ALBERT

Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.

Note: Contents: List of Contributors. - Preface. - Part I. Introduction: 1. Applications and uses of diatoms: prologue ; 2. The diatoms: a primer ; 3. Numerical methods for the analysis of diatom assemblage data ; Part II. Diatoms as indicators of environmental change in flowing waters and lakes: 4. Assessing environmental conditions in rivers and streams with diatoms ; 5. Diatoms as indicators of long-term environmental change in rivers, fluvial lakes and impoundments ; 6. Diatoms as indicators of surface-water acidity ; 7. Diatoms as indicators of lake eutrophication ; 8. Diatoms as indicators of environmental change in shallow lakes ; 9. Diatoms as indicators of water-level change in freshwater lakes ; 10. Diatoms as indicators of hydrologic and climatic change in saline lakes ; 11. Diatoms in ancient lakes ; Part III. Diatoms as Indicators in Arctic, Antarctic and alpine lacustrine environments: 12. Diatoms as indicators of environmental change in subarctic and alpine regions ; 13. Freshwater diatoms as indicators of environmental change in the High Arctic ; 14. Diatoms as indicators of environmental change in Antarctic and subantarctic freshwaters ; Part IV. Diatoms as indicators in marine and estuarine environments: 15. Diatoms and environmental change in large brackish-water ecosystems ; 16. Applied diatom studies in estuaries and shallow coastal environments ; 17. Estuarine paleoenvironmental reconstructions using diatoms ; 18. Diatoms on coral reefs and in tropical marine lakes ; 19. Diatoms as indicators of former sea levels, earthquakes, tsunamis and hurricanes ; 20. Marine diatoms as indicators of modern changes in oceanographic conditions ; 21. Holocene marine diatom records of environmental change ; 22. Diatoms as indicators of paleoceanographic events ; 23. Reconsidering the meaning of biogenic silica accumulation rates in the glacial Southern Ocean ; Part V. Other applications: 24. Diatoms of aerial habitats ; 25. Diatoms as indicators of environmental change in wetlands and peatlands ; 26. Tracking fish, seabirds, and wildlife population dynamics with diatoms and other limnological indicators ; 27. Diatoms and archaeology ; 28. Diatoms in oil and gas exploration ; 29. Forensic science and diatoms ; 30. Toxic marine diatoms ; 31. Diatoms as markers of atmospheric transport ; 32. Diatoms as nonnative species ; 33. Diatomite ; 34. Stable isotopes from diatom silica ; 35. Diatoms and nanotechnology: early history and imagined future as seen through patents ; Part IV. Conclusions: 36. Epilogue: a view to the future ; Glossary, acronyms, and abbreviations ; Index.

Note: Contents: F–1. GLACIERS OF THE FORMER SOVIET UNION / VLADIMIR M. KOTLYAKOV, with contributions from A.M. DYAKOVA (Siberia), V.S. KORYAKIN (Russian Arctic Islands), V.I. KRAVTSOVA (Caucasus, Altay), G.B. OSIPOVA (Tien Shan), G.M. VARNAKOVA (Pamirs and Alai Range), V.N. VINOGRADOV (Kamchatka), O.N. VINOGRADOV (Caucasus), and N.M. ZVERKOVA (Ural Mountains and Taymyr Peninsula) Sections on FLUCTUATIONS OF GLACIERS OF THE CENTRAL CAUCASUS AND GORA EL’BRUS (With a subsection on THE GLACIOLOGICAL DISASTER IN NORTH OSETIYA / VLADIMIR M. KOTLYAKOV, O.V. ROTOTAEVA, and G.A. NOSENKO INVESTIGATIONS OF THE FLUCTUATIONS OF SURGE-TYPE GLACIERS IN THE PAMIRS BASED ON OBSERVATIONS FROM SPACE / VLADIMIR M. KOTLYAKOV, G.B. OSIPOVA, and D.G. TSVETKOV THE GLACIOLOGY OF THE RUSSIAN HIGH ARCTIC FROM LANDSAT IMAGERY / J.A. DOWDESWELL, E.K. DOWDESWELL, M. WILLIAMS, and A.F. GLAZOVSKII F–2. GLACIERS OF CHINA / SHI YAFENG, MI DESHENG, YAO TANDONG, ZENG QUNZHU, and LIU CHAOHAI F–3 GLACIERS OF AFGHANISTAN / JOHN E. SHRODER , JR ., and MICHAEL P. BISHOP F–4 GLACIERS OF PAKISTAN / JOHN E. SHRODER , JR ., and MICHAEL P. BISHOP F–5 GLACIERS OF INDIA / CHANDER P. VOHRA Updated supplement on A STUDY OF SELECTED GLACIERS UNDER THE CHANGING CLIMATE REGIME / SYED IQBAL HASNAIN, RAJESH KUMAR , SAFARAZ AHMAD, and SHRESTH TAYAL F–6 GLACIERS OF NEPAL — GLACIER DISTRIBUTION IN THE NEPAL HIMALAYA WITH COMPARISON TO THE KARAKORAM RANGE / KEIJI HIGUCHI, OKITSUGU WATANABE, HIROJI FUSHIMI, SHUHEI TAKENAKA, and AKIO NAGOSHI, Supplement by YUTAKA AGETA F–7 GLACIERS OF BHUTAN / SHUJI IWATA F–8 THE PALEOENVIRONMENTAL RECORD PRESERVED IN MIDDLE-LATITUDE, HIGH-MOUNTAIN GLACIERS: AN OVERVIEW OF U.S. GEOLOGICAL SURVEY RESEARCH IN CENTRAL ASIA AND THE UNITED STATES / L. DeWAYNE CECIL, DAVID L. NAFTZ, PAUL F. SCHUSTER , DAVID D. SUSONG, and JAROMY R . GREEN

Note: Contents Preface 1 Introduction 1.1 The necessity for measurements 1.2 Definition of a measurement 1.3 Historical aspects 2 Measurement basics 2.1 Overview of methods 2.1.1 Direct and indirect methods 2.1.2 In-situ and remote sensing methods 2.1.3 Instantaneous and integrating methods 2.1.4 On-line and off-line methods, post-processing 2.1.5 Flux measurements 2.2 Main measurement principles 2.3 Measurements by inversion 2.3.1 Inversion with one variable 2.3.2 Inversion with more than one variable 2.3.3 Well-posed and ill-posed problems 2.4 Measurement instruments 2.4.1 Active and passive instruments 2.4.2 Analogue and digital instruments 2.5 Measurement platforms 2.6 Measurement variables 2.7 General characteristics of measured data 2.8 Data logging 2.9 Quality assurance/quality control 3 In-situ measurements of state variables 3.1 Thermometers 3.1.1 Liquid-in-glass thermometers 3.1.2 Bimetal thermometers 3.1.3 Resistance thermometers, thermistors 3.1.4 Thermocouples, thermopiles 3.1.5 Sonic thermometry 3.1.6 Measurement of infrared radiation 3.1.7 Soil thermometer 3.1.8 Recommendations for temperature measurements 3.2 Measuring moisture 3.2.1 Hygrometer 3.2.2 Psychrometers 3.2.3 Dewpoint determination 3.2.4 Capacitive methods 3.2.5 Recommendations for humidity measurements 3.3 Pressure sensors 3.3.1 Barometers 3.3.2 Hypsometers 3.3.3 Electronic barometers 3.3.4 Microbarometer 3.3.5 Pressure balance 3.3.6 Recommendations for pressure measurements 3.4 Wind measurements 3.4.1 Estimation from visual observations 3.4.2 Wind direction 3.4.3 Cup anemometer 3.4.4 Pressure tube 3.4.5 Hot wire anemometer 3.4.6 Ultrasonic anemometer 3.4.7 Propeller anemometer 3.4.8 Recommendations for wind measurements 4 In-situ methods for observing liquid water and ice 4.1 Precipitation 4.1.1 Rain sensors (Present Weather Sensors) 4.1.2 Rain gauges (totalisators) 4.1.3 Pluviographs 4.1.4 Disdrometer 4.1.5 Special instruments for snow 4.1.6 Recommendations for precipitation measurements 4.2 Soil moisture 4.2.1 Gravimetric methods 4.2.2 Neutron probes 4.2.3 Time domain reflectrometry (TDR) 4.2.4 Tensiometers 4.2.5 Resistance block tensiometer 4.2.6 Recommendations for soil moisture measurements 5 In-situ measurement of trace substances 5.1 Measurement of trace gases 5.1.1 Physical methods 5.1.2 Chemical methods 5.1.3 Recommendations for the measurement of trace gases 5.2 Particle measurements 5.2.1 Determination of the particle mass 5.2.2 Measuring particle size distributions 5.2.3 Measurement of the chemical composition of particles 5.2.4 Measuring the particle structure 5.2.5 Saltiphon 5.2.6 Recommendations for particle measurements 5.3 Olfactometry 5.4 Radioactivity 5.4.1 Counter tubes 5.4.2 Scintillation counters 5.4.3 Recommendations for radioactivity monitoring 6 In-situ flux measurements 6.1 Measuring radiation 6.1.1 Measuring direct solar radiation 6.1.2 Measuring shortwave irradiance 6.1.3 Measuring longwave irradiance 6.1.4 Measuring the total irradiance 6.1.5 Measuring chill 6.1.6 Sunshine recorder 6.1.7 Recommendations for radiation measurements 6.2 Visual range 6.3 Micrometeorological flux measurements 6.3.1 Cuvettes 6.3.2 Surface chambers 6.3.3 Mass balance method 6.3.4 Inferential method 6.3.5 Gradient method 6.3.6 Bowen-ratio method 6.3.7 Flux variance method 6.3.8 Dissipation method 6.3.9 Eddy covariance method 6.3.10 Eddy accumulation methods 6.3.11 Disjunct eddy covariance method 6.3.12 Recommendations for the measurement of turbulent fluxes 6.4 Evaporation Atmometers 6.4.2 Lysimeters 6.4.3 Evaporation pans and tanks 6.4.4 Recommendations for evaporation measurements 6.5 Soil heat flux 6.6 Inverse emission flux modelling 7 Remote sensing methods 7.1 Basics of remote sensing 7.2 Active sounding methods 7.2.1 RADAR 7.2.2 Windprofilers 7.2.3 SODAR 7.2.4 RASS 7.2.5 LIDAR 7.2.6 Further LIDAR techniques 7.3 Active path-averaging methods 7.3.1 Scintillometers 7.3.2 FTIR 7.3.3 DOAS 7.3.4 Quantum cascade laser 7.4 Passive methods 7.4.1 Radiometers 7.4.2 Photometers 7.4.3 Infrared-Interferometer 7.5 Tomography 7.5.1 Simultaneous Iterative Reconstruction Technique 7.5.2 Algebraic Reconstruction Technique (ART) 7.5.3 Smooth Basis Function Minimization (SBFM) 8 Remote sensing of atmospheric state variables 8.1 Temperature 8.1.1 Near-surface temperatures 8.1.2 Temperature profiles 8.2 Gaseous humidity 8.2.1 Integral water vapour content 8.2.2 Vertical profiles 8.2.3 Large-scale humidity distribution 8.3 Wind and turbulence 8.3.1 Small-scale near-surface turbulence 8.3.2 Horizontal wind fields 8.3.3 Vertical wind profiles 8.3.4 Turbulence profiles 8.3.5 Cloud winds 8.3.6 Ionospheric winds 8.4 Mixing-layer heights 8.4.1 LIDAR 8.4.2 SODAR 8.5 Turbulent fluxes 8.6 Ionospheric electron densities 8.7 Recommendations for remote sensing of state variables 9 Remote sensing of water and ice 9.1 Precipitation 9.1.1 RADAR 9.1.2 Precipitation measurements from satellites 9.2 Clouds 9.2.1 Cloud base 9.2.2 Cloud cover 9.2.3 Cloud movement 9.2.4 Water content 9.3 Recommendations for remote sensing of liquid water and ice 10 Remote sensing of trace substances 10.1 Trace gases 10.1.1 Horizontal path-averaging methods 10.1.2 Vertical column densities 10.1.3 Sounding methods 10.2 Aerosols 10.2.1 Aerosol optical depths (AOD) 10.2.2 Sounding methods 10.3 Recommendations for remote sensing of trace substances 11 Remote sensing of surface properties 11.1 Properties of the solid surface 11.1.1 Surface roughness 11.1.2 Land surface temperature 11.1.3 Soil moisture 11.1.4 Vegetation 11.1.5 Snow and ice 11.1.6 Fires 11.2 Properties of the ocean surface 11.2.1 Altitudes of the sea surface 11.2.2 Wave heights 11.2.3 Sea surface temperature 11.2.4 Salinity 11.2.5 Ocean currents 11.2.6 Ice cover, size of ice floes 11.2.7 Algae and suspended sediment concentrations 12 Remote sensing of electrical phenomena 12.1 Spherics 12.1.1 Directional analyses 12.1.2 Distance analyses 12.2 Optical lightning detection 13 Outlook on new developments Literature Subject index Appendix: Technical guidelines and standards Index to the Appendix

Note: Cotents: Teil I: R-Grundlagen: 1 Beschaffung und Installation von R. - 2 Die R-Benutzerschnittstelle. - 3 Kurzeinführung in R. - 4 R-Pakete. - Teil II: Die Programmiersprache R: 5 Überblick über die Programmiersprache R. - 6 R-Syntax. - 7 R-Objekte. - 8 Symbole und Umgebungen. - 9 Funktionen. - 10 Objektorientierte Programmierung. - 11 Hochperformantes R. - Teil II: Daten aufbereiten und darstellen: 12 Daten speichern, laden und bearbeiten. - 13 Datenaufbereitung. - 14 Grafik. - 15 Trellis-Grafik mit Lattice. - Teil IV: Statistik mit R: 16 Datenexploration. - 17 Wahrscheinlichkeitsverteilungen. - 18 Statistische Testverfahren. - 19 Poweranalyse. - 20 Regressionsmodelle. - 21 Klassifikationsmodelle. - 22 Maschinelles Lernen. - 23 Zeitreihenanalyse. - 24 Bioconductor. - Anhang A: Funktionsreferenz. - Anhang B: Datensatzreferenz. - Literatur. - Index

Note: CONTENTS PREFACE PREFACE TO THE SECOND EDITION ACKNOWLEDGEMENTS PART ONE GLACIERS 1 INTRODUCTION 1.1 Glacier systems 1.1.1 Mass balance 1.1.2 Meltwater 1.1.3 Glacier motion 1.1.4 Glaciers and sea-level change 1.1.5 Erosion and debris transport 1.1.6 Glacial sediments, landforms and landscapes 1.2 Glacier morphology 1.2.1 Ice sheets and ice caps 1.2.2 Glaciers constrained by topography 1.2.3 Ice shelves 1.3 Present distribution of glaciers 1.3.1 Influence of latitude and altitude 1.3.2 Influence of aspect, relief and distance from a moisture source 1.4 Past distribution of glaciers 1.4.1 'Icehouse' and 'greenhouse' worlds 1.4.2 Cenozoic glaciation 2 SNOW, ICE AND CLIMATE 2.1 Introduction 2.2 Surface energy balance 2.2.1 Changes of state and temperature 2.2.2 Shortwave radiation 2.2.3 Longwave radiation 2.2.4 Sensible and latent heat: turbulent fluxes 2.2.5 Energy supplied by rain 2.2.6 Why is glacier ice blue? 2.3 Ice temperature 2.3.1 The melting point of ice 2.3.2 Controls on ice temperature 2.3.3 Thermal structure of glaciers and ice sheets 2.4 Processes of accumulation and ablation 2.4.1 Snow and ice accumulation 2.4.2 Transformation of snow to ice 2.4.3 Melting of snow and ice 2.4.4 Sublimation and evaporation 2.4.5 The influence of debris cover 2.5 Mass balance 2.5.1 Definitions 2.5.2 Measurement of mass balance 2.5.3 Annual mass balance cycles 2.5.4 Mass balance gradients 2.5.5 The equilibrium line 2.5.6 Glaciation levels or glaciation thresholds 2.5.7 Glacier sensitivity to climate change 2.6 Glacier-climate interactions 2.6.1 Effects of glaciers and ice sheets on the atmosphere 2.7 Ice cores 2.7.1 Ice coring programmes 2.7.2 Stable isotopes 2.7.3 Ancient atmospheres: the gas content of glacier ice 2.7.4 Solutes and particulates 3 GLACIER HYDROLOGY 3.1 Introduction 3.2 Basic concepts 3.2.1 Water sources and routing 3.2.2 Hydraulic potential 3.2.3 Resistance to flow 3.2.4 Channel wall processes: melting, freezing and ice deformation 3.3 Supraglacial and englacial drainage 3.3.1 Supraglacial water storage and drainage 3.3.2 Englacial drainage 3.4 Subglacial drainage 3.4.1 Subglacial channels 3.4.2 Water films 3.4.3 Linked cavity systems 3.4.4 Groundwater flow 3.4.5 Water at the ice-sediment interface 3.5 Glacial hydrological systems 3.5.1 Temperate glaciers 3.5.2 Polythermal glaciers 3.5.3 Modelling glacial hydrological systems 3.6 Proglacial runoff 3.6.1 Seasonal and shorter-term cycles 3.6.2 Runoff and climate change 3.7 Glacial lakes and outburst floods 3.7.1 Introduction 3.7.2 Moraine-dammed lakes 3.7.3 Ice-dammed lakes 3.7.4 Icelandic subglacial lakes 3.7.5 Estimating GLOF magnitudes 3.8 Life in glaciers 3.8.1 Supraglacial ecosystems 3.8.2 Subglacial ecosystems 3.9 Glacier hydrochemistry 3.9.1 Overview 3.9.2 Snow chemistry 3.9.3 Chemical weathering processes 3.9.4 Subglacial chemical weathering 3.9.5 Proglacial environments 3.9.6 Rates of chemical erosion 4 PROCESSES OF GLACIER MOTION 4.1 Introduction 4.2 Stress and strain 4.2.1 Stress 4.2.2 Strain 4.2.3 Rheology: stress-strain relationships 4.2.4 Force balance in glaciers 4.3 Deformation of ice 4.3.1 Glen's Flow Law 4.3.2 Crystal fabric, impurities and water content 4.3.3 Ice creep velocities 4.4 Sliding 4.4.1 Frozen beds 4.4.2 Sliding of wet-based ice 4.4.3 Glacier-bed friction 4.4.4 The role of water 4.5 Deformable beds 4.5.1 The Boulton-Hindmarsh model 4.5.2 Laboratory testing of subglacial tills 4.5.3 Direct observations of deformable glacier beds 4.5.4 Rheology of subglacial till 4.6 Rates of basal motion 4.6.1 'Sliding laws' 4.6.2 Local and non-local controls on ice velocity 4.7 Crevasses and other structures: strain made visible 4.7.1 Crevasses 4.7.2 Crevasse patterns 4.7.3 Layering, foliation and related structures 5 GLACIER DYNAMICS 5.1 Introduction 5.2 Understanding glacier dynamics 5.2.1 Balance velocities 5.2.2 Deviations from the balance velocity 5.2.3 Changes in ice thickness: continuity 5.2.4 Thermodynamics 5.3 Glacier models 5.3.1 Overview 5.3.2 Equilibrium glacier profiles 5.3.3 Time-evolving glacier models 5.4 Dynamics of valley glaciers 5.4.1 Intra-annual velocity variations 5.4.2 Multi-annual variations 5.5 Calving glaciers 5.5.1 Flow of calving glaciers 5.5.2 Calving processes 5.5.3 'Calving laws' 5.5.4 Advance and retreat of calving glaciers 5.6 Ice shelves 5.6.1 Mass balance of k e shelves 5.6.2 Flow of ice shelves 5.6.3 Ice shelf break-up 5.7 Glacier surges 5.7.1 Overview 5.7.2 Distribution of surging glaciers 5.7.3 Temperate glacier surges 5.7.4 Polythermal surging glaciers 5.7.5 Surge mechanisms 6 THE GREENLAND AND ANTARCTIC ICE SHEETS 6.1 Introduction 6.2 The Greenland Ice Sheet 6.2.1 Overview 6.2.2 Climate and surface mass balance 6.2.3 Ice sheet flow 6.2.4 Ice streams and outlet glaciers 6.3 The Antarctic Ice Sheet 6.3.1 Overview 6.3.2 Climate and mass balance 6.3.3 Flow of inland ice 6.3.4 Ice streams 6.3.5 Hydrology and subglacial lakes 6.3.6 Ice stream stagnation and reactivation 6.3.7 Stability of the West Antarctic Ice Sheet 7 GLACIERS AND SEA LEVEL CHANGE 7.1 Introduction 7.2 Causes of sea-level change 7.2.1 Overview 7.2.2 Glacio-eustasy and global ice volume 7.2.3 Glacio-isostasy and ice sheet loading 7.3 Sea-level change over glacial-interglacial cycles 7.3.1 Ice sheet fluctuations and eustatic sea-level change 7.3.2 Sea-level histories in glaciated regions 7.4 Glaciers and recent sea-level change 7.4.1 Recorded sea-level change 7.4.2 Global glacier mass balance 7.5 Future sea-level change 7.5.1 IPCC climate and sea-level projections 7.5.2 Predicting the glacial contribution to sea-level change PART TWO GLACIATION 8 EROSIONAL PROCESSES, FORMS AND LANDSCAPES 8.1 Introduction 8.2 Subglacial erosion 8.2.1 Rock fracture: general principles 8.2.2 Abrasion 8.2,3 Quarrying 8.2.4 Erosion beneath cold ice 8.2.5 Erosion of soft beds 8.3 Small-scale erosional forms 8.3.1 Striae and polished surfaces 8.3.2 Rat tails 8.3.3 Chattermarks, gouges and fractures 8.3.4 P-forms 8.4 Intermediate-scale erosional forms 8.4.1 Roches moutonnees 8.4.2 Whalebacks and rock drumlins 8.4.3 Crag and tails 8.4.4 Channels 8.5 Large-scale erosional landforms 8.5.1 Rock basins and overdeepenings 8.5.2 Basins and overdeepenings in soft sediments 8.5.3 Troughs and fjords 8.5.4 Cirques 8.5.5 Strandflats 8.6 Landscapes of glacial erosion 8.6.1 Areal scouring 8.6.2 Selective linear erosion 8.6.3 Landscapes of little or no glacial erosion 8.6.4 Alpine landscapes 8.6.5 Cirque landscapes 8.6.6 Continent-scale patterns of erosion 9 DEBRIS ENTRAPMENT AND TRANSPORT 9.1 Introduction 9.2 Approaches to the study of glacial sediments 9.2.1 The glacial debris cascade 9.2.2 Spatial hierarchies of sediments and landforms 9.3 Glacial debris entrainment 9.3.1 Supraglacial debris entrainment 9.3.2 Incorporation of debris into basal ice 9.4 Debris transport and release 9.4.1 Subglacial transport 9.4.2 High-level debris transport 9.4.3 Glacifluvial transport 9.5 Effects of transport on debris 9.5.1 Granulometry 9.5.2 Clast morphology 9.5.3 Particle micromorphology 10 GLACIGENIC SEDIMENTS AND DEPOSITIONAL PROCESSES 10.1 Introduction 10.2 Sediment description and classification 10.2.1 Sediment description 10.2.2 Deformation structures 10.2.3 Primary and secondary deposits 10.3 Primary glacigenic deposits (till) 10.3.1 Overview 10.3.2 Processes of subglacial till formation 10.3.3 Glacitectonite 10.3.4 Subglacial traction till 10.4 Glacifluvial deposits 10.4.1 Terminology and classification of glacifluvial sediments 10.4.2 Plane bed deposits 10.4.3 Ripple cross-laminated facies 10.4.4 Dunes 10.4.5 Antidunes 10.4.6 Scour and minor channel fills 10.4.7 Gravel sheets 10.4.8 Silt and mud drapes 10.4.9 Hyperconcentrated flow deposits 10.5 Gravitational mass movement deposits and syn-sedimentary deformation structures 10.5.1 Overview 10.5.2 Fall deposits 10.5.3 Slide and slump deposits 10.5.4 Debris (sediment-gravity) flow deposits 10.5.5

Note: Contents: 1 Carbon on earth. - 2 The stable geologic carbon cycle. - 3 The unstable ice age carbon cycle. - 4 The present and future carboncycle - stable or unstable?. - 5 Methane.

Note: Contents Preface to the Second Edition Preface to the First Edition 1. Images, Arrays, and Matrices 1.1 Multispectral Satellite Images 1.2 Algebra of Vectors and Matrices 1.2.1 Elementary Properties 1.2.2 Square Matrices 1.2.3 Singular Matrices 1.2.4 Symmetric, Positive Definite Matrices 1.2.5 Linear Dependence and Vector Spaces 1.3 Eigenvalues and Eigenvectors 1.4 Singular Value Decomposition 1.5 Vector Derivatives 1.6 Finding Minima and Maxima 1.7 Exercises 2. Image Statistics 2.1 Random Variables 2.1.1 Discrete Random Variables 2.1.2 Continuous Random Variables 2.1.3 Normal Distribution 2.2 Random Vectors 2.3 Parameter Estimation 2.3.1 Sampling a Distribution 2.3.2 Interval Estimation 2.3.3 Provisional Means 2.4 Hypothesis Testing and Sample Distribution Functions 2.4.1 Chi-Square Distribution 2.4.2 Student-t Distribution 2.4.3 F-Distribution 2.5 Conditional Probabilities, Bayes' Theorem, and Classification 2.6 Ordinary Linear Regression 2.6.1 One Independent Variable 2.6.2 More Than One Independent Variable 2.6.3 Regularization, Duality, and the Gram Matrix 2.7 Entropy and Information 2.7.1 Kullback-Leibler Divergence 2.7.2 Mutual Information 2.8 Exercises 3. Transformations 3.1 Discrete Fourier Transform 3.2 Discrete Wavelet Transform 3.2.1 Haar Wavelets 3.2.2 Image Compression 3.2.3 Multiresolution Analysis 3.2.3.1 Dilation Equation and Refinement Coefficients 3.2.3.2 Cascade Algorithm 3.2.3.3 Mother Wavelet 3.2.3.4 Daubechies D4 Scaling Function 3.3 Principal Components 3.3.1 Primal Solution 3.3.2 Dual Solution 3.4 Minimum Noise Fraction 3.4.1 Additive Noise 3.4.2 Minimum Noise Fraction Transformation in ENVI 3.5 Spatial Correlation 3.5.1 Maximum Autocorrelation Factor 3.5.2 Noise Estimation 3.6 Exercises 4. Filters, Kernels, and Fields 4.1 Convolution Theorem 4.2 Linear Filters 4.3 Wavelets and Filter Banks 4.3.1 One-Dimensional Arrays 4.3.2 Two-Dimensional Arrays 4.4 Kernel Methods 4.4.1 Valid Kernels 4.4.2 Kernel PCA 4.5 Gibbs-Markov Random Fields 4.6 Exercises 5. Image Enhancement and Correction 5.1 Lookup Tables and Histogram Functions 5.2 Filtering and Feature Extraction 5.2.1 Edge Detection 5.2.2 Invariant Moments 5.3 Panchromatic Sharpening 5.3.1 HSV Fusion 5.3.2 Brovey Fusion 5.3.3 PCA Fusion 5.3.4 DWT Fusion 5.3.5 A Trous Fusion 5.3.6 Quality Index 5.4 Topographic Correction 5.4.1 Rotation, Scaling, and Translation 5.4.2 Imaging Transformations 5.4.3 Camera Models and RFM Approximations 5.4.4 Stereo Imaging and Digital Elevation Models 5.4.5 Slope and Aspect 5.4.6 Illumination Correction 5.5 Image-Image Registration 5.5.1 Frequency-Domain Registration 5.5.2 Feature Matching 5.5.2.1 High-Pass Filtering 5.5.2.2 Closed Contours 5.5.2.3 Chain Codes and Moments 5.5.2.4 Contour Matching 5.5.2.5 Consistency Check 5.5.2.6 Implementation in IDL 5.5.3 Resampling and Warping 5.6 Exercises 6. Supervised Classification: Part 1 6.1 Maximum a Posteriori Probability 6.2 Training Data and Separability 6.3 Maximum Likelihood Classification 6.3.1 ENVI's Maximum Likelihood Classifier 6.3.2 Modified Maximum Likelihood Classifier 6.4 Gaussian Kernel Classification 6.5 Neural Networks 6.5.1 Neural Network Classifier 6.5.2 Cost Functions 6.5.3 Backpropagation 6.5.4 Overfitting and Generalization 6.6 Support Vector Machines 6.6.1 Linearly Separable Classes 6.6.1.1 Primal Formulation 6.6.1.2 Dual Formulation 6.6.1.3 Quadratic Programming and Support Vectors 6.6.2 Overlapping Classes 6.6.3 Solution with Sequential Minimal Optimization 6.6.4 Multiclass SVMs 6.6.5 Kernel Substitution 6.6.6 Modified SVM Classifier 6.7 Exercises 7. Supervised Classification: Part 2 7.1 Postprocessing 7.1.1 Majority Filtering 7.1.2 Probabilistic Label Relaxation 7.2 Evaluation and Comparison of Classification Accuracy 7.2.1 Accuracy Assessment 7.2.2 Model Comparison 7.3 Adaptive Boosting 7.4 Hyperspectral Analysis 7.4.1 Spectral Mixture Modeling 7.4.2 Unconstrained Linear Unmixing 7.4.3 Intrinsic End-Members and Pixel Purity 7.5 Exercises 8. Unsupervised Classification 8.1 Simple Cost Functions 8.2 Algorithms That Minimize the Simple Cost Functions 8.2.1 K-Means Clustering 8.2.2 Kernel K-Means Clustering 8.2.3 Extended K-Means Clustering 8.2.4 Agglomerative Hierarchical Clustering 8.2.5 Fuzzy K-Means Clustering 8.3 Gaussian Mixture Clustering 8.3.1 Expectation Maximization 8.3.2 Simulated Annealing 8.3.3 Partition Density 8.3.4 Implementation Notes 8.4 Including Spatial Information 8.4.1 Multiresolution Clustering 8.4.2 Spatial Clustering 8.5 Benchmark 8.6 Kohonen Self-Organizing Map 8.7 Image Segmentation 8.7.1 Segmenting a Classified Image 8.7.2 Object-Based Classification 8.7.3 Mean Shift 8.8 Exercises 9. Change Detection 9.1 Algebraic Methods 9.2 Postclassification Comparison 9.3 Principal Components Analysis 9.3.1 Iterated PCA 9.3.2 Kernel PCA 9.4 Multivariate Alteration Detection 9.4.1 Canonical Correlation Analysis 9.4.2 Orthogonality Properties 9.4.3 Scale Invariance 9.4.4 Iteratively Reweighted MAD 9.4.5 Correlation with the Original Observations 9.4.6 Regularization 9.4.7 Postprocessing 9.5 Decision Thresholds and Unsupervised Classification of Changes 9.6 Radiometrie Normalization 9.7 Exercises Appendix A: Mathematical Tools A.l Cholesky Decomposition A.2 Vector and Inner Product Spaces A.3 Least Squares Procedures A.3.1 Recursive Linear Regression A.3.2 Orthogonal Linear Regression Appendix B: Efficient Neural Network Training Algorithms B.1 Hessian Matrix B.1.1 R-Operator B.1.1.1 Determination of Rv{n} B.1.1.2 Determination of Rv{δo} B.1.1.3 Determination of Rv{δh} B.1.2 Calculating the Hessian B.2 Scaled Conjugate Gradient Training B.2.1 Conjugate Directions B.2.2 Minimizing a Quadratic Function B.2.3 Algorithm B.3 Kaiman Filter Training B.3.1 Linearization B.3.2 Algorithm B.4 A Neural Network Classifier with Hybrid Training Appendix C: ENVI Extensions in IDL C.1 Installation C.2 Extensions C.2.1 Kernel Principal Components Analysis C.2.2 Discrete Wavelet Transform Fusion C.2.3 A Trous Wavelet Transform Fusion C.2.4 Quality Index C.2.5 Calculating Heights of Man-Made Structures in High-Resolution Imagery C.2.6 Illumination Correction C.2.7 Image Registration C.2.8 Maximum Likelihood Classification C.2.9 Gaussian Kernel Classification C.2.10 Neural Network Classification C.2.11 Support Vector Machine Classification C.2.12 Probabilistic Label Relaxation C.2.13 Classifier Evaluation and Comparison C.2.14 Adaptive Boosting a Neural Network Classifier C.2.15 Kernel K-Means Clustering C.2.16 Agglomerative Hierarchical Clustering C.2.17 Fuzzy K-Means Clustering C.2.18 Gaussian Mixture Clustering C.2.19 Kohonen Self-Organizing Map C.2.20 Classified Image Segmentation C.2.21 Mean Shift Segmentation C.2.22 Multivariate Alteration Detection C.2.23 Viewing Changes C.2.24 Radiometric Normalization Appendix D: Mathematical Notation References Index

Note: Contents: Preface. - 1 Cosmic rays. - 1.1 Origin and nature of cosmic rays. - 1.2 Interaction with magnetic fields. - 1.3 Interactions with the Earth's atmosphere. - 1.4 Interactions with the Earth's surface. - 1.5 Production of cosmogenic nuclides. - 1.6 Detection of cosmic rays. - 2 Cosmogenic nuclides. - 2.1 'Useful' cosmogenic nuclides. - 2.2 Stable cosmogenic nuclides. - 2.3 Cosmogenic radionuclides. - 2.4 Sample preparation. - 2.5 Analytical methods. - 3 Production rates and scaling factors. - 3.1 Deriving production rates. - 3.2 Scaling factors. - 3.3 Building scaling factors. - 4 Application of cosmogenic nuclldes to Earth surface sciences. - 4.1 Exposure dating. - 4.2 Burial dating. - 4.3 Erosion/denudation rates. - 4.4 Uplift rates. - 4.5 Soil dynamics. - 4.6 Dealing with uncertainty. - Appendix A: Sampling checklist. - Appendix B: Reporting of cosrnogenic-nudide data for exposure age and erosion rate determinations. - References. - Index.

Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.

Note: Ersch. unregelmäßig , Beiträge teilweise in Englisch

Note: Contents: Preface. - Acknowledgements. - PART 1 INTRODUCTION. - 1 Introduction. - 1.1 Humans and the coastal zone. - 1.2 Approaches to the study of coasts. - 1.3 Information sources. - 1.4 Approach and organisation. - References. - 2. Coastal geomorphology. - 2.1 Definition and scope of coastal geomorphology. - 2.2 The coastal zone: definition and nomenclature. - 2.3 Factors influencing coastal morphology and processes. - References. - PART 2 COASTAL PROCESSES. - 3. Sea level fluctuations and changes. - 3.1 Synopsis. - 3.2 Mean sea level, the geoid, and changes in mean sea level. - 3.3 Changes in mean sea level. - 3.4 Astronomical tides. - 3.5 Short-term dynamic changes in sea level. - 3.6 Climate change and sea level rise. - References. - 4. Wind-generated waves. - 4.1 Synopsis. - 4.2 Definition and characteristics of waves. - 4.3 Measurement and description of waves. - 4.4 Wave generation. - 4.5 Wave prediction. - 4.6 Wave climate. - Further reading. - Preferences. - 5. Waves - wave theory and wave dynamics. - 5.1 Synopsis. - 5.2 Wave theories. - 5.3 Wave shoaling and refraction. - 5.4 Wave breaking. - 5.5 Wave groups and low-frequency energy in the surf and swash zones. - Further reading. - References. - 6. Surf zone circulation. - 6.1 Synopsis. - 6.2 Undertow. - 6.3 Rip cells. - 6.4 Longshore currents. - 6.5 Wind and tidal currents. - Further reading. - References. - 7. Coastal sediment transport. - 7.1 Synopsis. - 7.2 Sediment transport mechanisms, boundary layers and bedforms. - 7.3 On-offshore sand transport. - 7.4 Longshore sand transport. - 7.5 Littoral sediment budget and littoral drift cells. - Further reading. - References. - PART 3 COASTAL SYSTEMS. - 8. Beach and nearshore systems. - 8.1 Synopsis. - 8.2 Beach and nearshore sediments and morphology. - 8.3 Nearshore morphodynamics. - 8.4 Beach morphodynamics. - References. - 9. Coastal sand dunes. - 9.1 Synopsis. - 9.2 Morphological components of coastal dunes and dune fields. - 9.3 Plant communities of coastal dunes. - 9.4 Aeolian processes in coastal dunes. - 9.5 Sand deposition. - 9.6 Beach / dune interaction and foredune evolution. - 9.7 Management of coastal dunes. - References. - 10. Barrier systems. - 10.1 Synopsis. - 10.2 Barrier types and morphology. - 10.3 Barrier dynamics: overwash and inlets. - 10.4 Barrier spit morphodynamics. - 10.5 Barrier islands. - 10.6 Management of barrier systems. - References. - 11. Salt marshes and mangroves. - 11.1 Synopsis. - 11.2 Saltmarsh and mangrove ecosystems. - 11.3 Salt marshes. - 11.4 Mangroves. - 11.5 Conservation and management of saltmarshes and mangroves. - Further reading. - References. - 12. Coral reefs and atolls. - 12.1 Synopsis. - 12.2 Corals and reef formation. - 12.3 Geomorphology and sedimentology of coral reefs. - 12.4 Impacts of disturbance on coral reefs. - Further reading. - References. - 13. Cliffed and rocky coasts. - 13.1 Synopsis. - 13.2 Cliffed coast morphology. - 13.3 Cliffed coast erosion system. - 13.4 Cohesive bluff coasts. - 13.5 Rock coasts. - 13.6 Shore platforms. - 13.7 Management of coastal cliff shorelines. - Further reading. - References. - Index

Note: Introduction -- Sanctioning models : theories and their scope -- Methodology for a virtual world -- A tale of two methods -- When theories shake hands -- Models of climate : values and uncertainties -- Reliability without truth -- Conclusion..

Note: The basics -- Matching, covering and packing -- Connectivity -- Planar graphs -- Colouring -- Flows -- Extremal graph theory -- Infinite graphs -- Ramsey theory for graphs -- Hamilton cycles -- Random graphs -- Minors, trees, and WQO..

Note: Chapter 1 Not Another Crisis! -- Chapter 2 From Abundance to Scarcity in 25 Years -- Chapter 3 Causes of Water Scarcity -- Chapter 4 Climate Change and Water -- Chapter 5 Agriculture and Water -- Chapter 6 Water, Food, and Poverty -- Chapter 7 Integrating Water Planning and Management -- Chapter 8 Water Governance for People and the Environment -- Chapter 9 Water Rights and Water Costs -- Chapter 10 Solving the World’s Water Problems

Note: Inhalt = Content 1. Vorwort = Introduction 2. Ausgewählte Forschungsthemen = Selected research topics Methanemission aus dem Permafrost im Lena-Delta = Methane emission from permafrost in the Lena River Delta / Torsten Sachs, Julia Boike Neue Biomarker belegen Schwankungen der arktischen Meereisbedeckung während der letzten 30.000 Jahre = New biomarkers reveal fluctuations in Arctic sea ice cover during the past 30,000 years / Juliane Müller, Rüdiger Stein Die Stabilität des Westantarktischen Eisschildes – Ergebnisse der ANDRILL Tiefbohrungen = The stability of the West Antarctic ice sheet – results of ANDRILL deep drilling operations / Gerhard Kuhn, Frank Niessen Meeresalgen global - detaillierter Blick aus dem All = Detailed view from space – marine algae globally observed / Astrid Bracher, Tilman Dinter, Ilka Peeken, Bettina Schmitt Was verrät der Jahreszyklus über die Klimaentwicklung der letzten Millionen Jahre? = What does the annual cycle tell us about climate change in the last millions of years? / Thomas Laepple, Gerrit Lohmann Der Puls der Atmosphäre: Dekadisches Auf und Ab / The pulse of the tmosphere: The decadal Ups and Downs / Dörthe Handorf, Klaus Dethloff, Sascha Brand, Matthias Läuter Das Eisendüngungsexperiment LOHAFEX = The Iron Fertilization Experiment LOHAFEX / Philipp Assmy, Christine Klaas, Victor Smetacek, Dieter Wolf-Gladrow Ein nützliches genetisches Erbe - Wie alte Gene das Überleben in neuen Lebensräumen ermöglichen = A convenient genetic heritage - How ancestral genes help to survive in new habitats / Doris Abele, Ellen Weihe, Magnus Lucassen, Christoph Held, Kevin Pöhlmann Verursacher von Muschelvergiftungen identifiziert = Cause of Shellfish Poisoning Identified / Urban Tillmann, Malte Elbrächter, Bernd Krock, Uwe John, Allan Cembella Mikrobielle Stoffumsätze im Klimawandel = Climate change and the microbial cycling of organic matter / Anja Engel, Judith Piontek, Mascha Wurst, Nicole Händel, Mirko Lunau, Corinna Borchard 3. Forschung = Research PACES 3.1 TOPIC 1: The changing Arctic and Antarctic 3.2 TOPIC 2: Coastal change 3.3 TOPIC 3: Lehrstunden aus der Erdgeschichte = Lessons from the past 3.4 TOPIC 4: Das Erdsystem aus polarer Perspektive = The Earth System from a Polar Perspective 4. Helmholtz-Nachwuchsgruppen = Helmholtz Young Investigator Groups 5. Entwicklungen in den Fachbereichen = Progresses in the scientific divisions 6. Tiefseeökologie und -technologie (HGF-MPG) = Deep-sea ecology and technology (HGF-MPG) 7. Logistik und Forschungsplattformen = Logistics and research platforms 8. Nationale und internationale Zusammenarbeit = National and international cooperation 9. Wissenschaftliches Rechenzentrum = Scientific data processing centre 10. Bibliothek = Library 11. Technologietransfer = Technology transfer 12. Kommunikation und Medien = Communications and Media 13. Schulprojekt = School project 14. Personeller Aufbau und Haushaltsentwicklung = Personnel structure and budget trends 15. Veröffentlichungen, Patente = Publications, patents Anhang = Annex , In deutscher und englischer Sprache

Note: PART I: BIOSPHERE - 1. Forest disturbance assessment using satellite data of moderate and low resolution / M. A. Korets, V. A. Ryzhkova, A. I. Sukhinin, S. A. Bartalev and I. V. Danilova 2. Fire / climate interactions in Siberia / Heiko Balzter, Kevin Tansey, Jorg Kaduk, Charles George, France Gerard, Maria Cuevas Gonzalez, Anatoly Sukhinin and Evgeni Ponomarev 3. Long-term dynamics of mixed fir-aspen forests in West Sayan (Altai-Sayan Ecoregion) / D. M. Ismailova and D. I. Nazimova 4. Evidence of evergreen conifers invasion into larch dominated forests during recent decades / V. I. Kharuk, K. J. Ranson and M. L. Dvinskaya 5. Potential climate-induced vegetation change in Siberia in the 21st century / N. M. Tchebakova , E. I. Parfenova, and A. J. Soja 6. Wildfire dynamics in mid-Siberian larch dominated forests / V. I. Kharuk, K. J. Ranson and M. L. Dvinskaya 7. Dendroclimatological evidence of climate changes across Siberia / Vladimir V. Shishov, Eugene A. Vaganov 8. Siberian pine and larch response to climate warming in the southern Siberian mountain forest: tundra ecotone / V. I. Kharuk, K. J. Ranson, M. L. Dvinskaya and S. T. Im PART II: HYDROSPHERE 9. Remote sensing of spring snowmelt in Siberia / A. Bartsch, W. Wagner and R. Kidd 10. Response of river runoff in the cryolithic zone of Eastern Siberia (Lena River Basin) to future climate warming / A. G. Georgiadi, I. P. Milyukova and E. A. Kashutina PART III: ATMOSPHERE 11. Investigating regional scale processes using remotely sensed atmospheric CO2 column concentrations from SCIAMACHY / M. P. Barkley, A. J. Hewitt and P. S. Monks 12. Climatic and geographic patterns of spatial distribution of precipitation in Siberia / A. Onuchin and T. Burenina PART IV: INFORMATION SYSTEMS 13. Interoperability, data discovery and access: the e-Infrastructures for Earth Sciences resources / Stefano Nativi, Christiana Schmullius, Lorenzo Bigagli and Roman Gerlach 14. Development of a web based information-computational infrastructure for the Siberia Integrated Regional Study / E. P. Gordov, A. Z. Fazliev, V. N. Lykosov, I. G. Okladnikov and A. G. Titov 15. Conclusions / Heiko Balzter. - Appendix. - Index.

Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..

Note: Text dt. und engl. - Text in Faltbl. [1] dt.

Note: Text dt. und engl.

Note: Thinking differently for an age of complexity -- How can theory improve practice? -- Stories from the field -- The praxis of collaboration -- Dialogue as a community of inquiry -- Knowledge into action : the role of dialogue -- Using local knowledge for justice and resilience -- Beyond collaboration : democratic governance for a resilient society..

Note: Aus dem Franz. übers.

Note: Zugleich: Dissertation, Freie Unversität Berlin, [ca. 1963] , INHALTSVERZEICHNIS PROBLEMSTELLUNG UND ZIELSETZUNG 1. BEMERKUNGEN ZUM BEOBACHTUNGSGELÄNDE UND ZUM BEOBACHTUNGSMATERIAL 1.1 Das Beobachtungsgelände 1.2 Das Beobachtungsmaterial 2. HOMOGENITÄTSBETRACHTUNGEN 2.1 Temperatur 2.2 Niederschlag 2.3 Wind 2.4 Sonnenschein und Bewölkung 3. TEMPERATURVERHÄLTNISSE 3.1 Monats- und Jahreswerte 3.2 Tageswerte 3.3 Pentadenwerte 3.4 Häufigkeitsbetrachtungen 3.5 Interdiurne Veränderlichkeit 3.6 Der tägliche Gang 3.7 Vorkommen bestimmter Schwellenwerte 3.71 Frost- und Eistage 3.72 Sommer- und Tropentage 4. DER WASSERGEHALT DER LUFT 4.1 Monats- und Jahreswerte 4.2 Tageswerte 4.3 Häufigkeitsbetrachtungen 4.4 Interdiurne Veränderlichkeit 4.5 Der tägliche Gang 5. BEWÖLKUNGSVERHÄLTNISSE 5.1 Monats- und Jahreswerte 5.2 Tageswerte 5.3 Häufigkeitsbetrachtungen 5.4 Der tägliche Gang 5.5 Heitere und trübe Tage 5.6 Nebel 6. SONNENSCHEIN 6.1 Monats- und Jahreswerte 6.2 Tageswerte 6.3 Der tägliche Gang 7. NIEDERSCHLAGSVERHÄLTNISSE 7.1 Monats- und Jahreswerte 7.2 Niederschlagsbereitschaft 7.3 Tageswerte 7.4 Der tägliche Gang 7.5 Häufigkeitsbetrachtungen 7.6 Niederschlags- und Trockenperioden 7.7 Niederschlag und Wind· 7.8 Schneeverhältnisse 7.81 Schneefall und Schneedecke 7.82 Schneehöhe 7.9 Gewitter 8. WINDVERHÄLTNISSE 8.1 Windrichtung 8.2 Windgeschwindigkeit 8.21 Der jährliche Gang 8.22 Häufigkeitsbetrachtungen 8.23 Sturmtage und Windstillen 8.24 Der tägliche Gang 9.ZUSAMMENFASSUNG VERZEICHNIS DER TEXTTABELLEN VERZEICHNIS DER ABBILDUNGEN LITERATURVERZEICHNIS TABELLENANHANG

Note: Contents: Einleitung ; I Theorie ; 1 Typologie politischer Systeme ; 2 Die Stabilität politischer Systeme ; 3 Transformationsbegriffe ; 4 Transformationstheorien ; 5 Massen und Eliten in der Transformation ; 6 Transformationsphasen ; II Die Demokratisierungswellen des 20. Jahrhunderts ; 1 Die erste Demokratisierungswelle: Die Entstehung von Demokratien ; 2 Die erste autokratische Gegenwelle: Der Zusammenbruch von Demokratien ; 3 Die zweite Demokratisierungswelle: Die Nachkriegsdemokratien in Deutschland, Italien und Japan ; III Die Dritte Demokratisierungswelle: Südeuropa ; 1 Die Demokratisierung in Südeuropa ; IV Die dritte Demokratisierungswelle: Lateinamerika ; 1 Typen autoritärer Regime ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung ; 5 Fazit und Ausblick ; V Die dritte Demokratisierungswelle: Ost- und Südostasien ; 1 Typen autoritärer Regime ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung ; 5 Fazit: Die Konsolidierung im Vergleich ; 6 Gibt es eine "asiatische Form" der Demokratie? ; VI Die dritte Demokratisierungswelle: Osteuropa ; 1 Die besondere Transformationsproblematik in Osteuropa ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung: Ungarn, Polen, Russland und Belarus im Vergleich ; VII Externe Demokratisierung ; 1 Demokratieförderung ; 2 Demokratisierung "durch" Krieg? ; Ausblick: Kehren die Diktaturen zurück? ; 1 Theoretische Paradigmen und empirische Artefakte ; Gegenwartsdiagnose ; Zukunftsprognose

Note: Zugl.: Marburg (Lahn), Univ., Habil.-Schr., 2004 u.d.T.: Gutmann, Mathias: Die Medialität des Erfahrens

Note: Zugl.: Berlin, TU, Fakultät VII - Wirtschaft und Management, Diss., 2009

Note: Contents: 1. A looming crisis Part I Status and challenges 2. Rising demand and dwindling per capita resources 3. Water and poverty 4. Governance and finance 5. Pollution and water-related disease 6. Water, land and wildlife 7. Dams and diversions 8. Trading water - real and virtual 9. Water, war and terrorism 10. The threat of global warming Part II Nature's resources 11. The restless water cycle 12. Shrinking freshwater stores Part III Towards sustainability 13. Cutting demand 14. Increasing supplies 15. Cleaning up and protecting the aquatic environment 16. Using seawater 17. Controlling the weather 18. Improved monitoring and data management 19. Improving prediction and risk assessment 20. Improving management and justice 21. Aid for the developing world Conclusions 22. Is sustainability achievable?

Note: Fundamental Concepts -- Introduction and overview -- Introduction to quantum mechanics -- Introduction to computer science -- Quantum Computation -- Quantum circuits -- The quantum Fourier transform and its applications -- Quantum search algorithms -- Quantum computers: physical realisation -- Quantum Information -- Quantum noise, open quantum systems, and quantum operations -- Distance measurement for quantum information -- Quantum error-correction -- Entropy and information -- Quantum information theory -- Notes on basic probability theory -- Group theory -- Approximating quantum gates: the Solovay-Kitaev theorem -- Number theory -- Public-key cryptography and the RSA cryptosystem -- Proof of Lieb's theorem.

Note: Includes bibliographical references and index

Note: Zugleich: Dissertation, Freie Unversität Berlin, [ca. 1963] , INHALTSVERZEICHNIS PROBLEMSTELLUNG UND ZIELSETZUNG 1. BEMERKUNGEN ZUM BEOBACHTUNGSGELÄNDE UND ZUM BEOBACHTUNGSMATERIAL 1.1 Das Beobachtungsgelände 1.2 Das Beobachtungsmaterial 2. HOMOGENITÄTSBETRACHTUNGEN 2.1 Temperatur 2.2 Niederschlag 2.3 Wind 2.4 Sonnenschein und Bewölkung 3. TEMPERATURVERHÄLTNISSE 3.1 Monats- und Jahreswerte 3.2 Tageswerte 3.3 Pentadenwerte 3.4 Häufigkeitsbetrachtungen 3.5 Interdiurne Veränderlichkeit 3.6 Der tägliche Gang 3.7 Vorkommen bestimmter Schwellenwerte 3.71 Frost- und Eistage 3.72 Sommer- und Tropentage 4. DER WASSERGEHALT DER LUFT 4.1 Monats- und Jahreswerte 4.2 Tageswerte 4.3 Häufigkeitsbetrachtungen 4.4 Interdiurne Veränderlichkeit 4.5 Der tägliche Gang 5. BEWÖLKUNGSVERHÄLTNISSE 5.1 Monats- und Jahreswerte 5.2 Tageswerte 5.3 Häufigkeitsbetrachtungen 5.4 Der tägliche Gang 5.5 Heitere und trübe Tage 5.6 Nebel 6. SONNENSCHEIN 6.1 Monats- und Jahreswerte 6.2 Tageswerte 6.3 Der tägliche Gang 7. NIEDERSCHLAGSVERHÄLTNISSE 7.1 Monats- und Jahreswerte 7.2 Niederschlagsbereitschaft 7.3 Tageswerte 7.4 Der tägliche Gang 7.5 Häufigkeitsbetrachtungen 7.6 Niederschlags- und Trockenperioden 7.7 Niederschlag und Wind· 7.8 Schneeverhältnisse 7.81 Schneefall und Schneedecke 7.82 Schneehöhe 7.9 Gewitter 8. WINDVERHÄLTNISSE 8.1 Windrichtung 8.2 Windgeschwindigkeit 8.21 Der jährliche Gang 8.22 Häufigkeitsbetrachtungen 8.23 Sturmtage und Windstillen 8.24 Der tägliche Gang 9.ZUSAMMENFASSUNG VERZEICHNIS DER TEXTTABELLEN VERZEICHNIS DER ABBILDUNGEN LITERATURVERZEICHNIS TABELLENANHANG