ALBERT

Note: San Antonio, Univ. of Texas, Diss., 2009

Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.

Note: Table of Contents - Čast' 1.: Research by the pulsing method of a NRM of the metastable water formed at dissociation freonhydrate-12 in the field of negative temperatures / V. A. Vlasov, A. G. Zavodovsky, M. S. Madygulov, A. N. Nesterov, A. M. Reshetnikov. - Kinetics crystallization subcooling of the water contacting to surface gas hydrate / V. A. Vlasov, A. G. Zavodovsky, M. S. Madygulov, A. N. Nesterov, A. M. Reshetnikov. - Transformation of cryogenic structure of frozen clay soils at plain stamp test / S. S. Volokhov. - About influence of contact zone structure of frozen soils with materials on adfreezing strength / S. S. Volokhov, N. V. Solovyeva. - Possibilities of calculating the effective diffusion coefficient of water vapour in snow due to field observations data / R. I. Gavriliev. - Features of water's crystallization in dispersed rocks / V. N. Golubev, G. A. Rzhanitsyn. - Mass exchange in the system of atmosphere-snow cover-ground / V. N. Golubev, D. M. Frolov. - Physical and mechanical aspects of phase transition processes in frozen and freezing ground / J. B. Gorelik. - The experimental stadies of cryogenic preassure into water-saturated saline soils / S. E. Grechishchev, A. V. Brousehkov, Ark. V. Pavlov, O. V. Grechisheheva. - Phase composition of frozen saline ground with petroleum pollution / E. S. Grechishcheva, R. G. Motenko. - About plastic deformation of frozen rocks / M. M. Iudin. - Studies of Soil Moisture Transfer and ice extraction in clay loam Patterns Under External Pressure / O. A. Kazansky. - Isotopic content of interfacial water and ice frozen ground / V. N. Konischev, V. V. Rogov, V. N. Golubev, S. A. Sokratov. - On longevity and structured physical system organizations (on example of frozen soils and ice) / A. A. Konovalov. - On toughness and deforming the frozen ground / A. A. Konovalov. - The study of deformation characteristics of thawing soils / P. I. Kotov. - Thermal properties of volcanic ashes (Kamchatka) / E. P. Kuznetsova, R. G. Motenko. - About temperature extension coeffision of frozen soils / V. P. Merzlyakov. - Classification indicators of frost-susceptible soils / A. L. Nevzorov. - Separation of the pore solution compounds during mass transfer in disperse ice / V. Ye. Ostroumov, N. V. Ostroumova. - Achievements and problems of frozen soils mechanics / L. T. Roman. - Classification of frozen soils / L. T. Roman, V. I. Aksenov, A. V. Iospa. - Modification of frozen soils and ice by adding polyvinyl alcohol in order to facilitate construction / E. V. Safronov, V. V. Vialdin, V. G. Cheverev, V. E. Gagarin, D. V. Hvostikov. - Method of mass crystallization calculation for multiphased rheological mediums / N. I. Sidnyaev, D. A. Krylov. - The deflected mode of the freezing soils layer taking into account the creep and compliance of the boundary conditions / Z. G. Ter-Martirosyan, P. A. Gorbachev. - Study of deformation characteristics of thawing soils of Vankor oilfield / M. N. Tsarapov. - Influence of outer loading on frost heaving of freezing soils, according to theoretical and experimental researches / V. G. Cheverev, M. A. Minkin, E. V. Safronov, V. E. Gagarin, R. S. Bumaev. , Table of Contents - Čast' 2.: Investigation of glaciers and fumarolic activity of Mt Elbrus / V. A. Alekseev, N. G. Alekseeva, M. G. Daniyalov, P. A. Morozov, C. M. Pershin, P. V. Hlebopashev. - The study of impact craters near the Tunguska meteorite epicenter / V. A. Alekseev, V. V. Kopeykin, N. G. Alekseeva, V. V. Krivulin, L. G. Pelehan', V. A. Rukavishnikov, V. A. Chechin. - Engineering geophysical investigations to substantiate the investments for Nizhne-Timptonsk HPP construction / O. K. Voronkov, N. N. Sigatcheva, O. A. Semenov, Yu. Yu. Punin. - Essentials of technique for seismic hazard zoning of extended linear structures in cryolithic zone / V. I. Dzhurik, S. P. Serebrennikov, L. A. Usynin, E. V. Bryzhak. - Temperature dependence of seasonal changes of electrical resistance of frozen ground / V. N. Efremov. - Role and place geophysical methods at studying criolitozone / Y. D. Zykov, A. V. Koshurnikov, N. V. Paramonov, A. A. Pogorelov, R. D. Ostrovsky, A. Y. Gunar. - EM sounding technology's capability in long-term engineering-geological studies in transition zones (case study: transition of a pipeline Bovanenkovo-Ukhta through Baidaratskaya Bay) / Y. D. Zykov, Y. V. Kuleshov, S. V. Kulakov, A. V. Koshurnikov, E. I. Gorshkov, A. A. Pogorelov, E. M. Sizykh. - Experience using of aerospace infrared thermal data for characteristics of the permafrost / S. G. Kornienko. - Wave characteristics of permafrost in Western Yakutia / L. G. Neradovsky. - Geological-geophysical analysis of seismic events in the cryolithic zone of Mongolia / S. P. Serebrennikov, Ts. Batsaikhan, V. I. Dzhurik, A. Yu. Eskin, A. F. Drennov. - Seismic geocryological study of shallow waters in permafrost / A. G. Skvortsov, M. R. Sadurtdinov, A. M. Tsarev. - Features of seismic methods in engineering geocryological studies / A. G. Skvortsov, A. M. Tsarev, M. R. Sadurtdinov. - Descriptiveness of geophysical methods in the assessment of oil pollution / A. D. Skobelev, Y. D. Zykov, A. V. Koshurnikov, A. A. Pogorelov, P. D. Ostrovsky, A. Y. Gunnar. - Radiolocation of the upper frozen ground in Anadyr city: structure, interpretation, forecast / O. D. Tregubov. - Estimating of rock state and properties in long-tem physical weathering by an ultrasonic method / L. F. Ushakova, O. K. Voronkov. - The efficiency of geophysical methods in studies of cryolithic zone in the process of placer accumulation by dredge acquisition / I. M. Khasanov, N. L. Alevskaya, A. V. Koshumikov. - Impact assessment of cryolithic zone in geophysical explorations of gold minefields on a prospecting step, that arc disposed in background medium, consisted of finest sedimentary rock / I. M. Khasanov, V. M. Sharaphytdinov, A. V. Koshurnikov. - Engineering-geocryological research in offshore area of Kruzenshternsky field in Kara sea / V. A. Kholodilov, M. L. Tsemkalo, M. F. Savitskiy, N. V. Paramonov, A. V. Koshumikov, A. A. Pogorelov. - Using electrical resistivity tomography to investigate near-shore permafrost dynamics / P. Overduin, M. Grigoriev, T. Haberlau, S. Wetterich, S. Westermann, K. Yoshikawa. , Table of Contents - Čast' 3.: Cryogenic and seismogenic deormations in the Late Cenozoic deposits of Tunkinskaya depression in Baikal rift zone / S. V. Alexeev, L. P. Alexeeva, A. C. Gladkov, O. V. Lunina, A. M. Kononov, A. V. Andreev. - Coastal Permafrost evolution of Western Yamal in context of climate change / A. A. Vasiliev, I. D. Streletskaya, R. S. Shirokov, G. E. Oblogov. - Classification of massive ice /Yu. K. Vasil'chuk. - δ18O variation of Late Holocene ice-wedge of Aventdalen, Svalbard / Yu. K. Vasil'chuk, N. A. Budantseva, A. M. Zemskova. - Pollen spectra of massive ice of Yerkutayakha River valley, Southern Yamal Peninsula / A. C. Vasil'chuk, Yu. K. Vasi l'chuk, N. A. Budantscva. - Complex assessment of crioecolological and bioresource state of northern geosystems / L. I. Zotova, S. J. Dedjusova. - Study of Quaternary sediments and ground ice with detailed grane-size composition analysis at Yenisey North / M. S. Pavlov, I. D. Streletskaya, A. G. Matyukhin, G. E. Oblogov, A. V. Surkov. - On rock weathering in Cryolithozone / D. M. Shesternev. - Fossil organic matter in permafrost deposits of northern East Siberia - contents and characteristics / L. Schirrmeister, S. Wetterich, G. Grosse, J. Strauss, C. Siegert, P. P. Overduin, H.-W. Hubberten. , Table of Contents - Čast' 4.: The influence of reservoir parameters on hydrate formation in gas wells in permafrost / E. A. Bondarev, K. K. Argunova, I. I. Rozhin. - Research features of deposits wells with abnormal low field temperature / Z. A. Vasil'eva, D. S. Djafarov. - Technogenic indicators of natural gas hydrates presence in deposits of the western part of the Siberian Platform and Yenisei-Khatanga Depression / Z. A. Vasil'eva, D. S. Dzhafarov. - The commercially viable unconventional gas sources (gas hydrates, coalbed methane and shale gas) - experience of development and prospects in Russia / E. V. Perlova. - Gas hydrate of Yamal region (Yamal Peninsular, Kara Sea's shelf) - occurance, types, resources, technogenic challenges / E. V. Perlova, S. A. Leonov, E. S. Miklyaeva, S. D. Perlov. - Variation of thermal conductivity in gas-saturated sediments during hydrate accumulation and freezing / E. M. Chuvilin, B. A. Buhanov. - Sources of natural gas in cryolithozone of Yamal Pemnsula / V. S. Yakushev. , In kyrill. Schr.

Note: Meditation: why bother? -- What meditation isn't -- What meditationis -- Attitude -- The practice -- What to do with your body -- What to do with your mind -- Structuring your meditation -- Set-up exercises -- Dealing with problems -- Dealing with distractions 1 -- Dealing with distractions II -- Mindfulness (Sati) -- Mindfulness versus concentration -- Meditation in everyday life -- What's in it for you.

Note: TABLE OF CONTENTS: Contemporary hydrographic network of the North-East of the Russian Plain: chronology of development / A. S. Lavrov, L. M. Potapenko. - Some distinctions of big and smoll interglacials (by way of example of Western Siberia during Late Pleistocene) / S. A. Laukhin, A. M. Firsov. - Pollen spectra in the lithological facies of lake bottom sediment on the White Sea Coast / N. B. Lavrova, V. V. Kolka, O. P. Korsakova. - Barsova Gora is the unical object of glacial geology and Taiga vegetation in the middle Priobie / N. B. Levina, V. A. Tkachenko, V. N. Turin, N. N. Lavrovich, E. V. Shepetova. - Geological role of ice in formation of the Arctic Ocean recent and quaternary sediments composition / M. A. Levitan, K. V. Syromyatnikov. - Granite protrusions as a relief-forming factor of the activated sections of platforms and mobile belts / M. G. Leonov, E. S. Przhiyalgovsky. - Glacial tectonics and the granulated substance mechanics / M. G. Leonov, O. G. Epshtein. - Late Pliocene-Early Pleistocene lake sediments in hollow D'Issyk-kul / O. N. Leflat, T. N. Voskresenskaya. - Complexity and diversity of genetic indication of loose formations and new things in the methods of their identification (according to the results of research of small rivers' valleys of the North of Amur-Zeya Plain, Lower Amur Region and Western Priokhotye / E. Yu. Likutov. - Landscape-geological characteristic of travertine cascade of the ancient thermal source of tract pymvashor / A. A. Ljubas, J. N. Bolotov, M. Y. Gofarov, S. A. lglovskiy. - Lake's lithogenesis: new formations are on the bottom of the drying up Udinsky Streach / L. A. Magaeva, M. T. Ustinov. - Genetic classification of peat deposits based on trophicity degree / G. L. Makarenko. - On the issue of classification of mires based on trophicity degree / G. L. Makarenko. - Some burning issues of a structural interpretation of the plain areas relief / V. I. Makarov, N. V. Makarova, T. V. Sukhanova. - The first experience of the 230Th/U dating of buried wood remains / R. E. Maksimov, V. Yu. Kuznetsov, S. A. Laukhin, I. E. Zherebtsov, S. B. Levchenko, N. G. Baranova. - Variations of the relative intensity of geomagnetic field in bottom sediments of the Bering Sea and North-Western Pacific during the last 380 kyr / M. I. Malakhov, S. A. Gorbarenko, D. Nurnberg, R. Tiedemann, G. Yu. Malakhova, J. Riethdorf. - Using high-resolution records petromagnetic and lithophysic characteristics of the sediments Bering Sea and high-latitude Western Pacific for reconstruction of climate and environment in the Late Pleistocene-Holocene / M. I. Malakhov, S. A. Gorbarenko, D. Nurnberg, R. Tiedemann, G. Yu. Malakhova, J. Riethdorf. - Some information about genetic classification of lakes of the Vepsovsky Hill East of the Leningrad Region / O. V. Malozemova, L. A. Nesterova, D. A. Subetto. - Middle Pleistocene small mammal faunas of Eastern and Central Europe: Chronology, correlation / A. K. Markova, T. van Kolfschoten. - Astronomical and meteorological criteria of defining human activity traces in ancient megalith rock complexes in the North-West Russia / L. S. Marsadolov, G. N. Paranina. - Palynological characteristics of the middle Pleistocene deposits in the Vychegda River Basin, the Komi Republic (preliminary data) / T. I. Marchenko-Vagapova. - Isotope specialization (δ18O, δ13C) of quaternary carbonates from Belarus and potential of palaeoenvironments indication / N. A. Makhnach. - The complex survey of quaternary deposits / A. V. Mashukov, A. E. Mashukova. - Quaternary deposits and construction materials' deposits in the Kaluga Region / S. G. Medvedeva. - Vegetation and climate of Sakhalin in the early Holocene / Yu. A. Mikishin, L. G. Gvozdeva. - Inorganic geochemistry record of stages 6-11 from Elgygytgyn lake sediments (deep drilling data) / P. S. Minyuk, V. Ya. Borkhodoev and Elgygytgyn Scientific Party. - Palaeoshorelines on the Murmansk coast / M. V. Mityaev. - Vertical matter flow in Gulfs on Murmansk and Karelian coasts / M. V. Mityaev, M. V. Gerasimova. - Channel and basin components of sediment yield in the formation of quaternary alluvial suites of rivers of the middle Volga Region / V. V. Mozzherin. - Late Pleistocene interglacial-glacial climatic transition (MIS 5/MIS 4) as derived from palynological analysis and IR-OSL dating of deposits from the Voka Reference Section, Southeastern coast of the Gulf of Finland / A. N. Molodkov, N. S. Bolikhovskaya. - Quaternary sediments in the Central Part of Northern West Siberia / D. V. Nazarov. - Palynological evidences of the postglacial warm event of the Laptev Sea Region / O. D. Naidina. - Some problems of using luminescent methods for absolute dating of glacial deposits (by the example of Chagan Section, SE Altai) / R. K. Nepop, A. R. Agatova, H. Rodnight. - Freshwater travertine-like carbonates of the Izhora Plateau as the natural markers of the structural dislocations / M. U. Nikitin, A. A. Medvedeva. - Fold deformations in late Pleistocene deposits of the Central Part Kola Region and their genesis / S. B. Nikolaeva. - Mammoths and man of stone age in Northern Europe - insight of a question on migrations to European Subarctic by Western paths / A. A. Nikonov. - Formation of present-day deposits in the conditions of technogenic litogenesis / E. N. Ogorodnikova, S. K. Nikolaeva. - Traces cryogenesis of Neopleistocene sediments the lower Irtysh / O. L. Opokina, E. A. Slagoda. - Stratigraphical subdivision of the Eopleistocene deposits of the Simbugino Site and new mollusc finds (Southern Foreurals) / E. M. Osipova, G. A. Danukalova. - Late Pleistocene to Holocene environment and climate in the Upper Ponoy Depression (Kola Peninsula) reconstracted from pollen record of Churozero lake bottom deposits / E. Yu. Pavlova, M. V. Dorozhkina, E. I. Devyatova. - Absolute chronology and climatic conditions of Valdai (Vistulian) terraces formation in the middle Seim River Valley / A. Panin, J.-P. Buylaert, E. Matlakhova, A. Murray, O. Pakholova. - Possibility of reconstruction of climate change in the Mongolian Altai based on analysis of annual records in glaciers and lacustrine sediment / T. S. Papma, E. Yu. Mitrofanova, N. S. Malygina. - Northern labyrinth - thee Gnomon: compass, clock, calendar / G. N. Paranina. - Late Pleistocene and Holocene paleogeography of the coastal lowlands of Is. Paramushir (Kuril Islands) / A. Ju. Pakhomov. - Upper-Kama (Verhnekama) Upland - the newest lifting of the middle Last Pleistocene / M. M. Pakhomov, I. L. Borodatyi. - Dating mass accumulations of Mammoth across Arctic Eurasia / V. V. Pitulko, P. A. Nikolskiy, A. E. Basilyan, E. Y. Pavlova. - Features of vertical distribution of the materials within the marginal zones of permafrost polygonal structures and its importance for dating of quaternary deposits in cryolitozone / V. V. Pitulko, E. Y. Pavlova, A. E. Basilyan, S. G. Kritsuk. - Morfogenesis of the tectonics active area of the Mongolian Altay / S. G. Platonova. - Reference section of the Lichvin interglacial in the North-Western Part of European Russia's Region / E. S. Pleshivtseva, V. L. Garkusha, M. A. Travina. - New radiocarbon dates of Late Quaternary Mammals in the Arkhangelsk Region in connection with reconstructions of the last glaciation in the Eastern Europe / D. V. Ponomarev, T. van Kolfschoten, A. K. Markova, J. van der Plicht. - Geological illustrations of Aral-Caspian Region's latest seismodynamic high activity / V. I. Popkov. - About Karagiinsk closed depression (Mangishlak)'s genesis / V. I. Popkov. - On the issue of formation of the Caucasian mineral waters' modern structural geomorphologic aspect / V. I. Popkov, I. G. Sazonov, D. A. Kolleganova. - Natural climate changes on the border of Late Pleistocene and Holocene / A. N. Popova, D. A. Subetto. - Some problems paleogeomorfologi Volga Region / I. V. Proletkin. - New perspectives on modern geomorphological studies / I. V. Proletkin. - Dynamics of small mammals local assem , In kyrill. Schr. , In engl. und rus. Sprache

Note: Inhaltsverzeichnis: Vorwort. - 1 Theoretische Grundlagen und Zielsetzung der Physiologie. - 1.1 Das Selbstverständnis der Physiologie. - 1.2 Gesetzesaussagen in der Biologie. - 1.3 Systemtheorie. - 1.4 Prinzipien wissenschaftlichen Arbeitens. - 1.5 Das Kausalitätsprinzip in der Physiologie. - 1.6 Das Problem der Komplexität. - 1.7 Formulierung von Sätzen. - 1.8 Merkmale und Variabilität. - 1.9 Maßsystem und Bezugsgrößen. - 1.10 Darstellung von Daten. - 2 Die Zelle als morphologisches System. - 2.1 Die meristematische Pflanzenzelle. - 2.1.1 Strukturelle Gliederung. - 2.1.2 Endoplasmatisches Reticulum. - 2.1.3 Zellkern (Nucleus). - 2.1.4 Golgi-Apparat. - 2.1.5 Peroxisomen. - 2.1.6 Mitochondrien und Piastiden. - 2.1.7 Cytoskelett. - 2.1.8 Zellwand. - 2.2 Zellteilung. - 2.2.1 Cytokinese und Karyokinese. - 2.2.2 Regulation des Zellcyclus. - 2.2.3 Determination der Teilungsebene. - 2.3 Zelldifferenzierung. - 2.4 Zeil- und Organpolarität. - 2.5 Die Evolution der Pflanzenzelle. - 2.6 Vom einzelligen zum vielzelligen Organismus. - 3 Die Zelle als energetisches System. - 3.1 Der 1. Hauptsatz der Thermodynamik. - 3.2 Der 2. Hauptsatz der Thermodynamik. - 3.3 Die Zelle als offenes System, Fließgleichgewicht. - 3.4 Chemisches Potenzial. - 3.5 Chemisches Potenzial von Wasser. - 3.6 Anwendung des Wasserpotenzialkonzepts auf den Wasserzustand der Zelle. - 3.6.1 Die Zelle als osmotisches System. - 3.6.2 Das Osmometermodell. - 3.6.3 Die Zelle als Osmometeranalogon. - 3.6.4 Das Matrixpotenzial. - 3.6.5 Nomenklatorische Schwierigkeiten. - 3.6.6 Das osmotische Zustandsdiagramm der Zelle (Höfler-Diagramm). - 3.6.7 Die experimentelle Messung von π und ψ. - 3.6.8 Regulation des Wasserzustandes. - 3.7 Chemisches Potenzial von Ionen. - 3.8 Membranpotenzial. - 3.9 Energetik biochemischer Reaktionen. - 3.10 Phosphatübertragung und Phosphorylierungspotenzial. - 3.11 Redoxsysteme und Redoxpotenzial. - 4 Die Zelle als metabolisches System. - 4.1 Biologische Katalyse. - 4.1.1 Aktivierungsenergie. - 4.1.2 Enzymatische Katalyse. - 4.1.3 Enzymkinetik. - 4.1.4 Messung der Enzymaktivität. - 4.1.5 Modulation der Enzymaktivität. - 4.2 Metabolische Kompartimentierung der Zelle. - 4.3 Transportmechanismen an Biomembranen. - 4.3.1 Diffusion und Permeation. - 4.3.2 Spezifität des Membrantransports, Transportkatalyse. - 4.3.3 Transporter, Ionenpumpen und Ionenkanäle. - 4.3.4 Aquaporine. - 4.3.5 Passiver und aktiver Transport. - 4.3.6 Shuttle-Transport. - 4.4 ATP-Synthese an energietransformierenden Biomembranen. - 4.5 Stoffaufnahme in die Zelle. - 4.5.1 Ionenaufnahme. - 4.5.2 Aufnahme von Anelektrolyten. - 4.5.3 Akkumulation von Metaboliten und anorganischen Ionen in der Vacuole. - 4.6 Prinzipien der metabolischen Regulation. - 4.6.1 Ebenen der Regulation. - 4.6.2 Regulation des Enzymgehalts. - 4.6.3 Regulation des Aktivitätszustands bei konstantem Enzymgehalt. - 4.6.4 Intrazelluläre und interzelluläre Signaltransduktion. - 4.6.5 Die Integration der Regulationsmechanismen zum Kontrollsystem. - 5 Die Zelle als wachstumsfähiges System. - 5.1 Biophysikalische Grundlagen des Zellwachstums. - 5.1.1 Hydraulisches Zellwachstum. - 5.1.2 Messung der physikalischen Wachstumsparameter. - 5.2 Wachstum und Zeliwandveränderungen. - 5.2.1 Die strukturelle Dynamik der Primärwand. - 5.2.2 Diffuses Wachstum der Zellwand. - 5.2.3 Lokales Wachstum der Zellwand. - 5.3 Integration des Zellwachstums in vielzelligen Systemen. - 5.3.1 Die Epidermiswand als zellübergreifende Organwand. - 5.3.2 Streckungs-und Kontraktionswachstum bei Wurzeln. - 5.4 Zur Beziehung zwischen Zellwachstum und Zellteilung. - 5.5 Regulation des Streckungswachstums. - 6 Die Zelle als gengesteuertes System. - 6.1 Das Gen - die Einheit der genetischen Information. - 6.2 Die Organisation des Genoms. - 6.2.1 Die drei Genome der Pflanzenzelle. - 6.2.2 Genomstruktur im Zellkern. - 6.2.3 Das plastidäre Genom. - 6.2.4 Das mitochondriale Genom. - 6.3 Die Transkriptionspromotoren, RNA-Polymerasen und RNA-Reifung. - 6.3.1 Transkription nucleärer Gene. - 6.3.2 Transkription plastidärer Gene. - 6.3.3 Transkription mitochondrialer Gene. - 6.3.4 KNA-editing. - 6.4 Proteinsynthese (Translation) und Protein-turnover. - 6.4.1 Translation und Protein-turnover im Cytoplasma. - 6.4.2 Translation und Protein-turnover in Piastiden. - 6.4.3 Translation und Protein-turnover in Mitochondrien. - 6.5 Die Zelle als regulatorisches Netzwerk der Genexpression. - 6.5.1 Regulation nucleärer Gene. - 6.5.2 Regulation plastidärer Gene. - 6.5.3 Regulation mitochondrialer Gene. - 6.5.4 Evolutionäre Adaption von Regulationsstrukturen. - 7 Intrazelluläre Proteinverteilung und Entwicklung der Organellen. - 7.1 Proteinsortierung in der Pflanzenzelle. - 7.1.1 Prinzipien der Proteinsortierung. - 7.1.2 Proteinexport aus der Zelle und Import in die Vacuole. - 7.1.3 Proteintransport in die Mitochondrien. - 7.1.4 Proteintransport in die Piastiden. - 7.1.5 Isosorting - das gleiche Protein für Cytoplasma, Mitochondrien und Piastiden. - 7.1.6 Evolution der Proteintransportsysteme in Mitochondrien und Piastiden. - 7.1.7 Proteintransport in die Peroxisomen. - 7.1.8 Proteintransport in den Zellkern. - 7.2 Entwicklung der Mitochondrien. - 7.3 Entwicklung der Piastiden. - 7.4 Entwicklung der Peroxisomen. - 8 Photosynthese als Funktion des Chloroplasten. - 8.1 Photosynthese als Energiewandlung. - 8.2 Energiewandlung im Chloroplasten. - 8.2.1 Struktur der Chloroplasten. - 8.2.2 Struktur der Thylakoide. - 8.2.3 Photosynthesepigmente. - 8.2.4 Quantenmechanische Grundlagen der Lichtabsorption. - 8.2.5 Funktion der Pigmente. - 8.2.6 Energietransfer in den Pigmentkollektiven. - 8.2.7 Bildung von chemischem Potenzial. - 8.2.8 Funktionelle Verknüpfung der beiden Photosysteme. - 8.3 Die Pigmentsysteme der Rot- und Blaualgen. - 8.4 Photosynthetischer Elektronentransport. - 8.4.1 Offenkettiges System. - 8.4.2 Cyclisches System. - 8.5 Mechanismus der Photophosphorylierung. - 8.6 Der biochemische Bereich. - 8.6.1 Stoffwechselleistungen der Chloroplasten. - 8.6.2 Fixierung und Reduktion von CO2. - 8.6.3 Reduktion und Fixierung von Nitrat und Sulfat. - 8.6.4 Photosynthetische H2-Produktion. - 8.6.5 Photosynthetische N2-Fixierung. - 8.7 Regulation der photosynthetischen Teilprozesse. - 8.7.1 Regulation der Energieverteilung zwischen PSI und PSII. - 8.7.2 Regulation der ATP-Synthase-Aktivität. - 8.7.3 Regulation der CO2-Assimilation im Calvin-Cyclus. - 8.7.4 Koordination von C- und N-Assimilation. - 8.7.5 Fluoreszenzlöschung als Indikatorreaktion für die Effektivität der Photosynthese. - 8.8 Ein kurzer Blick auf die anoxygene Photosynthese der phototrophen Bakterien. - 9 Dissimilation. - 9.1 Energiegewinnung bei der Dissimilation. - 9.2 Dissimilation der Kohlenhydrate. - 9.2.1 Freisetzung chemischer Energie. - 9.2.2 Glycolyse. - 9.2.3 Fermentation (alkoholische Gärung und Milchsäuregärung). - 9.2.4 Citratcyclus und Atmungskette. - 9.2.5 Cyanidresistente Atmung. - 9.2.6 Oxidative Phosphorylierung. - 9.2.7 Elektronentransport an der Plasmamembran. - 9.2.8 Oxidativer (dissimilatorischer) Pentosephosphatcyclus. - 9.3 Photorespiration. - 9.3.1 Lichtatmung und Dunkelatmung. - 9.3.2 Photosynthese von Glycolat. - 9.3.3 Metabolisierung des photosynthetischen Glycolats im C2-Cyclus. - 9.3.4 Glycolatstoffwechsel bei Grün- und Blaualgen. - 9.4 Mobilisierung von Speicherstoffen in Speichergeweben. - 9.4.1 Natur und Lokalisierung der Speicherstoffe. - 9.4.2 Umwandlung von Fett in Kohlenhydrat. - 9.4.3 Metabolismus von Speicherpolysacchariden. - 9.4.4 Metabolismus von Speicherproteinen. - 9.5 Regulation des dissimilatorischen Gaswechsels. - 9.5.1 Atmung: CO2-Abgabe und O2-Aufnahme. - 9.5.2 Der Respiratorische Quotient. - 9.5.3 Regulation des Kohlenhydratabbaus durch Sauerstoff. - 9.5.4 Induktion der Fermentation durch Enzy

Note: Contents: 1 Introduction and examples. - 1.1 Introduction. - 1.2 Why Bayes?. - 1.2.1 Estimating the probability of a rare event. - 1.2.2 Building a predictive model. - 1.3 Where we are going. - 1.4 Discussion and further references. - 2 Belief, probability and exchangeability. - 2.1 Belief functions and probabilities. - 2.2 Events, partitions and Bayes' rule. - 2.3 Independence. - 2.4 Random variables. - 2.4.1 Discrete random variables. - 2.4.2 Continuous random variables. - 2.4.3 Descriptions of distributions. - 2.5 Joint distributions. - 2.6 Independent random variables. - 2.7 Exchangeability. - 2.8 de Finetti's theorem. - 2.9 Discussion and further references. - 3 One-parameter models. - 3.1 The binomial model. - 3.1.1 Inference for exchangeable binary data. - 3.1.2 Confidence regions. - 3.2 The Poisson model. - 3.2.1 Posterior inference . - 3.2.2 Example: Birth rates. - 3.3 Exponential families and conjugate priors. - 3.4 Discussion and further references. - 4 Monte Carlo approximation. - 4.1 The Monte Carlo method. - 4.2 Posterior inference for arbitrary functions. - 4.3 Sampling from predictive distributions. - 4.4 Posterior predictive model checking. - 4.5 Discussion and further references. - 5 The normal model. - 5.1 The normal model. - 5.2 Inference for the mean, conditional on the variance. - 5.3 Joint inference for the mean and variance. - 5.4 Bias, variance and mean squared error. - 5.5 Prior specification based on expectations. - 5.6 The normal model for non-normal data. - 5.7 Discussion and further references. - 6 Posterior approximation with the Gibbs sampler. - 6.1 A semiconjugate prior distribution. - 6.2 Discrete approximations. - 6.3 Sampling from the conditional distributions. - 6.4 Gibbs sampling. - 6.5 General properties of the Gibbs sampler. - 6.6 Introduction to MCMC diagnostics. - 6.7 Discussion and further references. - 7 The multivariate normal model. - 7.1 The multivariate normal density. - 7.2 A semiconjugate prior distribution for the mean. - 7.3 The inverse-Wishart distribution. - 7.4 Gibbs sampling of the mean and covariance. - 7.5 Missing data and imputation. - 7.6 Discussion and further references. - 8 Group comparisons and hierarchical modeling. - 8.1 Comparing two groups. - 8.2 Comparing multiple groups. - 8.2.1 Exchangeability and hierarchical models. - 8.3 The hierarchical normal model. - 8.3.1 Posterior inference. - 8.4 Example: Math scores in U.S. public schools. - 8.4.1 Prior distributions and posterior approximation. - 8.4.2 Posterior summaries and shrinkage. - 8.5 Hierarchical modeling of means and variances. - 8.5.1 Analysis of math score data. - 8.6 Discussion and further references. - 9 Linear regression. - 9.1 The linear regression model. - 9.1.1 Least squares estimation for the oxygen uptake data. - 9.2 Bayesian estimation for a regression model. - 9.2.1 A semiconjugate prior distribution. - 9.2.2 Default and weakly informative prior distributions. - 9.3 Model selection. - 9.3.1 Bayesian model comparison. - 9.3.2 Gibbs sampling and model averaging. - 9.4 Discussion and further references. - 10 Nonconjugate priors and Metropolis-Hastings algorithms. - 10.1 Generalized linear models. - 10.2 The Metropolis algorithm. - 10.3 The Metropolis algorithm for Poisson regression. - 10.4 Metropolis, Metropolis-Hastings and Gibbs. - 10.4.1 The Metropolis-Hastings algorithm. - 10.4.2 Why does the Metropolis-Hastings algorithm work?. - 10.5 Combining the Metropolis and Gibbs algorithms. - 10.5.1 A regression model with correlated errors. - 10.5.2 Analysis of the ice core data. -

Note: Aus dem Franz. übers.

Note: In kyrill. Schr.

Note: Studying democratic innovations : an analytical framework -- Popular assemblies : from New England town meetings to participatory budgeting -- Mini-publics : assemblies by random selection -- Direct legislation : direct democracy through the ballot box -- E-democracy : the promise of information and communication technology -- Realising the goods of democratic institutions..

Note: Contents: Part 1: Introduction ; Building the Global Adaptation Community ; Part 2: Describing Impacts at the Local Level ; Introduction: Describing Impacts at the Local Level ; Understanding Potential Climate Change Impacts and Adaptation Options in Indian Megacities ; Assessment of Climate Change-Induced Vulnerability to Floods in Hyderabad, India, Using Remote Sensing Data ; The Role of Community Resilience in Adaptation to Climate Change: The Urban Poor in Jakarta, Indonesia ; Ecohealth and Climate Change: Adaptation to Flooding Events in Riverside Secondary Cities, West Africa ; Climate Change and Adaptive Capacity of Women to Water Stress in Urban Centers of Nigeria: Emerging Concerns and Reactions ; Urban Climate Strategies Against Future Heat Stress Conditions ; Climate-Proof Urban Transport Planning: Opportunities and Challenges in Developing Cities ; Part 3: Frameworks for Local Action – Challenges and Proactive Recommendations ; Introduction: Frameworks for Local Action – Challenges and Proactive Recommendations ; Inclusive Adaptation: Linking Participatory Learning and Knowledge Management to Urban Resilience ; Urban Adaptation Planning and Governance: Challenges to Emerging Wisdom ; Urban Climate Change Adaptation in the Context of Transformation: Lessons from Vietnam ; Getting Ready for a Changing Climate: Supporting Councillor’s Leadership Role in Adaptation ; Environmental Learning from the Ivory Tower to the Town Square: The Case of Trondheim, Norway ; Plan B:altic: A Social–Ecological Approach to Climate Change Adaptation ; Governance Recommendations for Adaptation in European Urban Regions: Results from Five Case Studies and a European Expert Survey ; Creating Resilient Cities Through Empowered, Deliberative Participation ; Part 4: Local Strategies and Actions in Response to Climate Change ; Introduction: Local Strategies and Actions in Response to Climate Change ; Comparative Research on the Adaptation Strategies of Ten Urban Climate Plans ; Managing Regional Climate Mitigation and Adaptation Co-benefits and Co-costs ; Interdisciplinary and Multi-institutional Approaches to Climate Change Adaptation ; Climate Adaptation Strategies: Evidence from Latin American City-Regions ; Adaptation in UK Cities: Heading in the Right Direction? ; Finding the Balance: Challenges and Opportunities for Climate Change Adaptation at Different Levels of English Local Government ; Local Strategies for Climate Change Adaptation: Urban Planning Criteria for Municipalities of the Basque Country, Spain ; Climate Change Adaptation in Dutch Municipalities: Risk Perception and Institutional Capacity ; Toward a More Flood Resilient Urban Environment: The Dutch Multi-level Safety Approach to Flood Risk Management ; Climate Change and City Development: Resilience Strategies in Bonn ; Integrated Climate Adaptation in Dresden: Insights from Flood Prevention ; Integrated Climate Protection Program for the City of Chemnitz: Climate Diagnosis, Climate Change Prognosis, and Adaptation Measures in the Urban Area ; Adaptation Strategies for the City of Cape Town: Finding the Balance Within Social-Ecological Complexity ; Sharing the Lagos Megacity Experience in the Integrated Management of Sea Level Rise and Flooding ; Community-Based Vulnerability Assessment: Semarang, Indonesia ; Research News for Climate Compliant Cities: The Case of Ho Chi Minh City, Vietnam ; Building Resilience to Climate Change Through Adaptive Land Use Planning in Ho Chi Minh City, Vietnam ; Climate Change Risk Management for a Suburban Local Government: The Case of Kogarah, Australia ; Climate Change as a Survival Strategy: Soft Infrastructure for Urban Resilience and Adaptive Capacity in Australia’s Coastal Zones ; Curitiba, Brazil: A Model for Resilience in Latin America? ; Part 5: Approaches to Climate Change Adaptation in Cities ; Introduction: Approaches to Climate Change Adaptation in Cities ; Building Resilience to Climate Change in Asian Cities ; Local Vulnerability Assessment of Climate Change and Its Implications: The Case of Gyeonggi-Do, Korea ; Ecosystem-Based Adaptation in the Urban Environment ; Urban Agriculture and Climate Change Adaptation: Ensuring Food Security Through Adaptation ; Cooling the Public Realm: Climate-Resilient Urban Design ; The Role of Transport in Mitigation and Adaptation to Climate Change Impacts in Urban Areas ; Urban Green Spaces: Potentials and Constraints for Urban Adaptation to Climate Change ; Urban Climate Framework: A System Approach Towards Climate Proof Cities ; Part 6: Reality Check – Adaptation on the Ground ; Introduction: Reality Check – Adaptation on the Ground ; Preparing for Climate Change While Advancing Local ; Quito’s Climate Change Strategy: A Response to Climate Change in the Metropolitan District of Quito, Ecuador ; Climate Change Implications for Dhaka City: A Need for Immediate Measures to Reduce Vulnerability ; Adaptation in Practise: Durban, South Africa

Note: Ungezählte Beil. ab 2010: Special , Ersch. jährl. 4x

Note: Contents: Chapter 1: Introduction to the book ; Chapter 2: The nature of qualitative research ; Part I: The design cycle ; Chapter 3: The design cycle ; Chapter 4: Designing participatory research ; Chapter 5: Ethical issues in qualitative research ; Part II: The data collection cycle ; Chapter 6: Sampling and participant recruitment ; Chapter 7: In-depth interviews ; Chapter 8: Focus group discussions ; Chapter 9: Observation ; Part III: The analytic cycle ; Chapter 10: Data preparation and developing codes ; Chapter 11: Textual data analysis ; Chapter 12: From analysis to participatory action ; Chapter 13: Academic writing of qualitative research ; Post Script: Assessing quality in the qualitative research cycle

Note: Content: Preface. - Polar ecosystems in a changing climate. - Ice edge blooms - Migrating oases in polar seas. - Antarctic: Krill has evolved adaptation strategies to its extreme environment. - Living at -20 degrees: why sea Ice algae don't freeze up. - ocean acidification and Iron deficiency affect Antarctic phytoplankton communities. - The oceans are acidifying: spIder crabs and Ice fIsh are feeling the repercussions of climate change. - melting glaciers - Changing coastal ecosystems in the West Antarctic. - In the service of science: elephant seals explore the Southern Ocean. - Ocean Acoustics - palaoa broadcasts live from the Southern Ocean. - When ice shelves disintegrate - diversity of life on the Antarctic seabed. - RV 'Polarstern' in Antarctica - observations in the ice. - deep-sea observatory in the Arctic: Climate change affects life on the ocean floor. - plankton rain in the vicinity of the Arctic HAUSGARTEN: What do sinking particles tell us?. - pelagic research in the Arctic faces new challenges. - fram observatory - live conference with the Arctic deep sea in preparation. - dom - the oceans' molecular memory. - siberian forests moving north - impact on the climate and biodiversity. - promoting young talent: High school pupils learn together with AWI scientists. - dream job- polar scientist - How a student achieved her goal over an icy path. - marIne biosciences in the scientific-societal context of the 21st. century. - Contact persons at the AWI. - Imprint. - geographic locatIons of the research reports of this brochure

Note: Zugleich: Dissertation, Freie Unversität Berlin, [ca. 1963] , INHALTSVERZEICHNIS PROBLEMSTELLUNG UND ZIELSETZUNG 1. BEMERKUNGEN ZUM BEOBACHTUNGSGELÄNDE UND ZUM BEOBACHTUNGSMATERIAL 1.1 Das Beobachtungsgelände 1.2 Das Beobachtungsmaterial 2. HOMOGENITÄTSBETRACHTUNGEN 2.1 Temperatur 2.2 Niederschlag 2.3 Wind 2.4 Sonnenschein und Bewölkung 3. TEMPERATURVERHÄLTNISSE 3.1 Monats- und Jahreswerte 3.2 Tageswerte 3.3 Pentadenwerte 3.4 Häufigkeitsbetrachtungen 3.5 Interdiurne Veränderlichkeit 3.6 Der tägliche Gang 3.7 Vorkommen bestimmter Schwellenwerte 3.71 Frost- und Eistage 3.72 Sommer- und Tropentage 4. DER WASSERGEHALT DER LUFT 4.1 Monats- und Jahreswerte 4.2 Tageswerte 4.3 Häufigkeitsbetrachtungen 4.4 Interdiurne Veränderlichkeit 4.5 Der tägliche Gang 5. BEWÖLKUNGSVERHÄLTNISSE 5.1 Monats- und Jahreswerte 5.2 Tageswerte 5.3 Häufigkeitsbetrachtungen 5.4 Der tägliche Gang 5.5 Heitere und trübe Tage 5.6 Nebel 6. SONNENSCHEIN 6.1 Monats- und Jahreswerte 6.2 Tageswerte 6.3 Der tägliche Gang 7. NIEDERSCHLAGSVERHÄLTNISSE 7.1 Monats- und Jahreswerte 7.2 Niederschlagsbereitschaft 7.3 Tageswerte 7.4 Der tägliche Gang 7.5 Häufigkeitsbetrachtungen 7.6 Niederschlags- und Trockenperioden 7.7 Niederschlag und Wind· 7.8 Schneeverhältnisse 7.81 Schneefall und Schneedecke 7.82 Schneehöhe 7.9 Gewitter 8. WINDVERHÄLTNISSE 8.1 Windrichtung 8.2 Windgeschwindigkeit 8.21 Der jährliche Gang 8.22 Häufigkeitsbetrachtungen 8.23 Sturmtage und Windstillen 8.24 Der tägliche Gang 9.ZUSAMMENFASSUNG VERZEICHNIS DER TEXTTABELLEN VERZEICHNIS DER ABBILDUNGEN LITERATURVERZEICHNIS TABELLENANHANG

Note: Preface 1. Fire and brimstone: how volcanoes work 2. Eruption styles, hazards and ecosystem impacts 3. Volcanoes and global climate change 4. Forensic volcanology 5. Relics, myths and chronicles 6. Killer plumes 7. Human origins 8. The ash-giant/sulphur-dwarf 9. European volcanism in prehistory 10. The rise of Teotihuacan 11. Dark Ages: dark nature? 12. The Haze famine 13. The last great subsistence crisis in the western world 14. Volcanic catastrophe risk Appendix A. Volcano trumps: notable eruptions of the past 10,000 years Appendix B. Further reading Index.

Note: Zugleich: Dissertation, Freie Unversität Berlin, [ca. 1963] , INHALTSVERZEICHNIS PROBLEMSTELLUNG UND ZIELSETZUNG 1. BEMERKUNGEN ZUM BEOBACHTUNGSGELÄNDE UND ZUM BEOBACHTUNGSMATERIAL 1.1 Das Beobachtungsgelände 1.2 Das Beobachtungsmaterial 2. HOMOGENITÄTSBETRACHTUNGEN 2.1 Temperatur 2.2 Niederschlag 2.3 Wind 2.4 Sonnenschein und Bewölkung 3. TEMPERATURVERHÄLTNISSE 3.1 Monats- und Jahreswerte 3.2 Tageswerte 3.3 Pentadenwerte 3.4 Häufigkeitsbetrachtungen 3.5 Interdiurne Veränderlichkeit 3.6 Der tägliche Gang 3.7 Vorkommen bestimmter Schwellenwerte 3.71 Frost- und Eistage 3.72 Sommer- und Tropentage 4. DER WASSERGEHALT DER LUFT 4.1 Monats- und Jahreswerte 4.2 Tageswerte 4.3 Häufigkeitsbetrachtungen 4.4 Interdiurne Veränderlichkeit 4.5 Der tägliche Gang 5. BEWÖLKUNGSVERHÄLTNISSE 5.1 Monats- und Jahreswerte 5.2 Tageswerte 5.3 Häufigkeitsbetrachtungen 5.4 Der tägliche Gang 5.5 Heitere und trübe Tage 5.6 Nebel 6. SONNENSCHEIN 6.1 Monats- und Jahreswerte 6.2 Tageswerte 6.3 Der tägliche Gang 7. NIEDERSCHLAGSVERHÄLTNISSE 7.1 Monats- und Jahreswerte 7.2 Niederschlagsbereitschaft 7.3 Tageswerte 7.4 Der tägliche Gang 7.5 Häufigkeitsbetrachtungen 7.6 Niederschlags- und Trockenperioden 7.7 Niederschlag und Wind· 7.8 Schneeverhältnisse 7.81 Schneefall und Schneedecke 7.82 Schneehöhe 7.9 Gewitter 8. WINDVERHÄLTNISSE 8.1 Windrichtung 8.2 Windgeschwindigkeit 8.21 Der jährliche Gang 8.22 Häufigkeitsbetrachtungen 8.23 Sturmtage und Windstillen 8.24 Der tägliche Gang 9.ZUSAMMENFASSUNG VERZEICHNIS DER TEXTTABELLEN VERZEICHNIS DER ABBILDUNGEN LITERATURVERZEICHNIS TABELLENANHANG

Note: Contents: Continuous Path Processes ; Continuous-Path Random Processes: Mathematical Prerequisites ; Basic Concepts and Examples in Finance ; Hitting Times: A Mix of Mathematics and Finance ; Complements on Brownian Motion ; Complements on Continuous Path Processes ; A Special Family of Diffusions: Bessel Processes ; Jump Processes ; Default Risk: An Enlargement of Filtration Approach ; Poisson Processes and Ruin Theory ; General Processes: Mathematical Facts ; Mixed Processes ; Lévy Processes

Note: Contents: 1 Hinweise zu Markt und Ökonomie ; 2 Soziale Marktwirtschaft – Die Wurzel des ökosozialen Marktparadigmas ; 3 Das ökosoziale Paradigma – 1975 bis 2000 ; 4 Das ökosoziale Paradigma – die Zeit ab 2000 ; 5 Marktfundamentalismus – Viele Fragezeichen ; 6 Das Konzept der Planetengrenze – Ein ökosozialer Ansatz ; 7 Weltfinanzsystem und Klimafrage – »Freie Märkte« führen ins Desaster ; 8 Wohlstand und Nachhaltigkeit – Die ökosoziale Fundamentalidentität ; 9 Soziale Balance schafft Akzeptanz und den höchsten Wohlstand ; 10 Was droht, wenn die ökosoziale Wende nicht gelingt? ; 11 Global Marshall Plan – Schritte in die richtige Richtung ; 12 Ökosoziales Paradigma, Wachstumserfordernisse, doppelter Faktor 10 ; 13 Ökosoziale Marktwirtschaft als Zukunftsmodell – Die Antwort auf die Krise ; 14 Ökosoziale Marktwirtschaft – Wichtige Merkmale ; 15 Gibt es Hoffnung?

Note: ОГЛАВЛЕНИЕ Предисловие Глава 1. СОВРЕМЕННЫЕ ЗАКОНОМЕРНОСТИ РАСПРОСТРАНЕНИЯ ВЕЧНОЙ МЕРЗЛОТЫ (КРИОЛИТОЗОНЫ) КАК СЛЕДСТВИЕ СОВРЕМЕННОГО КЛИМАТА 1.1. Общие закономерности распространения мерзлоты 1.2. Внутрирегиональные закономерности распространения мерзлоты 1.2.1. Теплообмен между горными породами и атмосферой. Годовой тепловой баланс 1.2.2. Тепловой баланс земной поверхности и криолитозона Забайкалья 1.2.3. Тепловой баланс земной поверхности и криолитозона Западной Сибири Глава 2. СОВРЕМЕННЫЕ ПРЕДСТАВЛЕНИЯ О ГЛОБАЛЬНЫХ ИЗМЕНЕНИЯХ КЛИМАТА И ИХ ПРИЧИНАХ 2.1. Изменения климата под влиянием естественных факторов 2.2. Изменения климата под влиянием антропогенных факторов Глава 3. ДИНАМИКА КРИОЛИТОЗОНЫ КАК СЛЕДСТВИЕ ГЛОБАЛЬНЫХ ИЗМЕНЕНИЙ КЛИМАТА 3.1. Реакция вечной мерзлоты на изменения климата. Проникновение колебаний температуры воздуха в горные породы 3.2. Реакция мерзлоты на изменения климата в плейстоцене 3.3. Реакция мерзлоты на современные изменения климата 3.4. Влияние климата и его изменений на криогенные процессы 3.5. Влияние климата и его изменений на устойчивость ландшафтов криолитозоны к техногенным нагрузкам 3.6. Влияние колебаний климата на субгляциальную криолитозону Заключение Литература ПРИЛОЖЕНИЕ 1. Таблица. Средние многолетние данные метеорологических наблюдений в Забайкалье ПРИЛОЖЕНИЕ 2. Графики. Средняя месячная и средняя годовая температура грунта на склонах Центрального Забайкалья. Режимные измерения в скважинах ПРИЛОЖЕНИЕ 3. Графики. Средняя месячная и средняя годовая температура грунта в долинах рек Центрального Забайкалья. Режимные измерения в скважинах ПРИЛОЖЕНИЕ 4. Графики. Средняя месячная и средняя годовая температура грунта в Восточном Забайкалье. Режимные измерения в скважинах ПРИЛОЖЕНИЕ 5. Графики. Средняя месячная и средняя годовая температура грунта в Юго-Восточном Забайкалье. Наблюдения в скважинах ПРИЛОЖЕНИЕ 6. Таблица. Тепловой баланс поверхности и его составляющие для Западной Сибири ПРИЛОЖЕНИЕ 7. Таблица. Радиационный баланс на склонах Западной Сибири ПРИЛОЖЕНИЕ 8. Словарь терминов ПРИЛОЖЕНИЕ 9. Предметный указатель

Note: Zugl.: Marburg (Lahn), Univ., Habil.-Schr., 2004 u.d.T.: Gutmann, Mathias: Die Medialität des Erfahrens

Note: Contents Preface Editor Contributors Chapter 1 Sampling and Sample Treatments / Oliver Wurl Chapter 2 Analysis of Dissolved and Particulate Organic Carbon with the HTCO Technique / Oliver Wurl and Tsai Min Sin Chapter 3 Spectrophotometric and Chromatographic Analysis of Carbohydrates in Marine Samples / Christos Panagiotopoulos and Oliver Wurl Chapter 4 The Analysis of Amino Acids in Seawater / Thorsten Dittmar, Jennifer Cherrier, and Kai-Uwe Ludwichowski Chapter 5 Optical Analysis of Chromophoric Dissolved Organic Matter / Norman B. Nelson and Paula G. Coble Chapter 6 Isotope Composition of Organic Matter in Seawater / Laodong Guo and Ming-Yi Sun Chapter 7 Determination of Marine Gel Particles / Anja Engel Chapter 8 Nutrients in Seawater Using Segmented Flow Analysis / Alain Aminot, Roger Kérouel, and Stephen C. Coverly Chapter 9 Dissolved Organic and Particulate Nitrogen and Phosphorous / Gerhard Kattner Chapter 10 Pigment Applications in Aquatic Systems / Karen Helen Wiltshire Chapter 11 Determination of DMS, DMSP, and DMSO in Seawater / Jacqueline Stefels Chapter 12 Determination of Iron in Seawater / Andrew R. Bowie and Maeve C. Lohan Chapter 13 Radionuclide Analysis in Seawater / Mark Baskaran, Gi-Hoon Hong, and Peter H. Santschi Chapter 14 Sampling and Measurements of Trace Metals in Seawater / Sylvia G. Sander, Keith Hunter, and Russell Frew Chapter 15 Trace Analysis of Selected Persistent Organic Pollutants in Seawater / Oliver Wurl Chapter 16 Pharmaceutical Compounds in Estuarine and Coastal Waters / John L. Zhou and Zulin Zhang Appendix A: First Aid for Common Problems with Typical Analytical Instruments Appendix B: Chemical Compatibilities and Physical Properties of Various Materials Appendix C: Water Purification Technologies

Note: Contents Contents Preface Acknowledgements Part 1: Making Sediment Introduction Clastic sediment as a chemical and physical breakdown product 1.1 Introduction: clastic sediments—'accidents' of weathering 1.2 Silicate minerals and chemical weathering 1.3 Solute flux: rates and mechanisms of silicate chemical weathering 1.4 Physical weathering 1.5 Soils as valves and filters for the natural landscape 1.6 Links between soil age, chemical weathering and weathered-rock removal 1.7 Provenance: siliciclastic sediment-sourcing Further reading 2 Carbonate, siliceous, iron-rich and evaporite sediments 2.1 Marine vs. freshwater chemical composition and fluxes 2.2 The calcium carbonate system in the oceans 2.3 Ooid carbonate grains 2.4 Carbonate grains from marine plants and animals 2.5 Carbonate muds, oozes and chalks 2.6 Other carbonate grains of biological origins 2.7 Organic productivity, sea-level and atmospheric controls of biogenic CaCO3 deposition rates 2.8 CaCO3 dissolution in the deep ocean and the oceanic CaCO3 compensation mechanism 2.9 The carbonate system on land 2.10 Evaporite salts and their inorganic precipitation as sediment 2.11 Silica and pelagic plankton 2.12 Iron minerals and biomineralizers 2.13 Desert varnish 2.14 Phosphates 2.15 Primary microbial-induced sediments: algal mats and stromatolites Further reading 3 Sediment grain properties 3.1 General 3.2 Grain size 3.3 Grain-size distributions 3.4 Grain shape and form 3.5 Bulk properties of grain aggregates Further reading Part 2: Moving Fluid Introduction 4 Fluid basics 4.1 Material properties of fluids 4.2 Fluid kinematics 4.3 Fluid continuity with constant density 4.4 Fluid dynamics 4.5 Energy, mechanical work and power Further reading 5 Types of fluid motion 5.1 Osborne Reynolds and flow types 5.2 The distribution of velocity in viscous flows: the boundary layer 5.3 Turbulent flows 5.4 The structure of turbulent shear flows 5.5 Shear flow instabilities, flow separation and secondary currents 5.6 Subcritical and supercritical flows: the Froude number and hydraulic jumps 5.7 Stratified flow generally 5.8 Water waves 5.9 Tidal flow—long-period waves Further reading Part 3: Transporting Sediment Introduction 6 Sediment in fluid and fluid flow—general 6.1 Fall of grains through stationary fluids 6.2 Natural flows carrying particulate material are complex 6.3 Fluids as transporting machines 6.4 Initiation of grain motion 6.5 Paths of grain motion 6.6 Categories of transported sediment 6.7 Some contrasts between wind and water flows 6.8 Cohesive sediment transport and erosion 6.9 A warning: nonequilibrium effects dominate natural sediment transport systems 6.10 Steady state, deposition or erosion: the sediment continuity equation and competence vs. capacity Further reading 7 Bedforms and sedimentary structures in flows and under waves 7.1 Trinity of interaction: turbulent flow, sediment transport and bedform development 7.2 Water-flow bedforms 7.3 Bedform phase diagrams for water flows 7.4 Water flow erosional bedforms on cohesive beds 7.5 Water wave bedforms 7.6 Combined flows: wave-current ripples and hummocky cross-stratification 7.7 Bedforms and structures formed by atmospheric flows Further reading 8 Sediment gravity flows and their deposits 8.1 Introduction 8.2 Granular flows 8.3 Debris flows 8.4 Turbidity flows 8.5 Turbidite evidence for downslope transformation from turbidity to debris flows Further reading 9 Liquefaction, fluidization and sliding sediment deformation 9.1 Liquefaction 9.2 Sedimentary structures formed by and during liquefaction 9.3 Submarine landslides, growth faults and slumps 9.4 Desiccation and synaeresis shrinkage structures Further reading Part 4: Major External Controls on Sedimentation and Sedimentary Environments Introduction 10 Major external controls on sedimentation 10.1 Climate 10.2 Global climates: a summary 10.3 Sea-level changes 10.4 Tectonics 10.5 Sediment yield, denudation rate and the sedimentary record Further reading Part 5: Continental Sedimentary Environments Introduction 11 Rivers 11.1 Introduction 11.2 River networks, hydrographs,patterns and long profiles 11.3 Channel form 11.4 Channel sediment transport processes, bedforms and internal structures 11.5 The floodplain 11.6 Channel belts, alluvial ridges and avulsion 11.7 River channel changes, adjustable variables and equilibrium 11.8 Alluvial architecture: product of complex responses 11.9 Alluvial architecture: scale, controls and time Further reading 12 Subaerial Fans: Alluvial and Colluvial 12.1 Introduction 12.2 Controls on the size (area) and gradient of fans 12.3 Physical processes on alluvial fans 12.4 Debris-flow-dominated alluvial fans 12.5 Stream-flow-dominated alluvial fans 12.6 Recognition of ancient alluvial fans and talus cones Further reading 13 Aeolian Sediments in Low-Latitude Deserts 13.1 Introduction 13.2 Aeolian system state 13.3 Physical processes and erg formation 13.4 Erg margins and interbedform areas 13.5 Erg and draa evolution and sedimentary architecture 13.6 Erg construction, stasis and destruction: climate and sea-level controls 13.7 Ancient desert facies Further reading 14 Lakes 14.1 Introduction 14.2 Lake stratification 14.3 Clastic input by rivers and the effect of turbidity currents 14.4 Wind-forced physical processes 14.5 Temperate lake chemical processes and cycles 14.6 Saline lake chemical processes and cycles 14.7 Biological processes and cycles 14.8 Modern temperate lakes and their sedimentary facies 14.9 Lakes in the East African rifts 14.10 Lake Baikal 14.11 The succession of facies as lakes evolve 14.12 Ancient lake facies Further reading 15 Ice 15.1 Introduction 15.2 Physical processes of ice flow 15.3 Glacier flow, basal lubrication and surges 15.4 Sediment transport, erosion and deposition by flowing ice 15.5 Glacigenic sediment: nomenclature and classification 15.6 Quaternary and modern glacial environments and facies 15.7 Ice-produced glacigenic erosion and depositional facies on land and in the periglacial realm 15.8 Glaciofluvial processes on land at and within the ice-front 15.9 Glacimarine environments 15.10 Glacilacustrine environments 15.11 Glacial facies in the pre-Quaternary geological record: case of Cenozoic Antarctica Further reading Part 6: Marine Sedimentary Environments Introduction 16. Estuaries 16.1 Introduction 16.2 Estuarine dynamics 16.3 Modern estuarine morphology and sedimentary environments 16.4 Estuaries and sequence stratigraphy Further reading 17. River and Fan Deltas 17.1 Introduction to river deltas 17.2 Basic physical processes and sedimentation at the river delta front 17.3 Mass movements and slope failure on the subaqueous delta 17.4 Organic deposition in river deltas 17.5 River delta case histories 17.6 River deltas and sea-level change 17.7 Ancient river delta deposits 17.8 Fan deltas Further reading 18. Linear Siliciclastic Shorelines 18.1 Introduction 18.2 Beach processes and sedimentation 18.3 Barrier-inlet-spit systems and their deposits 18.4 Tidal flats, salt marsh and chenier ridges 18.5 Ancient clastic shoreline facies Further reading 19 Siliciclastic Shelves 19.1 Introduction: shelf sinks and lowstand bypass 19.2 Shelf water dynamics 19.3 Holocene highstand shelf sediments: general 19.4 Tide-dominated, low river input, highstand shelves 19.5 Tide-dominated, high river input, highstand shelves 19.6 Weather-dominated highstand shelves Further reading 20 Calcium-carbonate-evaporite Shorelines, Shelves and Basins 20.1 Introduction: calcium carbonate 'nurseries' and their consequences 20.2 Arid carbonate tidal flats, lagoons and evaporite sabkhas 20.3 Humid carbonate tidal flats and marshes 20.4 Lagoons and bays 20.5 Tidal delta and margin-spillover carbonate tidal sands 20.6 Open-shelf carbonate ramps 20.7 Platform margin reefs and carbonate build-ups 20.8 Platform margin slopes and basins 20.9 Carbonate sediments, cycles and sea-level change 20.10 Displacement and destruction of carbonate environments: silicicl

Note: The Sun. The formation of the stars and the Sun ; The characteristics of the Sun ; A representation of the Sun ; The internal structure of the Sun ; The photosphere, solar radiation, the solar wind ; The thermal profile of the solar atmosphere ; Solar dynamics ; The Sun: the source of space weather -- The Earth. The Earth within the solar system ; The internal structure of the Earth : the geomagnetic field ; The atmosphere of the Earth ; The magnetosphere -- Toward a space weather. The consequences of solar agressions on our technological environment ; Other impacts of solar activity ; Space weather in order to forecast -- Appendices..

Note: Zugl.: Zürich, Eidgenössische Techn. Hochsch., Diss., 2006, No. 16474