ALBERT

Note: Inhaltsverzeichnis Vorwort Einleitung Die Erde als globales System Die Bausubstanz Einleitung Die Atmosphäre Die Hydrosphäre Die Kryosphäre Die Geosphäre Die Biosphäre Kreisläufe Einleitung Der Wasserkreislauf Bio-geochemische Kreisläufe Natürliche Veränderungen Einleitung Maßgebliche Veränderungen in unterschiedlichen Zeitskalen Die Folgen der zivilisatorischen Entwicklung Signale einer gestörten Natur Einleitung Die veränderte Umwelt Das Problem der wachsenden Weltbevölkerung Die Weit von Morgen Einleitung Klimamodelle und ihre Grenzen Leben in einem Treibhaus Forschung auf der Suche nach Spuren und Lösungen Die Herausforderung an die Wissenschaft Einleitung Leitlinien für ein Programm zur Erforschung globaler Veränderungen Wissenschaft und Politik greifen die Herausforderung auf: Internationale und nationale Forschungsprogramme Einleitung Internationale Ansätze Beiträge zur Global Change Thematik im Rahmen nationaler Projekte der Bundesrepublik Deutschland Quellenverzeichnis: Abbildungen

Note: TABLE OF CONTENTS Preface Chapter 1. The CO2-Carbonic Acid System and Solution Chemistry Basic Concepts Activity Coefficients in Solutions Influences of Temperature and Pressure The Carbonic Acid System in Seawater Calculation of the Saturation State of Seawater with Respect to Carbonate Minerals Concluding Remarks Chapter 2. Interactions Between Carbonate Minerals and Solutions Sedimentary Carbonate Minerals Basic Concepts Characteristics of Sedimentary Carbonate Minerals Solubility Behavior of Carbonate Minerals General Considerations Calcite and Aragonite Solubility Methods for the Calculation of Equilibrium Solution Composition Under Different Conditions Surface Chemistry of Carbonate Minerals Basic Principles Adsorption of Ions on Carbonate Surfaces Carbonate Dissolution and Precipitation Kinetics Basic Principles Reaction Kinetics in Simple Solutions Reaction Kinetics in Complex Solutions Concluding Remarks Chapter 3. Coprecipitation Reactions and Solid Solutions of Carbonate Minerals General Concepts Background Information Basic Chemical Considerations Coprecipitation of "Foreign" Ions in Carbonate Minerals Examples of Coprecipitation Reactions General Models for Partition Coefficients in Carbonates Magnesian Calcite General Considerations The Fundamental Problems Experimental Observations Hypothesis of a Hydrated Magnesian Calcite Stable Isotope Chemistry General Considerations Oxygen Isotopes Carbon Stable Isotopes Concluding Remarks Chapter 4. The Oceanic Carbonate System and Calcium Carbonate Accumulation in Deep Sea Sediments An Overview of Major Processes The CO2 System in Oceanic Waters The Upper Ocean The Deep Sea Saturation State of Deep Seawater with Respect to CaCO3 Sources and Sedimentation of Deep Sea Carbonates Sources Sedimentation The Distribution of CaCO3 in Deep Sea Sediments and Carbonate Lithofacies General Considerations The Distribution of CaCO3 in Surface Sediments Factors Controlling the Accumulation of Calcium Carbonate in Deep Sea Sediments General Relations Factors Leading to Variability Near Interfacial Processes Variability of Calcium Carbonate Deposition in Deep Sea Sediments with Time Influence of Glacial Times The Impact of Fossil Fuel CO2 on the Ocean-Carbonate System Concluding Remarks Chapter 5. Composition and Source of Shoal-Water Carbonate Sediments Introduction Shoal-Water Carbonates in Space and Time Carbonate Grains and Skeletal Parts Overview and Examples Sediment Classification Depositional Environments Concluding Statement Biomineralization General Aspects Environmental Controls on Mineralogy Stable Isotopes Coprecipitation Precipitation of Carbonates from Seawater Carbonate Chemistry of Shallow Seawater Abiotic Precipitation of CaCO3 from Seawater Sources of Aragonite Needle Muds Formation of Oöids Concluding Remarks 238 Chapter 6. Early Marine Diagenesis of Shoal-Water Carbonate Sediments Introduction Some Preliminary Thermodynamic and Kinetic Considerations Very Early Diagenesis Major Diagenetic Processes Pore Water Chemistry Precipitation of Early Carbonate Cements Dissolution of Carbonates Concluding Remarks Chapter 7. Early Non-Marine Diagenesis of Sedimentary Carbonates Introduction Plate-Tectonic Controls on Diagenesis General Considerations for Early Non-Marine Diagenesis Major Types of Non-Marine Environments Water Chemistry Reactivity of Sedimentary Carbonates Major Phase Transformations The Transformation of Aragonite to Calcite Dolomite Formation Summary Remarks Mass Transfer During Diagenesis General Considerations Geochemical Constraints on Mass Transfer Beachrock Formation Lithification in the Meteoric Environment Introduction The Meteoric Environment and Cement Precipitates Bermuda: A Case Study of a Meteoric Diagenetic Environment Introduction Geological Framework Limestone Chemistry and Isotopic Composition Water Chemistry Carbonate Mass Transfer A Brief Synthesis of Meteoric Diagenesis Diagenetic Stages Effect of Original Mineralogy Climatic Effects Rock-Water Relationships Mixed Meteoric-Marine Regime Concluding Remarks Chapter 8. Carbonates as Sedimentary Rocks in Subsurface Processes Introduction P,T, and X and Carbonate Mineral Stability Subsurface Water Chemistry in Sedimentary Basins Continuous Processes Pressure Solution Dolomitization Mud to Spar Neomorphism Secondary Porosity Cementation in the Subsurface Examples of "Models" of Long-Term Diagenesis The Present Ocean Setting The Present Continental Setting Concluding Remarks Chapter 9. The Current Carbon Cycle and Human Impact Introduction Modern Biogeochemical Cycle of Carbon A Model for the Cycle of Carbon Methane and Carbon Monoxide Fluxes CO2 Fluxes Human Impact on Carbon Fluxes The Fossil Fuel and Land Use Fluxes Observed Atmospheric CO2 Concentration Increase Future'Atmospheric CO2 Concentration Trends Consequences of Increased Atmospheric CO2 Levels The Oceanic System Sources of Calcium, Magnesium, and Carbon for Modern Oceans Mass Balance of Ca, Mg, and C in Present Oceans Oceanic Mass Balance of Elements Interactive with Ca, Mg, and C Concluding Remarks Chapter 10. Sedimentary Carbonates in the Evolution of Earth's Surface Environment Introduction Sedimentary Rock Mass-Age Distributions Secular Trends in Sedimentary Rock Properties Lithologic Types Chemistry and Mineralogy Carbon Cycling Modeling Introduction and Development of a Global Model Glacial-Interglacial Changes of Carbon Dioxide Long-Term Changes of Atmospheric CO2 Phanerozoic Cycling of Sedimentary Carbonates Synopsis of the Origin and Evolution of the Hydrosphere-Atmosphere-Sedimentary Lithosphere Origin of the Hydrosphere The Early Stages The Transitional Stage Modern Conditions Concluding Remarks Epilogue Introduction The Road Traveled The State of the Art Ever Onward References Index

Note: Ersch. unregelmäßig , Beiträge teilweise in Englisch

Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..

Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.

Note: Univ., Diss., Hohenheim, 2009

Note: The basics -- Matching, covering and packing -- Connectivity -- Planar graphs -- Colouring -- Flows -- Extremal graph theory -- Infinite graphs -- Ramsey theory for graphs -- Hamilton cycles -- Random graphs -- Minors, trees, and WQO..

Note: Text dt. und engl.

Note: Text dt. und engl. - Text in Faltbl. [1] dt.

Note: Berlin, Humboldt-Univ., Diss., 2011

Note: Chinese and English.

Note: Table of Contents: EXECUTIVE SUMMARY. - KEY FINDINGS. - 1 INTRODUCTION. - 1.1 Background. - 1.2 The Circumpolar Arctic Coast. - 1.3 Rationale. - 1.4 Objectives and Organization of the Report. - 2 STATE OF THE ARCTIC COAST 2010 – A Thematic Assessment2.1. Physical State of the Circum-Arctic Coast. - 2.2. Ecological State of the Circum-Arctic Coast. - 2.3 Social, Economic and Institutional State of the Circum-Arctic Coast. - 3 INTEGRATED ASSESSMENT AND RESPONSE TO ARCTIC COASTAL CHANGE. - 3.1 Integrated Approaches to Coastal Change in the Arctic. - 3.2 Monitoring, Detecting and Modelling Coastal Change. - 3.3 Vulnerability, Adaptation, Adaptive Capacity and Resilience. - 3.4 Governance and Adaptation. - 4 SYNTHESIS AND FUTURE DIRECTION. - 4.1 Introduction. - 4.2 ICARP-II Science Plans. - 4.3 Knowledge Gaps and Research Priorities . - 4.4 Building a Road Map to Integrated Coastal Systems Research in the Arctic. - 4.5 Summary Discussion. - 5 REFERENCES. - List of Contributors. - Acknowledgements.

Note: Zugl.: Frankfurt (Main), Univ., Diss., 1990

Note: Inhaltsverzeichnis: 1 Einleitung. - 1.1 Entwicklung der Sprache FORTRAN 77. - 1.2 Erzeugung von ausführbaren Programmen. - 1.3 Bemerkungen zur Notation. - 2 Programmiertechniken. - 2.1 Programmplanung. - 2.2 Qualitätsanforderungen. - 3 Grundelemente von FORTRAN 77. - 3.1 Grundsymbole und Bezeichner. - 3.2 Aufbau eines FORTRAN 77-Programms. - 3.2.1 Aufbau einer Programmeinheit. - 3.2.2 Codierung einer Programmzeile. - 3.2.3 Beispiele zu den einzelnen Zeilenarten. - 3.3 Die Standardtypen. - 3.3.1 Der Standardtyp INTEGER. - 3.3.2 Der Standardtyp REAL. - 3.3.3 Der Standardtyp DOUBLE PRECISION. - 3.3.4 Der Standardtyp COMPLEX. - 3.3.5 Der Standardtyp LOGICAL. - 3.3.6 Der Standardtyp CHARACTER. - 3.3.7 Der Zeichenkettentyp. - 3.4 Variablen der Standardtypen. - 3.4.1 Vorbemerkungen. - 3.4.2 Vereinbarungen. - 3.4.3 Typ Vereinbarungen. - 3.4.4 Konstantendefinitionen. - 3.4.5 Vereinbarung von Feldern. - 3.5 Ausdrücke in den Standardtypen. - 3.5.1 Allgemeine Regeln zur Formelauswertung. - 3.5.2 Arithmetischer Ausdruck. - 3.5.3 Logischer Ausdruck. - 3.5.4 Zeichenkettenausdruck. - 3.5.5 Einschränkungen für die Standardfunktionen. - 3.5.6 Beispiel zur Darstellung von Ausdrücken. - 4 Elementare Anweisungen. - 4.1 Statisches und dynamisches Programmende. - 4.2 Wertzuweisungen. - 4.3 Bedingte Anweisungen. - 4.3.1 Die logische IF-Anweisung. - 4.3.2 Die Block-IF-Anweisung. - 4.4 Sprunganweisungen. - 4.4.1 Einfache Sprunganweisung. - 4.4.2 Arithmetische IF-Anweisung. - 4.4.3 Berechnete Sprunganweisung. - 4.4.4 Gesetzte Sprunganweisung. - 4.4.5 Markenzuweisung. - 4.5 Ein-/Ausgabeanweisungen. - 4.5.1 Die READ-Anweisung. - 4.5.2 Die WRITE-Anweisung. - 4.5.3 Die PRINT-Anweisung. - 4.6 Schleifen. - 4.7 Programmbeispiele. - 4.7.1 Elektrischer Widerstand eines Leiters. - 4.7.2 Impedanz einer RL-Reihenschaltung. - 4.7.3 Reihenentwicklung einer Funktion. - 4.7.4 Berechnung der Zahl e. - 4.7.5 Lösung einer quadratischen Gleichung. - 4.7.6 Berechnungen zum schiefen Wurf. - 5 Unterprogramme. - 5.1 Formelfunktionen. - 5.2 Functions. - 5.3 Subroutines. - 5.4 Bemerkungen zur Unterprogrammtechnik. - 6 Ein-/Ausgabeformate. - 6.1 Formate für numerische Daten. - 6.1.1 Formate für Variablen vom Typ INTEGER. - 6.1.2 Formate für Festpunktdarstellung. - 6.1.3 Formate für Gleitpunktdarstellung. - 6.1.4 Formate für normierte Festpunktdarstellung. - 6.1.5 Formate für Variablen vom Typ COMPLEX. - 6.2 Formate für nichtnumerische Daten. - 6.2.1 Formate für Variablen vom Typ LOGICAL. - 6.2.2 Formate für Zeichenketten. - 6.2.3 Weitere Formatierungsmöglichkeiten. - 6.3 Hinweise zu den Formatvereinbarungen. - 7 Speicherplatzverwaltung. - 7.1 Grundüberlegungen. - 7.2 Datenaustausch. - 7.3 Initialisierung von Variablen. - 7.3.1 Die DATA-Anweisung. - 7.3.2 BLOCK DATA-Programmeinheiten. - 8 Dateiverwaltung. - 8.1 Zugriff auf externe Dateien. - 8.2 Die OPEN-Anweisung. - 8.3 Die CLOSE-Anweisung. - 8.4 Schreiben und Lesen von externen Dateien. - 8.5 Positionierung sequentieller Dateien. - 8.6 Ermitteln von Dateieigenschaften. - 8.7 Interne Dateien. - 9 Ergänzungen zur Programmierung. - 9.1 Spracherweiterungen. - 9.1.1 Strukturanweisungen. - 9.1.2 Erweiterte Vereinbarungen. - 9.1.3 Sonstige Erweiterungen. - 9.1.4 Zusätzliche Functions. - 9.1.5 Zusätzliche Subroutines. - 9.2 Geplante Spracherweiterungen. - 9.3 Häufige Fehler. - 9.3.1 Fehlermeldungen des Compilers. - 9.3.2 Fehlermeldungen des Betriebssystems. - 9.4 Änderungen zu FORTRAN IV. - A Ausgewählte Beispiele. - A.1 Inversion einer Zeichenkette. - A.2 Häufigkeit eines Zeichens. - A.3 Dateistatistik. - A.4 Umwandlung von Zeichenfolgen. - A.5 Darstellung eines Funktionsgraphen. - A.6 Numerische Integration. - A.7 Sprungantwort eines PID-Reglers. - B Übersicht über die FORTRAN 77-Anweisungen.

Note: Thinking differently for an age of complexity -- How can theory improve practice? -- Stories from the field -- The praxis of collaboration -- Dialogue as a community of inquiry -- Knowledge into action : the role of dialogue -- Using local knowledge for justice and resilience -- Beyond collaboration : democratic governance for a resilient society..

Note: Planetary magnetism : foreword / A. Balogh ... [et al.] -- Space exploration of planetary magnetism / N.F. Ness -- Planetary magnetic field measurements : missions and instrumentation / A. Balogh -- Current systems in planetary magnetospheres and ionospheres / W. Baumjohann ... [et al.] -- Separation of the magnetic field into external and internal parts / N. Olsen, K.-H. Glassmeir, X. Jia -- The magnetic field of planet Earth / G. Hulot ... [et al.] -- Crustal magnetic fields of terrestrial planets / B. Langlais ... [et al.] -- Magnetic fields of the outer planets / C.T. Russell, M.K. Dougherty -- Magnetic fields of the satellites of Jupiter and Saturn / X. Jia ... [et al.] -- The magnetic field of mercury / B.J. Anderson ... [et al.] -- Paleomagnetic records of meteorites and early planetesimal differentiation / B.P. Weiss ... [et al.] -- Induced magnetic fields in solar system bodies / J. Saur, f.M. Neubauer, K.-H. Glassmeier -- The interior structure, composition, and evolution of giant planets / J.J. Fortney, N. Nettelmann -- Thermal evolution and magnetic field generation in terrestrial planets and satellites / D. Breuer, S. Labrosse, T. Spohn -- Theory and modeling of planetary dynamos / J. Wicht, A. Tilgner -- Laboratory dynamo experiments / G. Verhille ... [et al.] -- Dynamo scaling laws and applications to the planets / U.R. Christensen -- The solar dynamo / C.A. Jones, M.J. Thompson, S.M. Tobias -- Dynamo models for planets other than Earth / S. Stanley, G.A. Glatzmaier -- Planetary magnetic fields : achievements and prospects / D.J. Stevenson..

Note: SUMARIO: Presentación. - Hidrografía al borde del hielo entre las islas Elefante y las Orcadas del Sur durante el verano austral 1988- 1989 / F. G. Figueiras y F. F. Pérez. - Hidrografía de Admiralty Bay, isla King George, Antártida, al comienzo del verano austral de 1988-1989 / R. Prego, F. F. Pérez y F. G. Figueiras. - Saruracrón de oxigeno disuelto en las aguas Investigadas durante la campaña "Antártida 8611" / A. Alvarez Meneses. - Peces capturados durante la campaña "Antártida 8611" / J. Matallanas. - Edad y crecimiento de Notothenia gibberifrons (Lönnberg, 1905), en Georgia del Sur / M. T. García Santamaría y E. Balguerias. - Algunos datos sobre la distribución, abundancia y biología de Patagonotothen brevicauda guntheri (Norman, 1937) en Shag Rocks / E. Balguerias y M. E. Quintero. - Dos nuevas especies de picnogónidos antárticos / T. Munilla. - Distribución espacial del Krill (Euphasia superba; Dana, 1852), obtenida durante la campaña "Antártida 8611" / l. Sobrino. - Análisis de los porcentajes de hembras fecundadas de Krill (Euphasia superba; Dana, 1852), obtenidos durante la campaña "Antártida 8611" / I. Sobrino. - Primeros datos sobre la flora y vegetación liquénica de isla Livingston (islas Shetland del Sur, Antártida) / L. G. Sancho, L. Kappen y B. Schroeter. - lnvestigaciones ecofisiológicas en líquenes antárticos. Primeros datos sobre la actividad fotosintética de líquenes crustáceos "in situ" / L. Kappen, B Schroeter y L. G. Sancho. - Microclima y fotosíntesis neta de Usnea antarctica a partir de mediciones realizadas "in situ" en isla Livingston (islas Shetland del Sur, Antártida) / B. Schroeter, L. Kapen y L. G. Sancho. - Notas acerca de una colonia de nidificación de Cormoran carunculado del Antártico (Phalacrocorax atriceps) en Bahía Paraíso (península Antartrca) / J. Curt y A . Fernández Riestra. - Observación de cinco cisnes de cuello negro (Cygnus melanocoryphus) en la zona del Tratado Antártico / J. Curt. - Catálogo de ceráceos, pinnípedos y aves observados desde el buque oceanográfico "Las Palmas" durante las navegaciones efectuadas en la zona del Tratado Antártico y en sus destacamentos de las islas Shetland del Sur y estrecho de Bransfiel (25-I-89 a 1-III-89) / J. Curt. - Foraminíferos, biofacies e hidrodinámica sedimentaria en la Antártida / G. Mateu. - Actividad antimicrobiana de un nuevo monoterpeno del Plocamium cartilagineum de la península Antártica / J. Rovirosa, L. Sánchez, Y. Palacios, J. Darías y A. San Martín. - Aspectos taxonómicos de bacterias aisladas en la isla Livingston durante la campaña 1986-1987 / N. Bozal, J. G. Loren y J. Guinea. - Observaciones de NO2 y ozono en el interíor del Vértice Polar Antártico / M. Gil, J. Cacho, L. Acedo y M. J. Sainz de Aja. - Condiciones meteorológicas del agujero del ozono en la Antártida / J. M. Cisneros. - Altos valores de humedad relativa medidos en la estratosfera antártica / J . M. Cisneros. - Aproximación al estudio de fenómenos micrometeorológicos en la isla Decepción / J . Vira, M. Ramos y M. R. Soler. - Las campañas 1987-1988, 1988-1989 al sur del mar de Brandsfield. Resultados científicos / M. Catalán. - Las campañas geodésicas 1987- 1988, 1988-1989 en las Shetland del Sur / J. Ballesteros, M. Berrocoso, M. Catalán, F. Cruz. R. Estrada. J. M. Fernández López, A. Luján, J. Muñoz, J. Sánchez del Toro, J. C. Sastre, R. Soto y J. G. Viramonte. - Las observaciones GPS en la red antártica 1988-1989. El efecto del campo gravitatorio austral en la observación de satélites / M. Catalán y M. Berrocoso. - Origen y estructura de la isla Decepción (islas Shetland del Sur) / J. Martí, A . Baraldo y J. Rey. - Geoquímica de fluidos en la isla Decepción / A. Valentin, M. Martini y J. L. Diez Gil. - Los enclaves de las rocas volcánicas de terraza Kendall y Bahía Murature, isla Decepción, Shetland del Sur. Antártida / C. Risso, A . Aparicio y J. G. Viramonte. - Anomalías térmicas y balance de flujo disipado en la isla Decepción, Shetland del Sur / M. Ramos, R. Ortiz, J. L. Diez Gil y J. G. Viramonte. - Caracterización de algunos parámetros termodinámicos del suelo del volcán Decepción (Antártida) / M. Ramos, M. Domínguez y R. Ortiz. - Temblores volcánicos en Decepción. Origen y evolución / J. Vila, A. M. Correig, R. Ortiz y J. Batlló. - Detección de una capa de baja velocidad asociada a las últimas erupciones en Decepción / J. Vila, A. M. Correig, R. Maciá y R. Ortiz. - Interpretación preliminar de un ensayo de perfil sísmico de refracción en Port Foster (isla Decepción) / R. Ortiz, R. Boloix y E. Carreño. - Actividad sísmica en el entorno de la Base Antártica Española Juan Carlos I (islas Livingston y Decepción) / R. Ortiz, J. Vila y J. C. Sastre. - Estudio del campo magnético en Port Foster (isla Decepción) / A. García, J. G. Viramonte, J. Vila y J. M. lbáñez. - Perfiles magnéticos sobre el sistema de fracturas del sector noroeste de Decepción / J. G. Viramonte, M Ramos, A. García, C. Suazo y J. L. Díez Gil. - Anomalías magnéticas al sur del mar de Bransfield / J. Acosta, M. Catalán, J. L. Diez, J. M Fernández López, A. García, P. Herranz, R. Ortiz y J. C. Sastre. - Tectónica reciente en los depósitos submarinos de la bahía de Depción / J. Rey, J. R. de Andrés, J. M. Fernández López y C. Palomo. - Nuevos datos de sísmica continua por reflexión sobre la evolución geodinámica reciente del margen de las Shetland del Sur y estrecho de Bransfield / J. L. Sanz, J. Acosta y P. Herranz. - Perfiles sísmicos en las Shetland del Sur y estrecho de Bransfiel. Estructura y dinámica reciente / J. Acosta, M. Catalán, P. Herranz y J. L. Sanz. - Análisis estructural del hielo del glaciar Cazadora, cuantificación direccional de la anisotropia y predicción del drenaje subglaciar. Base Antártica Española Juan Carlos l. Isla Livingston (Shetland del Sur) / A. Erase, l. Antigüedad y M. Taylor. - Distribución vertical de isótopos estables (Deuterio y Oxígeno-18) en el hielo del glaciar Cazadora junto a la Base Antártica Española Juan Carlos l. Isla Livingston (Shetland del Sur) / A. Eraso, l. Antigüedad, R. Gonfiantini, L. Araguas, M Gómez Martos y J. A. López Geta. - Distribución vertical de algunos oligoelementos presentes en el glaciar Cazadora junto a la Base Antártica Española Juan Carlos l. Isla Livingston (Shetland del Sur) / A. Eraso, l. Antigüedad. A. llarri, J. A. López Geta y M. Gómez Martos. - Análisis mineralógico y por microsonda de las cenizas volcánicas existentes junto a la Base Antártica Española Juan Carlos l. Isla Livingston (Shetland del Sur) / A. Eraso, l. Antigüedad, P. Herrero, J. Arostegui. L Eguiluz, C. Quesada y A. Sánchez. - Diferentes tipologías de aguas encontradas en la proximidad de la Base Antártica Española Juan Carlos l. Isla Livingston (Shetland del Sur) / l. Antigüedad, A. Eraso y R. Fernández Rubio. - Correlación entre caudales drenados y parámetros hidroquimicos en el río de la Base Antártica Española Juan Carlos l. Isla Livingston (Shetland del Sur) / l. Antigüedad, A. Eraso y R. Fernández Rubio. - Caracteríscicas del hidrograma en función de los datos meteorológicos y elaboración de la curva de gastos del río de la Base Antártica Española Juan Carlos l. Isla Livingston (Shetland del Sur) / l. Antigüedad. A. Eraso, A. Mangín y R. Fernández Rubió. - Anteproyecto de construcción de un azud en la albufera fósil del sexto nivel de playa existente junto a la Base Antá rtica Española Juan Carlos l. Isla livingston (Shetland del Sur) / A. Eraso, A. Sánchez de Toro, R. Fernández Rubio y J. Presa. - Instrumentación Antártica, unidad automática de adquisición de datos para aplicación general. / R. Ortiz y E. Giménez. - Instrumentación Antártica. Red Sísmica Digital / R. Ortiz y J. Vila. - Experiencias térmicas realizadas sobre el comportamiento térmico del acero en condiciones polares (Polo Norte Geográfico) / J. Aguirre, M Ramos, P. D. Sanz y A. Sigot. - Estudio de fa resistencia térmica del traje polar prototipo "CM" e , Sprache der Zusammenfassung: Englisch

Note: Contents: Introduction. - Legend. - Chapter 1. Basic Directions of Snow and Ice Thermal Physics Study. - 1. Analysis of traditional theoretical and experimental methods. - 2. New methodological point of view on the thermal physics of snow-ice masses. - 3. Conditions of initial data. - 4. Complex heat transfer within the system "space-atmosphere-earth surface". - 5. Optical and thermophysical properties of snow and ice. - Chapter 2. General Statement of the Problem of Radiative Thermophysics. - 1. Absorption and scattering of light in optical-heterogeneous media. - 2. Optical phenomenological models and parameters of radiation transfer in light-scattering media (LSM). - 3. Distribution of absorbed radiation flux in the unlimited layer of LSM. - 4. Optical models and snow and ice characteristics as LSM ones. - 5. Influence of boundary conditions upon thermal regime of lightscattering snow-ice layer. - 6. Statements of basic problems of radiative thermal physics of snow and ice. - Chapter 3. Thermal Regime of Snow-Ice Cover. - 1. Estimation of heat processes characteristics of snow-ice covers. - 2. Oscillating external sources. - 3. Radiative-conductive mechanism of snow and ice heating. - 4. Thermal regime of combined snow-ice layers. - 5. Melting in snow-ice media under conditions of radiative heat transfer. - 6. Thermo-radiative heating and balance of the upper part of active layer of antarctic snow-ice covers. - Chapter 4. The Model of Metamorphic Evolution of Snow and Ice. - 1. Influence of radiation fluxes upon icy crystals of snow cover. - 2. Mechanism of sublimation under forming of snow cover. - 3. Phenomenological picture of sublimation in snow medium. - 4. The model of radiative-thermal regime under sublimation. - 5. Thermal regime of snow and ice under conditions of evaporation and condensation. - 6. On nature of snow and ice metamorphism. - Chapter 5. Radiative Thermophysics of Snow-Ice Masses in Practical utilization. - 1. Heat regime of snow-ice cover under thermoregulative film. - 2. Influence upon surface melting of glaciers. - 3. Antarctic experiments on artificial increase of ablation. - 4. Artificial increase of ablation control. - 5. Ecological aspects of artificial increase of ablation. - 6. Cooling in polar regions. - Chapter 6. Thermophysics of Antarctic Lakes. - 1. Natural conditions of oases. - 2. Types of antarctic lakes. - 3. One-dimensional heat problem. - 4. Simplification of the model. - 5. Thermal regime of fresh and saline lakes. - 6. Phenomenon of fresh-saline stratified lakes. - 7. Stationary model including mass transfer. - 8. Thermal regime of fresh-saline lake Vanda. - Chapter 7. Space Glaciology. - 1. Ice in Solar system. - 2. Radiative thermophysics of ice under cosmic conditions. - 3. Ice of cometary nuclei. - 4. Heat-balance models of 'radiative thermophysics of cometary nuclei. - Conclusion. - References. - Index. , In kyrillischer Schrift

Note: Beilage unter dem Titel: SCAR : Wissenschaftliches Komitee für Antarktisforschung , Beilage unter dem Titel: Deutsche Mitglieder in SCAR-Gruppen = German members in SCAR Groups , Beilage unter dem Titel: Corrigendum / German Antarctic Research Report to SCAR, No. 12 - 1990 , Beilage unter dem Titel: SCAR Bulletin : No. 99, October 1990 ; Stations of SCAR nations operating in the Antarctic, winter 1990 , CONTENTS: I. National Committee for Antarctic Research, and National Operating Organization/Agency. - II. Map of Stations. - Ill. Permanent Observatories, Regular Observations and Long-term Monitoring. - IV. Report on Highlights of Science Activities from Previous Reporting Period (1 Oct. 89 - 31 March 90). - A. Biology. - B. Geodesy & Geographic Information. - C. Geology. - D. Solid Earth Geophysics. - E. Glaciology. - F. Human Biology & Medicine. - G. Atmospheric Sciences. - H. Logistics. - I. Ocean Physical Sciences. - V. List of Permits and Rationale for Entry into SPAs and SSSIs. - VI. Prospectus of Planned Activities for Coming Reporting Period (1 April 90 - 31 March 91). - A. Biology. - B. Geodesy & Geographic Information. - C. Geology. - D. Solid Earth Geophysics. - E. Glaciology. - F. Human Biology & Medicine. - G. Atmospheric Sciences. - H. Logistics. - I. Ocean Physical Sciences. - VII. Future Activities Planned & Funded (beyond 31 March 91). - A. Biology. - B. Geodesy & Geographic Information. - C. Geology. - D. Solid Earth Geophysics. - E. Glaciology. - F. Human Biology & Medicine. - G. Atmospheric Sciences. - H. Logistics. - I. Ocean Physical Sciences. - VIII. Bibliography. - IX. List of Principal Investigators and Responsible Authorities.

Note: German

Note: Inhaltsverzeichnis 1. Einleitende Übersicht 2. Nationale und internationale Zusammenarbeit 3. Forschungsarbeiten 3.1 Expeditionen 3.1.1 Arktisreise ARK V (April -August 1988) 3.1.2 Antarktisreise ANT VII (September 1988 - April 1989, EPOS: Die erste europäische Antarktisexpedition) 3.1.3 Arktisreise ARK VI (April - Juli 1989) 3.1.4 Antarktisreise ANT VII, 1-4 (August -Dezember 1989) 3.2 Arbeitsberichte der Sektionen 3.2.1 Biologie I (Zoologie) 3.2.2 Biologie II (Botanik und Mikrobiologie) 3.2.3 Chemie 3.2.4 Geologie 3.2.5 Geophysik 3.2.6 Physik des Ozeans und der Atmosphäre I (Feldstudien) 3.2.7 Physik des Ozeans und der Atmosphäre II (Modelle) 3.2.8 Meeresphysik und Meßwesen 3.3 Ausgewählte Forschungsthemen 4. Logistik 4.1 Antarktisstationen 4.2 Neubauprojekte 4.3 FS "Polarstern" und FS "Victor Hensen" 4.4 Polarflugzeuge und Hubschrauber 4.5 Allgemeine Logistik 4.6 Ingenieurprojekte 4.7 Internationale Einbindung 5. Zentrale Einrichtungen 5.1 Öffentlichkeitsarbeit 5.2 Bibliothek 5.3 Rechenzentrum 6. Personeller Aufbau und Entwicklung 6.1 Personal 6.2 Haushalt Anhang I Personal II Wissenschaftliche Veranstaltungen III Publikationen IV Veröffentlichungen V Abgeschlossene Examensarbeiten VI "Polarstern"-Expeditionen

Note: Editorial E&G Quaternary Science Journal, Vol. 67 (2018) Christopher Lüthgens and Margot Böse E&G Quaternary Sci. J., 67, 85-86, 2019. 〈a href="https://doi.org/10.5194/egqsj-67-85-2019" target="_blank"〉https://doi.org/10.5194/egqsj-67-85-2019〈/a〉 , Middle to Late Holocene mobilization of DOC-bound Pb and Y in the Magellanic moorlands (53° S) as a function of sea spray fertilization, climate variations and volcanic fallout? A preliminary report Björn Klaes, Rolf Kilian, Gerhard Wörner, Sören Thiele-Bruhn, and Helge W. Arz E&G Quaternary Sci. J., 67, 1-6, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-1-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-1-2018〈/a〉 , Capability of U–Pb dating of zircons from Quaternary tephra: Jemez Mountains, NM, and La Sal Mountains, UT, USA Jana Krautz, Mandy Hofmann, Andreas Gärtner, Ulf Linnemann, and Arno Kleber E&G Quaternary Sci. J., 67, 7-16, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-7-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-7-2018〈/a〉 , Reconsidering the origin of the Sedrun fans (Graubünden, Switzerland) Catharina Dieleman, Susan Ivy-Ochs, Kristina Hippe, Olivia Kronig, Florian Kober, and Marcus Christl E&G Quaternary Sci. J., 67, 17-23, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-17-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-17-2018〈/a〉 , Disestablishing “Glacial Lake Speight”, New Zealand? An example for the validity of detailed geomorphological assessment with the study of mountain glaciations Stefan Winkler, David Bell, Maree Hemmingsen, Kate Pedley, and Anna Schoch E&G Quaternary Sci. J., 67, 25-31, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-25-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-25-2018〈/a〉 , Proglacial streams and their chronology in the glacier forefields of the Himalayas Gerrit Tombrink E&G Quaternary Sci. J., 67, 33-36, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-33-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-33-2018〈/a〉 , Glacial history of the upper Drac Blanc catchment (Écrins massif, French Alps) Felix Martin Hofmann E&G Quaternary Sci. J., 67, 37-40, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-37-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-37-2018〈/a〉 , New data from the Middle Palaeolithic Cotencher cave (Swiss Jura): site formation, environment, and chronology Judit Deák, Frank Preusser, Marie-Isabelle Cattin, Jean-Christophe Castel, and François-Xavier Chauvière E&G Quaternary Sci. J., 67, 41-72, 2019. 〈a href="https://doi.org/10.5194/egqsj-67-41-2019" target="_blank"〉https://doi.org/10.5194/egqsj-67-41-2019〈/a〉 , Fortification, mining, and charcoal production: landscape history at the abandoned medieval settlement of Hohenwalde at the Faule Pfütze (Saxony, Eastern Ore Mountains) Johann Friedrich Tolksdorf, Matthias Schubert, Frank Schröder, Libor Petr, Christoph Herbig, Petr Kočár, Mathias Bertuch, and Christiane Hemker E&G Quaternary Sci. J., 67, 73-84, 2019. 〈a href="https://doi.org/10.5194/egqsj-67-73-2019" target="_blank"〉https://doi.org/10.5194/egqsj-67-73-2019〈/a〉

Note: Contents: Chapter 1: Introduction to the book ; Chapter 2: The nature of qualitative research ; Part I: The design cycle ; Chapter 3: The design cycle ; Chapter 4: Designing participatory research ; Chapter 5: Ethical issues in qualitative research ; Part II: The data collection cycle ; Chapter 6: Sampling and participant recruitment ; Chapter 7: In-depth interviews ; Chapter 8: Focus group discussions ; Chapter 9: Observation ; Part III: The analytic cycle ; Chapter 10: Data preparation and developing codes ; Chapter 11: Textual data analysis ; Chapter 12: From analysis to participatory action ; Chapter 13: Academic writing of qualitative research ; Post Script: Assessing quality in the qualitative research cycle

Note: CONTENTS Preface lnroduction Chapter I. Radiocarbon chronology and chronostratigraphy of the Paleolith of NE Asia: Statement of a Question Chapter II. Paleolithic sites of the Aidan River Valley Features of geology and geomorphology of Aldan valley Age and validity of archaeological sites in Aldan valley "Tectonic hypothesis" Chronostratigraphy of the Late Pleistocene and Holocene sites in Aldan valley Chapter III. Archaeological sites of the Yana-Indighirka Lowland The Yana site It's discovery and history of research General description of the site area Deposits of the second terrace of Yana River and position of the cultural layer of the Yana site Radiocarbon age of the cultura layer Archaeological finds Fauna remains The Berelekh site History of research Geological profile and radiocarbon chronology of Berelekh geocomplex Archaeological component of Berelekh geocomplex Fauna remains Chapter IV. Radiocarbon dated Paleolithic site of NE Asia beyond the Aidan valley and Coastal (Yana-Kolyma) lowland Geoarchaeological objects of Upper and Middle Lena River Archaeological sites of Kolyma River basin and Sea of Okhotsk and Kolyma River watershed Ushki sites in Kamchatka Peninsula Concluding remarks for the Fourth Chapter Chapter V. Basic elements of radiocarbon chronology of the Holocene Stone Age of NE Asia Chapter VI. Radiocarbon chronology, archaeological periodization and peculiarities of cultural development of the Late Pleistocene and Holocene of NE Asia Conclusions Summary References List of abbreviations Radiocarbon laboratory's codes List of illustrations List of tables Appendices Table 1. Radiocarbon dates of archaeological site of NE Asia Table 8. A synopsis for geomorphology of 14C dated Late Pleistocene and Early Holocene archaeological sites of NE Asia , СОДЕРЖАНИЕ Предисловие Введение Глава I. Радиоуглеродная хронология и хроностратиrрафия палеолита Северо- Востока Азии: постановка проблемы Глава II. Памятники палеолита в долине р. Алдан Особенности строения долины р. Алдан Возраст и валидность археологических памятников Алдана «Тектоническая гипотеза» Хроностратиграфия памятников позднего неоплейстоцена и голоцена Алдана Глава III. Памятники Яно-Индиrирской низменности Янская стоянка История открытия и изучения Общая характеристика района стоянки Отложения разреза второй надпойменной террасы р. Яны и положение культурного слоя Янской стоянки Радиоуглеродный возраст культурного слоя Археологическая составляющая Фаунистическая характеристика Стоянка Берелёх История изучения Характеристика разреза и хронология Берелёхского комплекса Археологическая составляющая Берелёхского комплекса Комплекс фаунистических находок Глава IV. Датированные памятники палеолита Северо-Восточной Азии вне пределов долины Алдана и Приморской (Я но-Колымской) низменности Геоархеологические объекты Верхней и Средней Лены Памятники Колымской системы и Охотска-Колымского водораздела Комплекс Ушковских стоянок (Камчатский полуостров) Заключительные замечания к разделу Глава V. Основные черты радиоуглеродной хронологии rолоценовых памятников каменноrо века Северо-Восточной Азии Глава VI. Радиоуглеродная хронология, археологическая периодизация и особенности культурно-исторических процессов позднего неоплейстоцена и rолоцена Северо-Восточной Азии Заключение Summary Литература Список сокращений Список иллюстраций Список табличного материала Список индексов лабораторий, проводящих радиоуглеродное датирование Приложения Таблица 1. Список радиоуглеродных дат археологических объектов Северо-Востока Азии Таблица 8. Краткий конспект геоморфологического положения датированных поздненеоплейстоценовых и раннеrолоценовых археологических памятников Северо-Востока Азии , Zusammenfassung in englischer Sprache , In kyrillischer Schrift

Note: Contents List of contributors Preface I Introductory Chapters 1 The Ecological Value of Biyophytes as Indicators of Climate Change / NANCY G. SLACK 2 Bryophyte Physiological Processes in a Changing Climate: an Overview / ZOLTÁN TUBA II Ecophysiology 3 Climatic Responses and Limits of Biyophytes: Comparisons and Contrasts with Vascular Plants / MICHAEL C. F. PROCTOR 4 Effects of Elevated Air C02 Concentration on Bryophytes: a Review / ZOLTÁN TUBA, EDIT ÖTVÖS, AND ILDIKÓ JÓCSÁK 5 Seasonal and Interannual Variability of Light and UV Acclimation in Mosses / NIINA M. LAPPALAINEN, ANNA HYYRYLÄINEN, AND SATU HUTTUNEN III Aquatic Bryophytes 6 Ecological and Physiological Effects of Changing Climate on Aquatic Bryophytes / JANICE M. GLIME 7 Aquatic Bryophytes under Ultraviolet Radiation / JAVIER MARTÍNEZ-ABAIGAR AND ENCARNACIÓN NÚÑEZ-OLIVERA IV Desert and Tropical Ecosystems 8 Responses of a Biological Crust Moss to Increased Monsoon Precipitation and Nitrogen Deposition in the Mojave Desert / LLOYD R. STARK, D. NICHOLAS MCLETCHIE, STANLEY D. SMITH, AND MELVIN J. OLIVER 9 Ecology of Bryophytes in Mojave Desert Biological Soil Crusts: Effects of Elevated CO2 on Sex Expression, Stress Tolerance, and Productivity in the Moss Syntrichia caninervis Mitt. / JOHN C. BRINDA, CATHERINE FERNANDO, AND LLOYD R. STARK 10 Responses of Epiphytic Bryophyte Communities to Simulated Climate Change in the Tropics / JORGE JÁCOME, S. ROBBERT GRADSTEIN, AND MICHAEL KESSLER V Alpine, Arctic, and Antarctic Ecosystems 11 Effects of Climate Change on Tundra Bryophytes / ANNIKA K. JÄGERBRAND, ROBERT G. BJÖRK, TERRY CALLAGHAN, AND RODNEY D. SEPPELT 12 Alpine Bryophytes as Indicators for Climate Change: a Case Study from the Austrian Alps / DANIELA HOHENWALLNER, HAROLD GUSTAV ZECHMEISTER, DIETMAR MOSER, HARALD PAULI, MICHAEL GOTTFRIED, KARL REITER, AND GEORG GRABHERR 13 Bryophytes and Lichens in a Changing Climate: An Antarctic Perspective / RODNEY D. SEPPELT VI Sphagnum and Peatlands 14 Living on the Edge: The Effects of Drought on Canada's Western Boreal Peatlands / MELANIE A. VILE, KIMBERLI D. SCOTT, ERIN BRAULT, R. KELMAN WlEDER, AND DALE H . VlTT 15 The Structure and Functional Features of Sphagnum Cover of the Northern West Siberian Mires in Connection with Forecasting Global Environmental and Climatic Changes / ALEKSEI V. NAUMOV AND NATALIA P. KOSYKH 16 The Southernmost Sphagnum-dominated Mires on the Plains of Europe: Formation, Secondary Succession, Degradation, and Protection / JÁNOS NAGY VII Changes in Bryophyte Distribution with Climate Change: Data and Models 17 The Role of Bryophyte Paleoecology in Quaternary Climate Reconstructions / GUSZTÁV JAKAB AND PÁL SÜMEGI 18 Signs of Climate Change in the Bryoflora of Hungary / TAMÁS PÓCS 19 Can the Effects of Climate Change on British Bryophytes be Distinguished from those Resulting from Other Environmental Changes? / JEFFREY W. BATES AND CHRISTOPHER D. PRESTON 20 Climate Change and Protected Areas: How well do British Rare Bryophytes Fare? / BARBARA J. ANDERSON AND RALF OHLEMÜLLER 21 Modeling the Distribution of Sematophyllum substrumulosum (Hampe) E. Britton as a Signal of Climatic Changes in Europe / CECÍLIA SÉRGIO, RUI FIGUEIRA, AND RUI MENEZES 22 Modeling Bryophyte Productivity Across Gradients of Water Availability Using Canopy Form-Function Relationships / STEVEN K. RICE, NATHALI NEAL, JESSE MANGO, AND KELLY BLACK VIII Conclusions 23 Bryophytes as Predictors of Climate Change / L. DENNIS GIGNAC 24 Conclusions and Future Research / NANCY G. SLACK AND LLOYD R. STARK Index

Note: Zugl.: Berlin, TU, Fakultät VII - Wirtschaft und Management, Diss., 2009

Note: Internetausg.: Astronomicke Observatorium Skalnate Pleso: Contributions of the Astronomical Observatory Skalnate Pleso , Erscheinungsjahr in Vorlageform:1990-

Note: Erscheinungsjahr in Vorlageform:c2011

Note: A stratigraphic concept for Middle Pleistocene Quaternary sequences in Upper Austria --- Magnetic excursions recorded in the Middle to Upper Pleistocene loess/palaeosol sequence Wels-Aschet (Austria) --- Paleopedological record along the loess-paleosol sequence in Oberlaab, Austria --- Grain size and mineralogical indicators of weathering in the Oberlaab loess-paleosol sequence, Upper Austria --- Last Interglacial paleosols with Argic horizons in Upper Austria and Central Russia --- Paudorf locus typicus (Lower Austria) revisited

Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.

Note: The democratic promiseThe deliberative turn in democratic theory -- The elusive concept of empathy -- Empathy in deliberative theory -- Empathy's importance : the empirical evidence -- Deliberative democracy and its critics -- Empathy and democracy..