf-podzolic soil and the soil buried under centenary dump (Sysert' District, Middle Urals) / L. Kirilyuk Paleopedology: objects and article of researches (review of publications in a «Soil Science» magazine for 2008-2010) / M. Komarova Soils with a buried humus horizon / B. Mongush Paleogeography formation conditions of Tuva sandy landscapes / Ch. Mongush, S. Kurbatskaya The comparative characteristic of 700-year-old and background soil near Sovetskiy city (middle taiga) / O. Nekrasova Humus soil memory: the conditions and time limits for the conservation of steppe / A. Nikiforov Study Holocene evolution of Central Tuva soil and soil formation / K. Ochur Estimation of restoration rate of damaged soils (on materials of studying archaeological objects of the foreststeppe zone) / E. Politova, V. Valdayskih Some polygenetic chernozem characteristics of the Ob Plateau Eastern edge (for example, the key area "Volodarka") / S. Ponomarev Vertical zonality soils in the Sayan mountains in Tuva / V. Sanchaiban Soil physical properties as a soil memory flash / E. Surkova Peculiarities of soddy-alluvial soil of the river Sysert' water-meadow (The Middle Urals) / A. Uchaev Aqueous extract composition of anthropogenically disturbed soils of Kamennyi Am bar settlement / D. Filimonova Environmental conditions of steppe soils for example near the village of Volodarka / H. Cherepanova New investigations at Tokaj-Csorgukut II. Loess section, Northeast Hungary / D. G. Páll, G. Persaits, P. Sümegi P Preliminary results on the phytoliths of the dutch neolithic site Swifterbant as seen from samples retrieved from soils, pig droppings and molars / G. Persaits, D. C. M. Raemaekers , In kyrillischer Schrift , Beiträge teilweise in englischer, teilweise in russischer Sprache

Note: Content: Preface. - Polar ecosystems in a changing climate. - Ice edge blooms - Migrating oases in polar seas. - Antarctic: Krill has evolved adaptation strategies to its extreme environment. - Living at -20 degrees: why sea Ice algae don't freeze up. - ocean acidification and Iron deficiency affect Antarctic phytoplankton communities. - The oceans are acidifying: spIder crabs and Ice fIsh are feeling the repercussions of climate change. - melting glaciers - Changing coastal ecosystems in the West Antarctic. - In the service of science: elephant seals explore the Southern Ocean. - Ocean Acoustics - palaoa broadcasts live from the Southern Ocean. - When ice shelves disintegrate - diversity of life on the Antarctic seabed. - RV 'Polarstern' in Antarctica - observations in the ice. - deep-sea observatory in the Arctic: Climate change affects life on the ocean floor. - plankton rain in the vicinity of the Arctic HAUSGARTEN: What do sinking particles tell us?. - pelagic research in the Arctic faces new challenges. - fram observatory - live conference with the Arctic deep sea in preparation. - dom - the oceans' molecular memory. - siberian forests moving north - impact on the climate and biodiversity. - promoting young talent: High school pupils learn together with AWI scientists. - dream job- polar scientist - How a student achieved her goal over an icy path. - marIne biosciences in the scientific-societal context of the 21st. century. - Contact persons at the AWI. - Imprint. - geographic locatIons of the research reports of this brochure

Note: Zugleich: Dissertation, Freie Unversität Berlin, [ca. 1963] , INHALTSVERZEICHNIS PROBLEMSTELLUNG UND ZIELSETZUNG 1. BEMERKUNGEN ZUM BEOBACHTUNGSGELÄNDE UND ZUM BEOBACHTUNGSMATERIAL 1.1 Das Beobachtungsgelände 1.2 Das Beobachtungsmaterial 2. HOMOGENITÄTSBETRACHTUNGEN 2.1 Temperatur 2.2 Niederschlag 2.3 Wind 2.4 Sonnenschein und Bewölkung 3. TEMPERATURVERHÄLTNISSE 3.1 Monats- und Jahreswerte 3.2 Tageswerte 3.3 Pentadenwerte 3.4 Häufigkeitsbetrachtungen 3.5 Interdiurne Veränderlichkeit 3.6 Der tägliche Gang 3.7 Vorkommen bestimmter Schwellenwerte 3.71 Frost- und Eistage 3.72 Sommer- und Tropentage 4. DER WASSERGEHALT DER LUFT 4.1 Monats- und Jahreswerte 4.2 Tageswerte 4.3 Häufigkeitsbetrachtungen 4.4 Interdiurne Veränderlichkeit 4.5 Der tägliche Gang 5. BEWÖLKUNGSVERHÄLTNISSE 5.1 Monats- und Jahreswerte 5.2 Tageswerte 5.3 Häufigkeitsbetrachtungen 5.4 Der tägliche Gang 5.5 Heitere und trübe Tage 5.6 Nebel 6. SONNENSCHEIN 6.1 Monats- und Jahreswerte 6.2 Tageswerte 6.3 Der tägliche Gang 7. NIEDERSCHLAGSVERHÄLTNISSE 7.1 Monats- und Jahreswerte 7.2 Niederschlagsbereitschaft 7.3 Tageswerte 7.4 Der tägliche Gang 7.5 Häufigkeitsbetrachtungen 7.6 Niederschlags- und Trockenperioden 7.7 Niederschlag und Wind· 7.8 Schneeverhältnisse 7.81 Schneefall und Schneedecke 7.82 Schneehöhe 7.9 Gewitter 8. WINDVERHÄLTNISSE 8.1 Windrichtung 8.2 Windgeschwindigkeit 8.21 Der jährliche Gang 8.22 Häufigkeitsbetrachtungen 8.23 Sturmtage und Windstillen 8.24 Der tägliche Gang 9.ZUSAMMENFASSUNG VERZEICHNIS DER TEXTTABELLEN VERZEICHNIS DER ABBILDUNGEN LITERATURVERZEICHNIS TABELLENANHANG