ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • English  (4,307)
  • German  (2,833)
  • Italian  (3)
  • Finnish  (2)
  • German  (1)
  • Dutch
  • 2010-2014  (7,102)
Collection
Keywords
Language
Years
Year
  • 1
    Call number: AWI G5-10-0074 ; M 11.0047
    In: Developments in paleoenvironmental research
    Description / Table of Contents: Chapter 1: High-resolution Paleoclimatology - R. Bradley What is high-resolution paleoclimatology? What are its major achievements? What opportunities and challenges does it now face? What should dendroclimatology's role be in this? Chapter 2: Dendroclimatology in high-resolution Paleoclimatology - M. K. Hughes, H. F. Diaz and Th. W. Swetnam An overview of the development of dendroclimatology and an introduction to the questions posed in this book. Scientific bases of dendroclimatology Chapter 3: How well understood are the processes that create tree-ring records? - G. Vaganov Starting at the most basic level of the environmental control of tree-ring formation, do we have the necessary biological and ecophysiological understanding of this to support inferences about climate variability from tree rings? What are the weak points of this understanding and how might they be strengthened? Chapter 4: The state of the art of quantitative methods in dendroclimatology - E. Cook How sound are the quantitative techniques commonly used in dendroclimatology, in chronology building, identification and reconstruction of climate variables and the checking of these reconstructions? Are they appropriate to the material being analyzed and to the climatological problems being addressed? How might they be improved? Chapter 5: Detecting low-frequency change using tree rings - K. Briffa What limits the ability of tree-ring records to faithfully record climate variability at low frequencies (multi-centennial to millennial)? How might those limitations be overcome, if at all? What are the advantages and limitations of older and more novel approaches? What are the implications of these limitations? Reconstruction of climate patterns and values relative to today's climate Chapter 6: Dendroclimatology at regional and continental scales - R. Villalba What have been the major contributions of dendroclimatology to climatology so far? In what regions and for which climate problems is exciting progress now being made? What next? Chapter 7: Dendroclimatology at hemispheric and global scales - M. K. Hughes and M. Mann What are the achievements of dendroclimatology as applied at hemispheric and global scales climate patterns, circulation indices and large-scale means? What are the limitations of this approach? How might they be overcome? How might dendroclimatology contribute to the study of central pressing problems such as "How big is climate sensitivity? How has the last century, and especially recent decades, compared with earlier centuries? How faithful a representation of variability in recent centuries does the 20th century instrumental record give? Particular attention will be given to: a) identifying the most robust findings; and b) the most serious limitations. Chapter 8: Dendroclimatology, dendrohydrology and water resources management - C. Woodhouse and D. Meko How may dendroclimatology contribute to the study of water resources? How may it be used to inform modern public and decision-maker expectations of climate variability? Chapter 9: Dendroclimatology and the ecosystem impacts of climate - Th. W. SwetnamHow has dendroclimatology contributed to disturbance ecology? What is the significance of the recent changes in tree-growth-climate relationships observed in some regions, not only for dendroclimatology, but also for the understanding of the impacts of climate variability and change on ecosystems? Chapter 10: Dendroclimatology and the understanding of the interactions between climate variability and ancient human societies - D. Stahle and J. DeanHow has dendroclimatology contributed to understanding of the relationships between climate variability and societies in ancient times? Chapter 11: Tree rings and climate- sharpening the focus - M. K. Hughes, H. F. Diaz and Th. W. Swetnam What has been learned, using tree rings, about natural climate variability and its environmental and social impacts? What are the most significant strengths and weaknesses of dendroclimatology and the needs of, and opportunities for, future work.
    Description / Table of Contents: This volume presents an overview of the current state of dendroclimatology, its contributions over the last 30 years, and its future potential. The material included is useful not only to those who generate tree-ring records of past climate-dendroclimatologists, but also to users of their results - climatologists, hydrologists, ecologists and archeologists.
    Type of Medium: Monograph available for loan
    Pages: xii, 365 S. : Ill., graph. Darst.
    ISBN: 9781402040108
    Series Statement: Developments in paleoenvironmental research 11
    Classification:
    Historical Geology
    Language: English
    Note: Contents: Part I Introductory Section. - 1 High-Resolution Paleoclimatology / Raymond S. Bradley. - 2 Dendroclimatology in High-Resolution Paleoclimatology / Malcolm K. Hughes. - Part II Scientific Bases of Dendroclimatology. - 3 How Well Understood Are the Processes that Create Dendroclimatic Records? A Mechanistic Model of the Climatic Control on Conifer Tree-Ring Growth Dynamics / Eugene A. Vaganov, Kevin J. Anchukaitis, and Michael N. Evans. - 4 Uncertainty, Emergence, and Statistics in Dendrochronology / Edward R. Cook and Neil Pederson. - 5 A Closer Look at Regional Curve Standardization of Tree-Ring Records: Justification of the Need, a Warning of Some Pitfalls, and Suggested Improvements in Its Application / Keith R. Briffa and Thomas M. Melvin. - 6 Stable Isotopes in Dendroclimatology: Moving Beyond ‘Potential’ / Mary Gagen, Danny McCarroll, Neil J. Loader, and Iain Robertson. - Part III Reconstruction of Climate Patterns and Values Relative to Today’s Climate. - 7 Dendroclimatology from Regional to Continental Scales: Understanding Regional Processes to Reconstruct Large-Scale Climatic Variations Across the Western Americas / Ricardo Villalba, Brian H. Luckman, Jose Boninsegna,Rosanne D. D’Arrigo, Antonio Lara, Jose Villanueva-Diaz, Mariano Masiokas, Jaime Argollo, Claudia Soliz, Carlos LeQuesne, David W. Stahle, Fidel Roig, Juan Carlos Aravena, Malcolm K. Hughes, Gregory Wiles, Gordon Jacoby, Peter Hartsough, Robert J.S. Wilson, Emma Watson, Edward R. Cook, Julian Cerano-Paredes, Matthew Therrell, Malcolm Cleaveland, Mariano S. Morales, Nicholas E. Graham, Jorge Moya, Jeanette Pacajes, Guillermina Massacchesi, Franco Biondi, Rocio Urrutia, and Guillermo Martinez Pastur. - Part IV Applications of Dendroclimatology. - 8 Application of Streamflow Reconstruction to Water Resources Management / David M. Meko and Connie A. Woodhouse. - 9 Climatic Inferences from Dendroecological Reconstructions / Thomas W. Swetnam and Peter M. Brown. - 10 North American Tree Rings, Climatic Extremes, and Social Disasters / David W. Stahle and Jeffrey S. Dean. - Part V Overview. - 11 Tree Rings and Climate: Sharpening the Focus / Malcolm K. Hughes, Henry F. Diaz, and Thomas W. Swetnam. - Index.
    Location: Upper compact magazine
    Branch Library: AWI Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    Call number: AWI A14-10-0012
    Description / Table of Contents: Demonstrating the breadth and depth of growth in the field since the publication of the popular first edition, Image Analysis, Classification and Change Detection in Remote Sensing, with Algorithms for ENVI/IDL, Second Edition has been updated and expanded to keep pace with the latest versions of the ENVI software environment. Effectively interweaving theory, algorithms, and computer codes, the text supplies an accessible introduction to the techniques used in the processing of remotely sensed imagery.
    Type of Medium: Monograph available for loan
    Pages: XIV, 441Seiten , Illustrationen
    Edition: Second edition
    ISBN: 978-1-4200-8713-0
    Language: English
    Note: Contents Preface to the Second Edition Preface to the First Edition 1. Images, Arrays, and Matrices 1.1 Multispectral Satellite Images 1.2 Algebra of Vectors and Matrices 1.2.1 Elementary Properties 1.2.2 Square Matrices 1.2.3 Singular Matrices 1.2.4 Symmetric, Positive Definite Matrices 1.2.5 Linear Dependence and Vector Spaces 1.3 Eigenvalues and Eigenvectors 1.4 Singular Value Decomposition 1.5 Vector Derivatives 1.6 Finding Minima and Maxima 1.7 Exercises 2. Image Statistics 2.1 Random Variables 2.1.1 Discrete Random Variables 2.1.2 Continuous Random Variables 2.1.3 Normal Distribution 2.2 Random Vectors 2.3 Parameter Estimation 2.3.1 Sampling a Distribution 2.3.2 Interval Estimation 2.3.3 Provisional Means 2.4 Hypothesis Testing and Sample Distribution Functions 2.4.1 Chi-Square Distribution 2.4.2 Student-t Distribution 2.4.3 F-Distribution 2.5 Conditional Probabilities, Bayes' Theorem, and Classification 2.6 Ordinary Linear Regression 2.6.1 One Independent Variable 2.6.2 More Than One Independent Variable 2.6.3 Regularization, Duality, and the Gram Matrix 2.7 Entropy and Information 2.7.1 Kullback-Leibler Divergence 2.7.2 Mutual Information 2.8 Exercises 3. Transformations 3.1 Discrete Fourier Transform 3.2 Discrete Wavelet Transform 3.2.1 Haar Wavelets 3.2.2 Image Compression 3.2.3 Multiresolution Analysis 3.2.3.1 Dilation Equation and Refinement Coefficients 3.2.3.2 Cascade Algorithm 3.2.3.3 Mother Wavelet 3.2.3.4 Daubechies D4 Scaling Function 3.3 Principal Components 3.3.1 Primal Solution 3.3.2 Dual Solution 3.4 Minimum Noise Fraction 3.4.1 Additive Noise 3.4.2 Minimum Noise Fraction Transformation in ENVI 3.5 Spatial Correlation 3.5.1 Maximum Autocorrelation Factor 3.5.2 Noise Estimation 3.6 Exercises 4. Filters, Kernels, and Fields 4.1 Convolution Theorem 4.2 Linear Filters 4.3 Wavelets and Filter Banks 4.3.1 One-Dimensional Arrays 4.3.2 Two-Dimensional Arrays 4.4 Kernel Methods 4.4.1 Valid Kernels 4.4.2 Kernel PCA 4.5 Gibbs-Markov Random Fields 4.6 Exercises 5. Image Enhancement and Correction 5.1 Lookup Tables and Histogram Functions 5.2 Filtering and Feature Extraction 5.2.1 Edge Detection 5.2.2 Invariant Moments 5.3 Panchromatic Sharpening 5.3.1 HSV Fusion 5.3.2 Brovey Fusion 5.3.3 PCA Fusion 5.3.4 DWT Fusion 5.3.5 A Trous Fusion 5.3.6 Quality Index 5.4 Topographic Correction 5.4.1 Rotation, Scaling, and Translation 5.4.2 Imaging Transformations 5.4.3 Camera Models and RFM Approximations 5.4.4 Stereo Imaging and Digital Elevation Models 5.4.5 Slope and Aspect 5.4.6 Illumination Correction 5.5 Image-Image Registration 5.5.1 Frequency-Domain Registration 5.5.2 Feature Matching 5.5.2.1 High-Pass Filtering 5.5.2.2 Closed Contours 5.5.2.3 Chain Codes and Moments 5.5.2.4 Contour Matching 5.5.2.5 Consistency Check 5.5.2.6 Implementation in IDL 5.5.3 Resampling and Warping 5.6 Exercises 6. Supervised Classification: Part 1 6.1 Maximum a Posteriori Probability 6.2 Training Data and Separability 6.3 Maximum Likelihood Classification 6.3.1 ENVI's Maximum Likelihood Classifier 6.3.2 Modified Maximum Likelihood Classifier 6.4 Gaussian Kernel Classification 6.5 Neural Networks 6.5.1 Neural Network Classifier 6.5.2 Cost Functions 6.5.3 Backpropagation 6.5.4 Overfitting and Generalization 6.6 Support Vector Machines 6.6.1 Linearly Separable Classes 6.6.1.1 Primal Formulation 6.6.1.2 Dual Formulation 6.6.1.3 Quadratic Programming and Support Vectors 6.6.2 Overlapping Classes 6.6.3 Solution with Sequential Minimal Optimization 6.6.4 Multiclass SVMs 6.6.5 Kernel Substitution 6.6.6 Modified SVM Classifier 6.7 Exercises 7. Supervised Classification: Part 2 7.1 Postprocessing 7.1.1 Majority Filtering 7.1.2 Probabilistic Label Relaxation 7.2 Evaluation and Comparison of Classification Accuracy 7.2.1 Accuracy Assessment 7.2.2 Model Comparison 7.3 Adaptive Boosting 7.4 Hyperspectral Analysis 7.4.1 Spectral Mixture Modeling 7.4.2 Unconstrained Linear Unmixing 7.4.3 Intrinsic End-Members and Pixel Purity 7.5 Exercises 8. Unsupervised Classification 8.1 Simple Cost Functions 8.2 Algorithms That Minimize the Simple Cost Functions 8.2.1 K-Means Clustering 8.2.2 Kernel K-Means Clustering 8.2.3 Extended K-Means Clustering 8.2.4 Agglomerative Hierarchical Clustering 8.2.5 Fuzzy K-Means Clustering 8.3 Gaussian Mixture Clustering 8.3.1 Expectation Maximization 8.3.2 Simulated Annealing 8.3.3 Partition Density 8.3.4 Implementation Notes 8.4 Including Spatial Information 8.4.1 Multiresolution Clustering 8.4.2 Spatial Clustering 8.5 Benchmark 8.6 Kohonen Self-Organizing Map 8.7 Image Segmentation 8.7.1 Segmenting a Classified Image 8.7.2 Object-Based Classification 8.7.3 Mean Shift 8.8 Exercises 9. Change Detection 9.1 Algebraic Methods 9.2 Postclassification Comparison 9.3 Principal Components Analysis 9.3.1 Iterated PCA 9.3.2 Kernel PCA 9.4 Multivariate Alteration Detection 9.4.1 Canonical Correlation Analysis 9.4.2 Orthogonality Properties 9.4.3 Scale Invariance 9.4.4 Iteratively Reweighted MAD 9.4.5 Correlation with the Original Observations 9.4.6 Regularization 9.4.7 Postprocessing 9.5 Decision Thresholds and Unsupervised Classification of Changes 9.6 Radiometrie Normalization 9.7 Exercises Appendix A: Mathematical Tools A.l Cholesky Decomposition A.2 Vector and Inner Product Spaces A.3 Least Squares Procedures A.3.1 Recursive Linear Regression A.3.2 Orthogonal Linear Regression Appendix B: Efficient Neural Network Training Algorithms B.1 Hessian Matrix B.1.1 R-Operator B.1.1.1 Determination of Rv{n} B.1.1.2 Determination of Rv{δo} B.1.1.3 Determination of Rv{δh} B.1.2 Calculating the Hessian B.2 Scaled Conjugate Gradient Training B.2.1 Conjugate Directions B.2.2 Minimizing a Quadratic Function B.2.3 Algorithm B.3 Kaiman Filter Training B.3.1 Linearization B.3.2 Algorithm B.4 A Neural Network Classifier with Hybrid Training Appendix C: ENVI Extensions in IDL C.1 Installation C.2 Extensions C.2.1 Kernel Principal Components Analysis C.2.2 Discrete Wavelet Transform Fusion C.2.3 A Trous Wavelet Transform Fusion C.2.4 Quality Index C.2.5 Calculating Heights of Man-Made Structures in High-Resolution Imagery C.2.6 Illumination Correction C.2.7 Image Registration C.2.8 Maximum Likelihood Classification C.2.9 Gaussian Kernel Classification C.2.10 Neural Network Classification C.2.11 Support Vector Machine Classification C.2.12 Probabilistic Label Relaxation C.2.13 Classifier Evaluation and Comparison C.2.14 Adaptive Boosting a Neural Network Classifier C.2.15 Kernel K-Means Clustering C.2.16 Agglomerative Hierarchical Clustering C.2.17 Fuzzy K-Means Clustering C.2.18 Gaussian Mixture Clustering C.2.19 Kohonen Self-Organizing Map C.2.20 Classified Image Segmentation C.2.21 Mean Shift Segmentation C.2.22 Multivariate Alteration Detection C.2.23 Viewing Changes C.2.24 Radiometric Normalization Appendix D: Mathematical Notation References Index
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
    Call number: PIK N 076-10-0102
    Type of Medium: Monograph available for loan
    Pages: 289 S. : zahlr. Ill., Kt.
    Edition: Dt. Erstausg.
    ISBN: 9783868732238
    Uniform Title: 100 places to remember before they disappear
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 4
    Monograph available for loan
    Monograph available for loan
    Cambridge [u.a.] : Cambridge Univ. Pr.
    Call number: AWI G6-10-0141
    Description / Table of Contents: The first comprehensive, state-of-the-art introduction to the fast-evolving topic of in-situ produced cosmogenic nuclides, for graduate students and practitioners.
    Type of Medium: Monograph available for loan
    Pages: IX, 187 S. : Ill.
    Edition: 1 ed.
    ISBN: 9780521873802 , 0-521-87380-0
    Language: English
    Note: Contents: Preface. - 1 Cosmic rays. - 1.1 Origin and nature of cosmic rays. - 1.2 Interaction with magnetic fields. - 1.3 Interactions with the Earth's atmosphere. - 1.4 Interactions with the Earth's surface. - 1.5 Production of cosmogenic nuclides. - 1.6 Detection of cosmic rays. - 2 Cosmogenic nuclides. - 2.1 'Useful' cosmogenic nuclides. - 2.2 Stable cosmogenic nuclides. - 2.3 Cosmogenic radionuclides. - 2.4 Sample preparation. - 2.5 Analytical methods. - 3 Production rates and scaling factors. - 3.1 Deriving production rates. - 3.2 Scaling factors. - 3.3 Building scaling factors. - 4 Application of cosmogenic nuclldes to Earth surface sciences. - 4.1 Exposure dating. - 4.2 Burial dating. - 4.3 Erosion/denudation rates. - 4.4 Uplift rates. - 4.5 Soil dynamics. - 4.6 Dealing with uncertainty. - Appendix A: Sampling checklist. - Appendix B: Reporting of cosrnogenic-nudide data for exposure age and erosion rate determinations. - References. - Index.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Borntraeger
    Call number: AWI A14-10-0064
    Description / Table of Contents: Measurement Methods in Atmospheric Sciences provides a comprehensive overview of in-situ and remote sensing measurement techniques for probing the Earth's atmosphere. The methods presented in this book span the entire range from classical meteorology via atmospheric chemistry and micrometeorological flux determination to Earth observation from space. Standard instruments for meteorological and air quality monitoring methods, as well as specialized instrumentation predominantly used in scientific experiments, are covered. The presented techniques run from simple mechanical sensors to highly sophisticated electronic devices. Special emphasis is placed on the rapidly evolving field of remote sensing techniques. Here, active ground-based remote sending techniques such as SODAR and LIDAR find a detailed coverage. The book conveys the basic principles of the various observational and monitoring methods, enabling the user to identify the most appropriate method. An introductory chapter covers general principles (e.g. inversion of measured data, available platforms, statistical properties of data, data acquisition). Later chapters each treat methods for measuring a specific property (e.g. humidity, wind speed, wind direction). Long chapters provide an introductory tabular list of the methods treated. More than 100 figures and 400 references, mostly to the recent scientific literature, aid the reader in reading up on the details of the various methods at hand. Recommendations at the end of each major chapter provide additional hints on the use of some instruments in order to facilitate the selection of the proper instrument for a successful measurement. A large number of national and international standards, providing precise guidelines for measuring and acquiring reliable, reproducible and comparable data sets are listed in the appendix. A dedicated index allows easy access to this valuable information. The book is of interest to undergraduate and graduate students in meteorology, physical geography, ecology, environmental sciences and related disciplines as well as to scientists in the process of planning atmospheric measurements in field campaigns or working with data already acquired. Practitioners in environmental agencies and similar institutions will benefit from instrument descriptions and the extended lists in the appendix.
    Type of Medium: Monograph available for loan
    Pages: XIV, 257 Seiten , Illustrationen
    ISBN: 9783443010669 , 3-443-01066-0
    Series Statement: Quantifying the environment
    Language: English
    Note: Contents Preface 1 Introduction 1.1 The necessity for measurements 1.2 Definition of a measurement 1.3 Historical aspects 2 Measurement basics 2.1 Overview of methods 2.1.1 Direct and indirect methods 2.1.2 In-situ and remote sensing methods 2.1.3 Instantaneous and integrating methods 2.1.4 On-line and off-line methods, post-processing 2.1.5 Flux measurements 2.2 Main measurement principles 2.3 Measurements by inversion 2.3.1 Inversion with one variable 2.3.2 Inversion with more than one variable 2.3.3 Well-posed and ill-posed problems 2.4 Measurement instruments 2.4.1 Active and passive instruments 2.4.2 Analogue and digital instruments 2.5 Measurement platforms 2.6 Measurement variables 2.7 General characteristics of measured data 2.8 Data logging 2.9 Quality assurance/quality control 3 In-situ measurements of state variables 3.1 Thermometers 3.1.1 Liquid-in-glass thermometers 3.1.2 Bimetal thermometers 3.1.3 Resistance thermometers, thermistors 3.1.4 Thermocouples, thermopiles 3.1.5 Sonic thermometry 3.1.6 Measurement of infrared radiation 3.1.7 Soil thermometer 3.1.8 Recommendations for temperature measurements 3.2 Measuring moisture 3.2.1 Hygrometer 3.2.2 Psychrometers 3.2.3 Dewpoint determination 3.2.4 Capacitive methods 3.2.5 Recommendations for humidity measurements 3.3 Pressure sensors 3.3.1 Barometers 3.3.2 Hypsometers 3.3.3 Electronic barometers 3.3.4 Microbarometer 3.3.5 Pressure balance 3.3.6 Recommendations for pressure measurements 3.4 Wind measurements 3.4.1 Estimation from visual observations 3.4.2 Wind direction 3.4.3 Cup anemometer 3.4.4 Pressure tube 3.4.5 Hot wire anemometer 3.4.6 Ultrasonic anemometer 3.4.7 Propeller anemometer 3.4.8 Recommendations for wind measurements 4 In-situ methods for observing liquid water and ice 4.1 Precipitation 4.1.1 Rain sensors (Present Weather Sensors) 4.1.2 Rain gauges (totalisators) 4.1.3 Pluviographs 4.1.4 Disdrometer 4.1.5 Special instruments for snow 4.1.6 Recommendations for precipitation measurements 4.2 Soil moisture 4.2.1 Gravimetric methods 4.2.2 Neutron probes 4.2.3 Time domain reflectrometry (TDR) 4.2.4 Tensiometers 4.2.5 Resistance block tensiometer 4.2.6 Recommendations for soil moisture measurements 5 In-situ measurement of trace substances 5.1 Measurement of trace gases 5.1.1 Physical methods 5.1.2 Chemical methods 5.1.3 Recommendations for the measurement of trace gases 5.2 Particle measurements 5.2.1 Determination of the particle mass 5.2.2 Measuring particle size distributions 5.2.3 Measurement of the chemical composition of particles 5.2.4 Measuring the particle structure 5.2.5 Saltiphon 5.2.6 Recommendations for particle measurements 5.3 Olfactometry 5.4 Radioactivity 5.4.1 Counter tubes 5.4.2 Scintillation counters 5.4.3 Recommendations for radioactivity monitoring 6 In-situ flux measurements 6.1 Measuring radiation 6.1.1 Measuring direct solar radiation 6.1.2 Measuring shortwave irradiance 6.1.3 Measuring longwave irradiance 6.1.4 Measuring the total irradiance 6.1.5 Measuring chill 6.1.6 Sunshine recorder 6.1.7 Recommendations for radiation measurements 6.2 Visual range 6.3 Micrometeorological flux measurements 6.3.1 Cuvettes 6.3.2 Surface chambers 6.3.3 Mass balance method 6.3.4 Inferential method 6.3.5 Gradient method 6.3.6 Bowen-ratio method 6.3.7 Flux variance method 6.3.8 Dissipation method 6.3.9 Eddy covariance method 6.3.10 Eddy accumulation methods 6.3.11 Disjunct eddy covariance method 6.3.12 Recommendations for the measurement of turbulent fluxes 6.4 Evaporation Atmometers 6.4.2 Lysimeters 6.4.3 Evaporation pans and tanks 6.4.4 Recommendations for evaporation measurements 6.5 Soil heat flux 6.6 Inverse emission flux modelling 7 Remote sensing methods 7.1 Basics of remote sensing 7.2 Active sounding methods 7.2.1 RADAR 7.2.2 Windprofilers 7.2.3 SODAR 7.2.4 RASS 7.2.5 LIDAR 7.2.6 Further LIDAR techniques 7.3 Active path-averaging methods 7.3.1 Scintillometers 7.3.2 FTIR 7.3.3 DOAS 7.3.4 Quantum cascade laser 7.4 Passive methods 7.4.1 Radiometers 7.4.2 Photometers 7.4.3 Infrared-Interferometer 7.5 Tomography 7.5.1 Simultaneous Iterative Reconstruction Technique 7.5.2 Algebraic Reconstruction Technique (ART) 7.5.3 Smooth Basis Function Minimization (SBFM) 8 Remote sensing of atmospheric state variables 8.1 Temperature 8.1.1 Near-surface temperatures 8.1.2 Temperature profiles 8.2 Gaseous humidity 8.2.1 Integral water vapour content 8.2.2 Vertical profiles 8.2.3 Large-scale humidity distribution 8.3 Wind and turbulence 8.3.1 Small-scale near-surface turbulence 8.3.2 Horizontal wind fields 8.3.3 Vertical wind profiles 8.3.4 Turbulence profiles 8.3.5 Cloud winds 8.3.6 Ionospheric winds 8.4 Mixing-layer heights 8.4.1 LIDAR 8.4.2 SODAR 8.5 Turbulent fluxes 8.6 Ionospheric electron densities 8.7 Recommendations for remote sensing of state variables 9 Remote sensing of water and ice 9.1 Precipitation 9.1.1 RADAR 9.1.2 Precipitation measurements from satellites 9.2 Clouds 9.2.1 Cloud base 9.2.2 Cloud cover 9.2.3 Cloud movement 9.2.4 Water content 9.3 Recommendations for remote sensing of liquid water and ice 10 Remote sensing of trace substances 10.1 Trace gases 10.1.1 Horizontal path-averaging methods 10.1.2 Vertical column densities 10.1.3 Sounding methods 10.2 Aerosols 10.2.1 Aerosol optical depths (AOD) 10.2.2 Sounding methods 10.3 Recommendations for remote sensing of trace substances 11 Remote sensing of surface properties 11.1 Properties of the solid surface 11.1.1 Surface roughness 11.1.2 Land surface temperature 11.1.3 Soil moisture 11.1.4 Vegetation 11.1.5 Snow and ice 11.1.6 Fires 11.2 Properties of the ocean surface 11.2.1 Altitudes of the sea surface 11.2.2 Wave heights 11.2.3 Sea surface temperature 11.2.4 Salinity 11.2.5 Ocean currents 11.2.6 Ice cover, size of ice floes 11.2.7 Algae and suspended sediment concentrations 12 Remote sensing of electrical phenomena 12.1 Spherics 12.1.1 Directional analyses 12.1.2 Distance analyses 12.2 Optical lightning detection 13 Outlook on new developments Literature Subject index Appendix: Technical guidelines and standards Index to the Appendix
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    Monograph available for loan
    Monograph available for loan
    München : oekom-verl.
    Call number: M 11.0026
    Type of Medium: Monograph available for loan
    Pages: 347 S. , Ill. , 238 mm x 145 mm
    ISBN: 9783865811974
    Series Statement: Stoffgeschichten 6
    Uniform Title: Dirt
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: AWI Bio-11-0010
    Description / Table of Contents: This much revised and expanded edition provides a valuable and detailed summary of the many uses of diatoms in a wide range of applications in the environmental and earth sciences. Particular emphasis is placed on the use of diatoms in analyzing ecological problems related to climate change, acidification, eutrophication, and other pollution issues. The chapters are divided into sections for easy reference, with separate sections covering indicators in different aquatic environments. A final section explores diatom use in other fields of study such as forensics, oil and gas exploration, nanotechnology, and archeology. Sixteen new chapters have been added since the first edition including introductory chapters on diatom biology and the numerical approaches used by diatomists. The extensive glossary has also been expanded and now includes over 1000 detailed entries, which will help non-specialists to use the book effectively
    Type of Medium: Monograph available for loan
    Pages: XVIII, 667 Seiten , Illustrationen
    Edition: Second edition
    ISBN: 9780521509961 , 0-521-50996-3
    Language: English
    Note: Contents: List of Contributors. - Preface. - Part I. Introduction: 1. Applications and uses of diatoms: prologue ; 2. The diatoms: a primer ; 3. Numerical methods for the analysis of diatom assemblage data ; Part II. Diatoms as indicators of environmental change in flowing waters and lakes: 4. Assessing environmental conditions in rivers and streams with diatoms ; 5. Diatoms as indicators of long-term environmental change in rivers, fluvial lakes and impoundments ; 6. Diatoms as indicators of surface-water acidity ; 7. Diatoms as indicators of lake eutrophication ; 8. Diatoms as indicators of environmental change in shallow lakes ; 9. Diatoms as indicators of water-level change in freshwater lakes ; 10. Diatoms as indicators of hydrologic and climatic change in saline lakes ; 11. Diatoms in ancient lakes ; Part III. Diatoms as Indicators in Arctic, Antarctic and alpine lacustrine environments: 12. Diatoms as indicators of environmental change in subarctic and alpine regions ; 13. Freshwater diatoms as indicators of environmental change in the High Arctic ; 14. Diatoms as indicators of environmental change in Antarctic and subantarctic freshwaters ; Part IV. Diatoms as indicators in marine and estuarine environments: 15. Diatoms and environmental change in large brackish-water ecosystems ; 16. Applied diatom studies in estuaries and shallow coastal environments ; 17. Estuarine paleoenvironmental reconstructions using diatoms ; 18. Diatoms on coral reefs and in tropical marine lakes ; 19. Diatoms as indicators of former sea levels, earthquakes, tsunamis and hurricanes ; 20. Marine diatoms as indicators of modern changes in oceanographic conditions ; 21. Holocene marine diatom records of environmental change ; 22. Diatoms as indicators of paleoceanographic events ; 23. Reconsidering the meaning of biogenic silica accumulation rates in the glacial Southern Ocean ; Part V. Other applications: 24. Diatoms of aerial habitats ; 25. Diatoms as indicators of environmental change in wetlands and peatlands ; 26. Tracking fish, seabirds, and wildlife population dynamics with diatoms and other limnological indicators ; 27. Diatoms and archaeology ; 28. Diatoms in oil and gas exploration ; 29. Forensic science and diatoms ; 30. Toxic marine diatoms ; 31. Diatoms as markers of atmospheric transport ; 32. Diatoms as nonnative species ; 33. Diatomite ; 34. Stable isotopes from diatom silica ; 35. Diatoms and nanotechnology: early history and imagined future as seen through patents ; Part IV. Conclusions: 36. Epilogue: a view to the future ; Glossary, acronyms, and abbreviations ; Index.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Monograph available for loan
    Monograph available for loan
    München : Beck
    Call number: 20-1/M 11.0030
    Type of Medium: Monograph available for loan
    Pages: 319 S. , Kt.
    ISBN: 9783406598982
    Uniform Title: L'avenir de l'eau
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    Call number: AWI G3-11-0007
    In: Advances in global change research, 40
    Description / Table of Contents: This book covers a round-up of environmental changes in Siberia with a focus on the terrestrial biosphere but also discussing climate and atmosphere and the hydrolofical cycle. It concludes with a discussion of information system approaches that are being developed to safeguard and make accessible spatial and temporal data for environmental studies.
    Type of Medium: Monograph available for loan
    Pages: xv, 282 Seiten , Illustrationen
    ISBN: 9789048186402
    Series Statement: Advances in global change research 40
    Language: English
    Note: PART I: BIOSPHERE - 1. Forest disturbance assessment using satellite data of moderate and low resolution / M. A. Korets, V. A. Ryzhkova, A. I. Sukhinin, S. A. Bartalev and I. V. Danilova 2. Fire / climate interactions in Siberia / Heiko Balzter, Kevin Tansey, Jorg Kaduk, Charles George, France Gerard, Maria Cuevas Gonzalez, Anatoly Sukhinin and Evgeni Ponomarev 3. Long-term dynamics of mixed fir-aspen forests in West Sayan (Altai-Sayan Ecoregion) / D. M. Ismailova and D. I. Nazimova 4. Evidence of evergreen conifers invasion into larch dominated forests during recent decades / V. I. Kharuk, K. J. Ranson and M. L. Dvinskaya 5. Potential climate-induced vegetation change in Siberia in the 21st century / N. M. Tchebakova , E. I. Parfenova, and A. J. Soja 6. Wildfire dynamics in mid-Siberian larch dominated forests / V. I. Kharuk, K. J. Ranson and M. L. Dvinskaya 7. Dendroclimatological evidence of climate changes across Siberia / Vladimir V. Shishov, Eugene A. Vaganov 8. Siberian pine and larch response to climate warming in the southern Siberian mountain forest: tundra ecotone / V. I. Kharuk, K. J. Ranson, M. L. Dvinskaya and S. T. Im PART II: HYDROSPHERE 9. Remote sensing of spring snowmelt in Siberia / A. Bartsch, W. Wagner and R. Kidd 10. Response of river runoff in the cryolithic zone of Eastern Siberia (Lena River Basin) to future climate warming / A. G. Georgiadi, I. P. Milyukova and E. A. Kashutina PART III: ATMOSPHERE 11. Investigating regional scale processes using remotely sensed atmospheric CO2 column concentrations from SCIAMACHY / M. P. Barkley, A. J. Hewitt and P. S. Monks 12. Climatic and geographic patterns of spatial distribution of precipitation in Siberia / A. Onuchin and T. Burenina PART IV: INFORMATION SYSTEMS 13. Interoperability, data discovery and access: the e-Infrastructures for Earth Sciences resources / Stefano Nativi, Christiana Schmullius, Lorenzo Bigagli and Roman Gerlach 14. Development of a web based information-computational infrastructure for the Siberia Integrated Regional Study / E. P. Gordov, A. Z. Fazliev, V. N. Lykosov, I. G. Okladnikov and A. G. Titov 15. Conclusions / Heiko Balzter. - Appendix. - Index.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Non-book medium
    Non-book medium
    Frankfurt am Main : Bundesamt für Kartographie und Geodäsie
    Call number: PIK CD-11-0124
    Description / Table of Contents: Contents: Topographische Übersichtskarte 1 : 200.000 (160 L/cm) ; Topographische Karte 1 : 500.000 (160 L/cm) ; Topographische Karte 1 : 1.000.000 (160 L/cm) ; Digitales Geländemodell (Auflösung 25m) ; Ortsnamenverzeichnis ; Verwaltungsgrenzen ; Blattschnitte der Topographischen Karten
    Type of Medium: Non-book medium
    Pages: 1 DVD-ROM : farb. ; 12 cm, in Behältnis 25 x 14 x 2 cm + 3D-Brille, Beil. (35 S.)
    Edition: Einzelplatzlizenz, Version 5
    ISBN: 9783898889193
    Series Statement: Amtliche topographische Karten Top 200
    Language: German
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    Monograph available for loan
    Monograph available for loan
    Paris : OECD
    Call number: PIK P 113-10-0202
    Description / Table of Contents: This joint IEA/NEA report on electricity generating costs presents the latest data available for a wide variety of fuels and technologies, including coal and gas (with and without carbon capture), nuclear, hydro, onshore and offshore wind, biomass, solar, wave and tidal as well as combined heat and power (CHP).  It provides levelised costs of electricity (LCOE) per MWh for almost 200 plants, based on data covering 21 countries (including four major non-OECD countries), and several industrial companies and organisations.  For the first time, the report contains an extensive sensitivit
    Type of Medium: Monograph available for loan
    Pages: 215 S. : graph. Darst.
    ISBN: 9789264084308
    Language: English
    Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
    Series available for loan
    Series available for loan
    Warnemünde : Inst. für Ostseeforschung
    Associated volumes
    Call number: ZS-000(80)
    In: Meereswissenschaftliche Berichte
    Type of Medium: Series available for loan
    Pages: 147 S.
    Series Statement: Meereswissenschaftliche Berichte 80
    Classification:
    Oceanology
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 13
    Monograph available for loan
    Monograph available for loan
    München [u.a.] : Addison-Wesley
    Call number: 18/M 11.0073
    Type of Medium: Monograph available for loan
    Pages: 183 S. , Ill., graph. Darst.
    ISBN: 9783827329745
    Uniform Title: Rocket surgery made easy
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 14
    Monograph available for loan
    Monograph available for loan
    Associated volumes
    Call number: ZSP-125-2009
    In: Antarctic Automatic Weather Station Data for the Calender Year ...
    Type of Medium: Monograph available for loan
    Pages: 44 S. : graph. Darst.
    Language: English
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Series available for loan
    Series available for loan
    Washington, DC : United States Government Printing Office
    Associated volumes
    Call number: S 90.0002(1386-F) ; AWI G7-11-0050
    In: Satellite image atlas of glaciers of the world, 1386-F
    In: Professional paper, 1386-F
    Description / Table of Contents: This chapter is the ninth to be released in U.S. Geological Survey Professional Paper 1386, Satellite Image Atlas of Glaciers of the World, a series of 11 chapters. In each of the geographic area chapters, remotely sensed images, primarily from the Landsat 1, 2, and 3 series of spacecraft, are used to analyze the specific glacierized region of our planet under consideration and to monitor glacier changes. Landsat images, acquired primarily during the middle to late 1970s and early 1980s, were used by an international team of glaciologists and other scientists to study various geographic regions and (or) to discuss related glaciological topics. In each glacierized geographic region, the present areal distribution of glaciers is compared, wherever possible, with historical information about their past extent. The atlas provides an accurate regional inventory of the areal extent of glacier ice on our planet during the 1970s as part of a growing international scientific effort to measure global environmental change on the Earth's surface.The chapter is divided into seven geographic parts and one topical part: Glaciers of the Former Soviet Union (F-1), Glaciers of China (F-2), Glaciers of Afghanistan (F-3), Glaciers of Pakistan (F-4), Glaciers of India (F-5), Glaciers of Nepal (F-6), Glaciers of Bhutan (F-7), and the Paleoenvironmental Record Preserved in Middle-Latitude, High-Mountain Glaciers (F-8). Each geographic section describes the glacier extent during the 1970s and 1980s, the benchmark time period (1972-1981) of this volume, but has been updated to include more recent information.
    Type of Medium: Series available for loan
    Pages: VIII, F349 S. , Illustrationen
    ISBN: 9781411326095
    Series Statement: Satellite image atlas of glaciers of the world / ed. by Richard S. Williams ... F
    Classification:
    Regional Geology
    Language: English
    Note: Contents: F–1. GLACIERS OF THE FORMER SOVIET UNION / VLADIMIR M. KOTLYAKOV, with contributions from A.M. DYAKOVA (Siberia), V.S. KORYAKIN (Russian Arctic Islands), V.I. KRAVTSOVA (Caucasus, Altay), G.B. OSIPOVA (Tien Shan), G.M. VARNAKOVA (Pamirs and Alai Range), V.N. VINOGRADOV (Kamchatka), O.N. VINOGRADOV (Caucasus), and N.M. ZVERKOVA (Ural Mountains and Taymyr Peninsula) Sections on FLUCTUATIONS OF GLACIERS OF THE CENTRAL CAUCASUS AND GORA EL’BRUS (With a subsection on THE GLACIOLOGICAL DISASTER IN NORTH OSETIYA / VLADIMIR M. KOTLYAKOV, O.V. ROTOTAEVA, and G.A. NOSENKO INVESTIGATIONS OF THE FLUCTUATIONS OF SURGE-TYPE GLACIERS IN THE PAMIRS BASED ON OBSERVATIONS FROM SPACE / VLADIMIR M. KOTLYAKOV, G.B. OSIPOVA, and D.G. TSVETKOV THE GLACIOLOGY OF THE RUSSIAN HIGH ARCTIC FROM LANDSAT IMAGERY / J.A. DOWDESWELL, E.K. DOWDESWELL, M. WILLIAMS, and A.F. GLAZOVSKII F–2. GLACIERS OF CHINA / SHI YAFENG, MI DESHENG, YAO TANDONG, ZENG QUNZHU, and LIU CHAOHAI F–3 GLACIERS OF AFGHANISTAN / JOHN E. SHRODER , JR ., and MICHAEL P. BISHOP F–4 GLACIERS OF PAKISTAN / JOHN E. SHRODER , JR ., and MICHAEL P. BISHOP F–5 GLACIERS OF INDIA / CHANDER P. VOHRA Updated supplement on A STUDY OF SELECTED GLACIERS UNDER THE CHANGING CLIMATE REGIME / SYED IQBAL HASNAIN, RAJESH KUMAR , SAFARAZ AHMAD, and SHRESTH TAYAL F–6 GLACIERS OF NEPAL — GLACIER DISTRIBUTION IN THE NEPAL HIMALAYA WITH COMPARISON TO THE KARAKORAM RANGE / KEIJI HIGUCHI, OKITSUGU WATANABE, HIROJI FUSHIMI, SHUHEI TAKENAKA, and AKIO NAGOSHI, Supplement by YUTAKA AGETA F–7 GLACIERS OF BHUTAN / SHUJI IWATA F–8 THE PALEOENVIRONMENTAL RECORD PRESERVED IN MIDDLE-LATITUDE, HIGH-MOUNTAIN GLACIERS: AN OVERVIEW OF U.S. GEOLOGICAL SURVEY RESEARCH IN CENTRAL ASIA AND THE UNITED STATES / L. DeWAYNE CECIL, DAVID L. NAFTZ, PAUL F. SCHUSTER , DAVID D. SUSONG, and JAROMY R . GREEN
    Location: Lower compact magazine
    Location: AWI Reading room
    Branch Library: GFZ Library
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    Call number: PIK B 160-11-0067
    Description / Table of Contents: Contents: Teil I: Vergangenheit als Prolog ; 1. Der große Reset ; 2. Die großen Vorgänger ; 3. Stadtentwicklung als Innovation ; 4. Das Jahrzehnt der größten technischen Fortschritte ; 5. Die Stunde der Vorstadt ; 6. Raumlösungen ; 7. Die Fäden entwirren ; Teil II: Die Umgestaltung der Wirtschaftslandschaft ; 8. Die Hauptstadt des Kapitals ; 9. Ablösung an der Spitze? ; 10. Der FIRE-Sektor ; 11. Der Boom der Behördenstädte ; 12. Leben und Sterben alter Industriestädte ; 13. Nordlicht ; 14. Sonnenuntergang über dem Sunbelt ; Teil III: Eine neue Lebensweise ; 15. Die Reset-Ökonomie ; 16. Eine gute Jobmaschine ; 17. Die neue Normalität ; 18. Die große Umsiedlung ; 19. Groß, schnell und grün ; 20. Die eigene Geschwindigkeit ; 21. Wie ein geölter Blitz ; 22. Ein Traum zur Miete ; 23. Der Zeitpunkt für den Reset
    Type of Medium: Monograph available for loan
    Pages: 248 S.
    ISBN: 9783593391250
    Uniform Title: The great reset
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
    Monograph available for loan
    Monograph available for loan
    Cambridge : White Horse Press
    Call number: PIK B 160-11-0030
    Description / Table of Contents: Contents: Preface ; I. Energy Systems and Social Evolution ; 1. Palaeolithic Hunter-gatherer Societies ; 2. The Neolithic Revolution and the Problem of Dynamics ; 3. Traditional Agriculture - A Controlled Solar Energy System ; 4. The Structure of the Agrarian Energy System ; 5. The Dynamics of Agrarian Society ; 6. Crisis and Transformation ; 7. The Industrial System and Fossil Energy ; II. Forest and Wood in Preindustrial Germany ; 1. Natural Foundations ; 2. Preindustrial Wood Consumption ; 3. Regulation Problems ; III. England: Coal in the Industrial Revolution ; 1. Substitution of Wood by Coal ; 2. Wood and Coal in Iron Smelting ; 3. Transport and Steam Power ; 4. Significance of Coal in the Industrial Revolution ; IV. Germany in the 18th Century: Wood Crisis and Strategies for Solutions ; 1. Conserving Wood ; 2. Functional Separation of Agriculture and Forestry ; 3. Substitution for Wood ; 4. Was the Wood Crisis an Energy Crisis? ; V. Perceptions of Fossil Energy ; 1. The Finiteness of Fossil Fuels ; 2. Classical Political Economy and the Stationary State ; 3. Jevons and the Contraction of the Industrial System ; 4. Nuclear or Solar Energy ; Bibliography
    Type of Medium: Monograph available for loan
    Pages: X, 230 S. : graph. Darst.
    Edition: 1. pbk. ed.
    ISBN: 9781874267539
    Uniform Title: Der unterirdische Wald
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 18
    Monograph available for loan
    Monograph available for loan
    Cham [u.a.] : Springer
    Call number: PIK M 370-15-89030
    Type of Medium: Monograph available for loan
    Pages: XVIII, 445 S. , graph. Darst.
    ISBN: 978-3-319-10276-4
    Series Statement: Systems & Control: Foundations & Applications
    Language: English
    Note: Contents: Linear Control Systems ; The Dynamic Programming Approach ; Ellipsoidal Techniques: Reachability and Control Synthesis ; Solution Examples on Ellipsoidal Methods: Computation in High Dimensions ; The Comparison Principle: Nonlinearity and Nonconvexity ; Impulse Controls and Double Constraints ; Dynamics and Control Under State Constraints ; Trajectory Tubes State-Constrained Feedback Control ; Guaranteed State Estimation ; Uncertain Systems: Output Feedback Control ; Verification: Hybrid Systems
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 19
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 20
    Monograph available for loan
    Monograph available for loan
    New York : Routledge
    Call number: IASS 16.89933
    Description / Table of Contents: Bringing together papers written by Norman Fairclough over a 25 year period, Critical Discourse Analysis represents a comprehensive and important contribution to the development of this popular field.  The book is divided into seven sections covering the following themes:  language in relation to ideology and powerdiscourse in processes of social and cultural change dialectics of discourse, dialectical relations between discourse and other moments of social lifemethodology of critical discourse analysis research analysis of political discourse discourse in globalisation and ?transition' critic
    Type of Medium: Monograph available for loan
    Pages: xi, 591 S.
    Edition: Second edition
    Edition: Online-Ausg.
    ISBN: 9781405858229 (pbk.)
    Language: English
    Note: section A. Language, ideology and powersection B. Discourse and sociocultural change -- section C. Dialectics of discourse: theoretical developments -- section D. Methodology in CDA research -- section E. Political discourse -- F. Globalisation and 'transition' -- section G. Language and education..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 21
    Call number: IASS 16.89646
    Type of Medium: Monograph available for loan
    Pages: 812 S , graph. Darst. , 23 cm
    Edition: 2., überarb. und erw. Aufl
    ISBN: 3895188654 (Geb.) , 9783895188657 (Geb.)
    Series Statement: Grundlagen der Wirtschaftswissenschaft 15
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    Call number: IASS 16.89630/2
    Type of Medium: Monograph available for loan
    Pages: S. 118 - 235 , Ill. , 28 cm
    Language: German , English
    Note: Text dt. und engl.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
    Call number: PIK E 713-17-90095
    Description / Table of Contents: Die Herausgeberinnen: Prof. Dr.-Ing. Sabine Hofmeister, Dr. rer. nat. Christine Katz, Dr. rer. soc. Tanja Mölders, alle: Lehr- und Forschungsgebiet Umweltplanung, Fakultät Nachhaltigkeit, Leuphana Universität Lüneburg
    Description / Table of Contents: Zwischen Geschlechter- und Nachhaltigkeitsforschung sind zahlreiche Synergien möglich. Die AutorInnen zeigen, warum die Umweltwissenschaften nicht auf die Kategorie Geschlecht verzichten dürfen. Den LeserInnen wird ein Überblick über das komplexe und vielfältig verwobene Forschungsfeld gegeben.
    Type of Medium: Monograph available for loan
    Pages: 403 Seiten
    ISBN: 9783847400103
    Language: German
    Note: Contents: I Grundlegungen und Orientierungen ; 1. Grundlegungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; 2. Orientierungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; II Forschungs- und Handlungsfelder der Nachhaltigkeitswissenschaften und -politik ; 1. Einführung ; 2. Wissenschaft und Forschung ; 3. Wirtschaften und Arbeiten ; 4. Raumentwicklung ; 5. Mobilität ; 6. Klimawandel und -politik ; 7. Ressourcenpolitik und Infrastruktur ; 8. Natur und Landschaft ; 9. Konsum- und Lebensstile ; 10. Zeit(en) ; 11. Governance, Partizipation, Empowerment ; III Fazit - Die Kategorie Geschlecht: Neue Perspektiven für die Nachhaltigkeitswissenschaften
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 24
    Monograph available for loan
    Monograph available for loan
    Cheltenham [u.a.] : Elgar
    Call number: PIK B 010-16-90165
    Description / Table of Contents: "'Globalization, it seems, has propelled the worlds uber-wealthy to new heights of power and money, with tremendous repercussions for the other 99.9 percent of us. At a time when neoliberalism has propelled the world into a new Gilded Age, with rising inequality everywhere, an aggressive class war being waged by the wealthy, and billionaires inserting themselves bluntly into the political arena, understanding the behavior and spatiality of the super-rich has acquired a pressing urgency. This volume offers a richly textured suite of essays concerning how the super-rich have restructured local places, transforming landscapes as varied as London and Kentucky, Ireland and St. Barts, as well as domains as varied as art, thoroughbred horses, and housing.'--Barney Warf, University of Kansas, USA. 'The worlds super-rich, made up of just 11 million people, have access to about US$42.0 trillion of wealth. These are people who each have a spare million of 'liquid' wealth. Their wealth is roughly equal to two thirds of global GDP. They own most of everything. As the editor of this books states ". . . library shelves and the pages of journals remain largely devoid of geographical work on the super-rich a startling lacuna this volume sets out to fill". The super-rich now own most of the planet. During the last year their share fell slightly. Times may be changing. Now is the time to begin to study the superrich in detail, especially if you are worried about where all the wealth has gone.'--Danny Dorling, University of Sheffield, UK. This timely and path-breaking book brings together a group of distinguished and emerging international scholars to critically consider the geographical implications of the worlds super-rich, a privileged yet remarkably overlooked group. Emerging from this unique collection is an enlightening picture of the influence of the super-rich over a diverse range of affairs, extending from the shape of urban and rural landscapes to the future of art history. By concentrating on those at the apex of the economic pyramid, this book provides valuable insights to the institutions, practices and cultural values of our society, as well as allowing us a more comprehensive view of the consequences of global capitalism. Presenting case studies from across the globe from Singapore to St Barts, London to Lexington the spatial and cultural span of the book is wide-ranging and diverse. This truly unique book will prove a fascinating read for academics, researcher ...
    Type of Medium: Monograph available for loan
    Pages: XVIII, 213 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9781782540267 (pbk.) , 9780857935687 (hbk.) , 9780857935694 (electronic)
    Language: English
    Note: 1. Establishing geographies of the super-rich : axes for analysis of abundance / Iain Hay2. Economic wealth and political power in the second Gilded Age / John Rennie Short -- 3. Overseeing the fortunes of the global super-rich : the nature of private wealth management in London's financial district / Jonathan V. Beaverstock, Sarah J.E. Hall and Thomas Wainwright -- 4. 'The world needs a second Switzerland' : onshoring Singapore as the liveable city for the super-rich / Choon-Piew Pow -- 5. 'Super-rich' Irish property developers and the Celtic Tiger economy / Laurence Murphy and Pauline McGuirk -- 6. The homes of the super-rich : multiple residences, hyper-mobility and decoupling of prime residential housing in global cities / Chris Paris -- 7. A study of the dominance of the super-wealthy in London's West End during the nineteenth century / Kathryn Wilkins -- 8. The elite countryside : shifting rural geographies of the transnational super-rich / Michael Woods -- 9. The super-rich, horses and the transformation of the rural landscape in Kentucky / Susan M. Roberts and Richard H. Schein -- 10. The sport of kings, queens, sheikhs and the super-rich : thoroughbred breeding and racing as leisure for the super-rich / Phil McManus -- 11. Making art history -- wealthy private collectors and contemporary visual art / Melanie Fasche -- 12. Islanders, immigrants and millionaires : the dynamics of upper-class segregation in St. Barts, French West Indies / Bruno Cousin and Sébastien Chauvin..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Monograph available for loan
    Monograph available for loan
    München : Open Source Press
    Call number: 18/M 16.90221
    Type of Medium: Monograph available for loan
    Pages: 575 Seiten , Ill., graph. Darst , 24 cm
    Edition: 5. Aufl.
    ISBN: 9783955390402
    Series Statement: Root's reading
    Classification:
    Informatics
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    Monograph available for loan
    Monograph available for loan
    München : Open Source Press
    Call number: (OCoLC)740934605
    Type of Medium: Monograph available for loan
    Pages: 343 S. , graph. Darst. , 240 mm x 176 mm
    ISBN: 9783941841369 (Pb.) , 9783941841604 (Set)
    Series Statement: Professional reference
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Monograph available for loan
    Monograph available for loan
    Oldenbourg : De Gruyter
    Call number: 18/M 16.90219
    Description / Table of Contents: 〈!doctype html public ""-//w3c//dtd html 4.0 transitional//en""〉 〈html〉〈head〉 〈meta content=""text/html; charset=iso-8859-1"" http-equiv=content-type〉 〈meta name=generator content=""mshtml 8.00.6001.23619""〉〈/head〉 〈body〉 〈P〉This book systematically describes important aspects when planning secure IT systems, as well as the different approaches that may be used. It presents procedures and protocols in detail and explains them with case examples. This book is a must-read for anyone involved in IT security.〈/P〉〈/body〉〈/html〉
    Type of Medium: Monograph available for loan
    Pages: XIV, 990 Seiten
    Edition: 9. Aufl.
    ISBN: 9783486778489
    Language: German
    Note: Vorwort; Inhaltsverzeichnis; 1 Einführung; 1.1 Grundlegende Begriffe; 1.2 Schutzziele; 1.3 Schwachstellen, Bedrohungen, Angriffe; 1.3.1 Bedrohungen; 1.3.2 Angriffs- undAngreifer-Typen; 1.3.3 Rechtliche Rahmenbedingungen; 1.4 ComputerForensik; 1.5 Sicherheitsrichtlinie; 1.6 Sicherheitsinfrastruktur; 2 Spezielle Bedrohungen; 2.1 Einführung; 2.2 Buffer-Overflow; 2.2.1 Einführung; 2.2.2 Angriffe; 2.2.3 Gegenmaßnahmen; 2.3 Computerviren; 2.3.1 Eigenschaften; 2.3.2 Viren-Typen; 2.3.3 Gegenmaßnahmen; 2.4 Würmer; 2.5 Trojanisches Pferd; 2.5.1 Eigenschaften; 2.5.2 Gegenmaßnahmen; 2.6 Bot-Netze undSpam. , 2.6.1 Bot-Netze2.6.2 Spam; 2.7 MobilerCode; 2.7.1 Eigenschaften; 2.7.2 Sicherheitsbedrohungen; 2.7.3 Gegenmaßnahmen; 2.7.4 MobileApps; 3 Internet-(Un-)Sicherheit; 3.1 Einführung; 3.2 Internet-Protokollfamilie; 3.2.1 ISO/OSI-Referenzmodell; 3.2.2 DasTCP/IP-Referenzmodell; 3.2.3 Das Internet-Protokoll IP; 3.2.4 DasTransmissionControlProtokoll TCP; 3.2.5 DasUserDatagramProtocolUDP; 3.2.6 DHCP und NAT; 3.3 Sicherheitsprobleme; 3.3.1 Sicherheitsprobleme von IP; 3.3.2 Sicherheitsprobleme von ICMP; 3.3.3 Sicherheitsprobleme vonARP; 3.3.4 Sicherheitsprobleme vonUDPundTCP. , 3.4 Sicherheitsprobleme vonNetzdiensten3.4.1 DomainNameService (DNS); 3.4.2 NetworkFileSystem(NFS); 3.4.3 WeitereDienste; 3.5 Web-Anwendungen; 3.5.1 World Wide Web (WWW); 3.5.2 Sicherheitsprobleme; 3.5.3 OWASPTop-TenSicherheitsprobleme; 3.6 Analysetools undSystemhärtung; 4 Security Engineering; 4.1 Entwicklungsprozess; 4.1.1 AllgemeineKonstruktionsprinzipien; 4.1.2 Phasen; 4.1.3 BSI-Sicherheitsprozess; 4.2 Strukturanalyse; 4.3 Schutzbedarfsermittlung; 4.3.1 Schadensszenarien; 4.3.2 Schutzbedarf; 4.4 Bedrohungsanalyse; 4.4.1 Bedrohungsmatrix; 4.4.2 Bedrohungsbaum; 4.5 Risikoanalyse. , 4.5.1 Attributierung4.5.2 Penetrationstests; 4.6 Sicherheitsarchitektur und Betrieb; 4.6.1 Sicherheitsstrategie undSicherheitsmodell; 4.6.2 Systemarchitektur undValidierung; 4.6.3 Aufrechterhaltung im laufenden Betrieb; 4.7 Sicherheitsgrundfunktionen; 4.8 Realisierung der Grundfunktionen; 4.9 Security Development Lifecycle (SDL); 4.9.1 Die Entwicklungsphasen; 4.9.2 Bedrohungs- und Risikoanalyse; 5 Bewertungskriterien; 5.1 TCSEC-Kriterien; 5.1.1 Sicherheitsstufen; 5.1.2 Kritik am Orange Book; 5.2 IT-Kriterien; 5.2.1 Mechanismen; 5.2.2 Funktionsklassen; 5.2.3 Qualität; 5.3 ITSEC-Kriterien. , 5.3.1 Evaluationsstufen5.3.2 Qualität und Bewertung; 5.4 Common Criteria; 5.4.1 Überblick über dieCC; 5.4.2 CC-Funktionsklassen; 5.4.3 Schutzprofile; 5.4.4 Vertrauenswürdigkeitsklassen; 5.5 Zertifizierung; 6 Sicherheitsmodelle; 6.1 Modell-Klassifikation; 6.1.1 Objekte undSubjekte; 6.1.2 Zugriffsrechte; 6.1.3 Zugriffsbeschränkungen; 6.1.4 Sicherheitsstrategien; 6.2 Zugriffskontrollmodelle; 6.2.1 Zugriffsmatrix-Modell; 6.2.2 RollenbasierteModelle; 6.2.3 Chinese-Wall Modell; 6.2.4 Bell-LaPadula Modell; 6.3 Informationsflussmodelle; 6.3.1 Verbands-Modell; 6.4 Fazit undAusblick. , 7 Kryptografische Verfahren.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    Call number: IASS 15.89620
    Keywords: Deutschland ; Großbritannien ; Klimaänderung ; Klimaschutz ; Technikbewertung ; Politische Auseinandersetzung
    Type of Medium: Monograph available for loan
    Pages: 263 S. , Ill., graph. Darst. , 210 mm x 148 mm, 351 g
    ISBN: 3658053658 (pbk.) , 9783658053659 (pbk.)
    Language: German
    Note: Univ., Diss.--Heidelberg, 2013
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
    Call number: 2015/8
    Type of Medium: 11
    ISBN: 9783060207602
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 30
    Call number: PIK B 310-16-90318
    Type of Medium: Monograph available for loan
    Pages: XV, 200 Seiten , graph. Darst.
    ISBN: 0857939327 (hbk.) , 9780857939326 (hbk.) , 9781782545842 (pbck) , 1782540865 (electronic; ebook) , 9781782540861 (electronic; ebook)
    Language: English
    Note: Contents: Preface ; 1. Introduction: It is the Only One We Have ; 2. Planet Accounts ; Part I: Short-term Fluctuations and Demand Management ; 3. Earth’s Business Cycle ; 4. Why I = S and What That Means: The Building Blocks of Macroeconomic Analysis ; 5. Investment, the IS Curve, and Product Market Equilibrium ; 6. What About Government? ; 7. Money Matters! The LM Curve and Money Market Equilibrium ; 8. Eartheconomic Demand and Supply ; 9. Puzzling Disagreements ; Part II: Long Run ; 10. Long-Run Growth ; 11. Development and Change , 12. Limits to Growth? ; Part III: Earth Governance and Global Public Goods ; 13. Global Public Goods ; 14. Global Peers: An Agenda ; References ; Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 31
    Monograph available for loan
    Monograph available for loan
    Cheltenham [u.a.] : Elgar
    Call number: PIK B 160-16-90323
    Type of Medium: Monograph available for loan
    Pages: XIV, 260 Seiten , graph. Darst.
    Edition: 2. ed.
    ISBN: 9780857932259 (hbk.) , 9780857932273 (pbk.)
    Language: English
    Note: Contents: Preface to the Second Edition ; Preface to the First Edition ; Introduction ; Part I: Evolution and Concepts ; 1. Evolution and Concepts ; Appendix to Chapter 1: Definitions and Data Issues ; Part II: Pre-WWII Approaches to International Investment ; Introduction to Part II 2. Marxist Approaches ; 3. Foreign Investment Within the Neoclassical Paradigm ; Part III: Modern Theories ; Introduction to Part III 4. Hymer’s Seminal Work ; 5. The Product Life Cycle and International Production ; 6. Oligopolistic Reactions and the Geographical Pattern of FDI ; 7. Currency Areas and Internationalization ; 8. Internalization and the Transnational Corporation ; 9. Dunning’s Eclectic Framework ; 10. Stages in the Internationalization Process: The Scandinavian School ; 11. Evolutionary Theories of the TNC ; 12. New Trade Theories and the Activities of TNCs ; 13. Transnational Monopoly Capitalism ; 14. Nation-states and TNCs’ Strategic Behaviour ; 15. Resources, Networks and the TNC ; Part IV: Effects ; Introduction to Part IV 16. Boundaries in the Assessment of Effects ; 17. Innovation and the TNCs ; 18. Effects on Labour ; 19. Effects on Trade ; 20. Effects on the Balance of Payments ; Reference ; Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Monograph available for loan
    Monograph available for loan
    Boca Raton, FL [u.a.] : CRC Press
    Call number: PIK D 024-15-89126
    Type of Medium: Monograph available for loan
    Pages: XXXVI, 349 S. , graph. Darst.
    ISBN: 9781420071269 (hbk. : £44.99) , 1420071262 (hbk.)
    Series Statement: Public administration and public policy 158
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Monograph available for loan
    Monograph available for loan
    Oxford : Oxford Univ. Press
    Call number: PIK N 071-15-89127
    Type of Medium: Monograph available for loan
    Pages: XXIII, 317 S.
    Edition: 1. ed.
    ISBN: 0199686394 , 9780199686391
    Language: English
    Note: Introduction.EU energy law and the approach taken in this studyThe regulatory history of EU energy : the evolution of EU energy law from 1957 onwardsThe evolution of the sector-specific regulatory frameworkTreaty law and the energy sectorEnvironment and energy : on a bumpy road towards a clean energy futureThe international dimension of EU energy law and policyFrom state to market and back : the changing role(s) of markets and states in the EUConclusion.European energy law under the impact of globalization : from state to market, from plan to contract, from public ownership to economic regulation and beyond..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Monograph available for loan
    Monograph available for loan
    Haar bei München : Franzis-Verl.
    Call number: M 15.89303
    Type of Medium: Monograph available for loan
    Pages: 180 S. , Ill., graph. Darst.
    ISBN: 3645602615 (Pb.) , 9783645602617 (Pb.)
    Series Statement: Python
    Uniform Title: Programming the Raspberry Pi: getting started with Python 〈dt.〉
    Classification:
    Informatik
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Monograph available for loan
    Monograph available for loan
    New York, NY [u.a.] :Routledge,
    Call number: IASS 16.90606
    Type of Medium: Monograph available for loan
    Pages: XV, 282 S. : , Kt. ; , 23 cm
    Edition: 1. issued in paperback
    ISBN: 9780415512831 , 9780415947121 , 0415512832
    Series Statement: Studies in international relations
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Call number: IASS 17.90836
    Description / Table of Contents: "Climate change is an issue that transcends and exceeds formal political and geographical boundaries. Social scientists are increasingly studying how effective policies on climate change can be enacted at the global level, 'beyond the state'. Such perspectives take into account governance mechanisms with public, hybrid and private sources of authority. Studies are raising questions about the ways in which state authority is constituted and practiced in the climate arena, and the implications for how we understand the potential and limits for addressing the climate problem. This book focuses on the rationalities and practices by which a carbon-constrained world is represented, categorized and ordered. The book will enable investigations into a range of sites (e.g., the body, home, shopping centre, firm, city, forests, streets, international bureaucracies, financial flows, migrants and refugees) where subjectivities around climate change and carbon are formed and contested. Despite a growing interest in this area of work, the field remains fragmented and diffuse. This edited collection brings together the leading scholarship in the field to cast new light on the question of how, why, and with what implications climate governance is taking place. It is the first volume to collect this body of scholarship, and provides a key reference point in the growing debate about climate change across the social sciences"--
    Type of Medium: Monograph available for loan
    Pages: XXIV, 270 S. , Ill., graph. Darst.
    ISBN: 9781107046269 (hardback) , 9781107624603 (paperback)
    Language: English
    Note: Machine generated contents note: Introduction J. Stripple and H. Bulkeley; Part I. Governmentality, Critical Theory and Climate Change: 1. Bringing governmentality to the study of global governance E. Lavbrand and J. Stripple; 2. Experimenting on climate governmentality with actor-network theory A. Blok; 3. Third side of the coin: hegemony and governmentality in global climate politics B. Stephan, D. Rothe and C. Methman; 4. The limits of climate governmentality C. Death; Part II. Cases of Climate Government: Theorising Practice: 5. Neuro-liberal climatic governmentalities M. Whitehead, R. Jones and J. Pykett; 6. Making carbon calculations S. Eden; 7. Smart meters and the governance of energy use in the household T. Hargreaves; 8. Translation loops and shifting rationalities of transnational bioenergy governance J. Kortelainen and M. Albrecht; 9. Governing mobile species in a climate-changed world J. Fall; 10. Measuring forest carbon H. Lovell; 11. Climate security as governmentality: from precaution to preparedness A. Oels; Part III. Future Directions: 12. The rise and fall of the global climate polity O. Corry; 13. Climate change multiple S. Randalls; 14. Reflections and way forward H. Bulkeley and J. Stripple..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    Monograph available for loan
    Monograph available for loan
    Cheltenham [u.a.] : Elgar
    Call number: IASS 17.90839
    Type of Medium: Monograph available for loan
    Pages: XVII, 541 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 9781849809405 , 1849809402 , 9781781005446
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
    Monograph available for loan
    Monograph available for loan
    Darmstadt : WBG (Wiss. Buchges.)
    Call number: 9/M 17.90844 ; 9/M 17.90844(2. Ex.)
    Type of Medium: Monograph available for loan
    Pages: 264 S. , zahlr. Ill., graph. Darst., Kt.
    Edition: 4., unveränd. Aufl.
    ISBN: 9783534262458
    Parallel Title: Erscheint auch als Vulkanismus
    Language: German
    Location: Reading room
    Location: Reading room
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 39
    Monograph available for loan
    Monograph available for loan
    Berkeley, Calif : Evolver Editions
    Call number: IASS 17.90846
    Type of Medium: Monograph available for loan
    Pages: XXII, 256 S
    ISBN: 9781583945001 (pbk.)
    Language: English
    Note: Preface -- Manifesto: a call to establish a legitimate, wise, powerful collective voice of the people -- Democracy is about power and the people -- Direct democracy, representative democracy, and their shadows -- Why we need public wisdom -- Public wisdom: its role, its sources and its limitations -- Citizenship and the random selection of ad hoc mini publics -- Citizen deliberative councils: their character, variety and history -- How citizen deliberative councils could and should be used -- Public empowerment, public engagement, and the role of journalism -- Polarization, transpartisanship, and public wisdom -- Wisdom councils in 100 cities; with study circles, world cafes, and open space to engage the public with the results -- Deliberation for direct democracy -- Empowered public wisdom rising from the grassroots -- A new branch of government? -- Protecting the power and integrity of public wisdom -- What role will you play? -- Appendices -- An annotated list of powerful participatory processes, with links -- Some areas for research and development..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: IASS 16.89972
    Description / Table of Contents: "The scale, effectiveness and legitimacy of global governance lag far behind the world's needs. This path-breaking book examines how far civil society involvement provides an answer to these problems. Does civil society make global governance more democratic? Have citizen action groups raised the accountability of global bodies that deal with challenges such as climate change, financial crises, conflict, disease and inequality? What circumstances have promoted (or blocked) civil society efforts to make global governance institutions more democratically accountable? What could improve these outcomes in the future? The authors base their argument on studies of thirteen global institutions, including the UN, G8, WTO, ICANN and IMF. Specialists from around the world critically assess what has and has not worked in efforts to make global bodies answer to publics as well as states. Combining intellectual depth and political relevance, Building Global Democracy? will appeal to students, researchers, activists and policymakers"--
    Type of Medium: Monograph available for loan
    Pages: xxv, 397 S.
    ISBN: 9780521140553
    Language: English
    Note: Machine generated contents note: Introduction Jan Aart Scholte; 1. Global governance, accountability and civil society Jan Aart Scholte; 2. Civil society and accountability of the United Nations Kerstin Martens; 3. The World Bank and democratic accountability: the role of civil society Alnoor Ebrahim and Steven Herz; 4. Civil society and IMF accountability Jan Aart Scholte; 5. Civil society and the WTO: contesting accountability Marc Williams; 6. Civil society and accountability in the Commonwealth Timothy M. Shaw and Pamela K. Mbabazi; 7. The organisation of the Islamic conference, accountability and civil society Saied Reza Ameli; 8. Civil society and patterns of accountability in the OECD Morten Ougaard; 9. Civil society and G8 accountability Peter I. Hajnal; 10. Structuring accountability: the Asia-Europe meeting Julie Gilson; 11. Civil society and accountability in global governance of climate change Peter Newell; 12. Civil society and accountability promotion in the global fund Carolyn Long and Nata Duvvury; 13. Accountability in private global governance: ICANN and civil society Mawaki Chango; 14. Civil society and the World Fair Trade Organisation: developing responsive accountability Heidi Ullrich; Conclusion Jan Aart Scholte..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 41
    Monograph available for loan
    Monograph available for loan
    Princeton : Princeton University Press
    Call number: PIK E 713-15-0146
    Description / Table of Contents: As countless love songs, movies, and self-help books attest, men and women have long sought different things. The result? Seemingly inevitable conflict. Yet we belong to the most cooperative species on the planet. Isn't there a way we can use this capacity to achieve greater harmony and equality between the sexes? In The War of the Sexes, Paul Seabright argues that there is--but first we must understand how the tension between conflict and cooperation developed in our remote evolutionary past, how it shaped the modern world, and how it still holds us back, both at home and at work. 〈
    Type of Medium: Monograph available for loan
    Pages: XI, 241 S. : Ill.
    ISBN: 9780691159720
    Language: English
    Note: Cover; Title Page; Copyright Page; Dedication Page; Table of Contents; Acknowledgments; Part One: Prehistory; 1. Introduction; 2. Sex and Salesmanship; 3. Seduction and the Emotions; 4. Social Primates; Part Two: Today; 5. Testing for Talent; 6. What Do Women Want?; 7. Coalitions of the Willing; 8. The Scarcity of Charm; 9. The Tender War; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    Call number: PIK M 900-16-89750
    Description / Table of Contents: Main description: Der Briefwechsel zwischen den Mathematikern Richard Dedekind und Heinrich Weber liegt nun erstmals in transkribierter Form vor. Es handelt sich um einen der wichtigsten Briefwechsel von Mathematikern im 19. Jahrhundert, da nahezu jedes Teilgebiet der Mathematik angesprochen wird und damals beginnende Entwicklungen intensiv diskutiert wurden. Personen- und Werkverzeichnisse erleichtern den Überblick über die in den Briefen diskutierten Themen.
    Description / Table of Contents: Main description: This volume provides the very first transcription of correspondence between Richard Dedekind and Heinrich Weber, one of the most important instances of written dialog between mathematicians in the 19th century. Nearly every subarea of mathematics is addressed in the letters, which intensively discuss nascent developments in the field. A register of persons and index of works ease access to the topics discussed in the letters.
    Type of Medium: Monograph available for loan
    Pages: XX, 490 S. , Ill. , 24 cm
    ISBN: 3110373661 (Gb.) , 9783110373660 (Gb.) , 9783110368048 (electr.; PDF) , 9783110398656 (electr.; ePub)
    Series Statement: Abhandlungen der Akademie der Wissenschaften in Hamburg 5
    Language: German
    Note: Techn. Univ., Diss. u.d.T.: Scheel, Katrin: Der Briefwechsel von Richard Dedekind mit Heinrich Weber--Braunschweig, 2015 , Frontmatter -- Grußwort Geleitwort Vorwort des Herausgebers Danksagung Editionskriterien Abkürzungsverzeichnis Inhalt: 1. Einleitung 2. Richard Dedekind 3. Heinrich Weber 4. Briefwechsel Dedekind - Weber 5. Elise Riemann 6. Verlag B. G. Teubner 7. Karl Hattendorff 8. Hermann Amandus Schwarz 9. Friedrich Wöhler A. Verlagsverträge B.G.Teubner-Verlag B. Chronologisches Dokumentenverzeichnis C. Verzeichnis der Fundstellen D. Literaturverzeichnis zum Briefwechsel E. Kurzbiographien Literatur Personenindex..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
    Monograph available for loan
    Monograph available for loan
    Dordrecht [u.a.] : Springer
    Associated volumes
    Call number: 11/M 16.89756
    In: Theory and applications of transport in porous media
    Description / Table of Contents: This book presents the basic principles of soil dynamics, and a variety of solutions of practical interest for geotechnical engineering, geophysics and earthquake engineering. Emphasis is on analytical solutions, often including the full derivation of the solution, and giving the main parts of computer programs that can be used to calculate numerical data. Reference is also made to a website from which complete computer programs can be downloaded. Soil behaviour is usually assumed to be linear elastic, but in many cases the effect of viscous damping or hysteretic damping, due to plastic deformations, is also considered. Special features are: the analysis of wave propagation in saturated compressible porous media, approximate analysis of the generation of Rayleigh waves, the analysis of the response of soil layers to earthquakes in the deep rock, with a theoretical foundation of such problems by the propagation of Love waves, and the solution of such basic problems as the response of an elastic half space to point loads, line loads, strip loads and moving loads.
    Type of Medium: Monograph available for loan
    Pages: XIV, 433 S. , 195 schw.-w. Ill., 6 schw.-w. Tab , 1 CD-ROM , 235 mm x 155 mm
    ISBN: 9789048134403 (Book with DVD.) , 9789048134410
    Series Statement: Theory and applications of transport in porous media 24
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 44
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: M 16.89755
    Description / Table of Contents: Provides a deeper understanding of earthquake processes, based on laboratory-derived physical laws and formulae, for researchers, professionals and graduate students
    Type of Medium: Monograph available for loan
    Pages: x, 270 S.
    Edition: Online-Ausg. 2013
    ISBN: 9781107030060
    Classification:
    Seismology
    Parallel Title: Print version: The Physics of Rock Failure and Earthquakes
    Language: English
    Note: Contents; Preface; 1 Introduction; 2 Fundamentals of rock failure physics; 2.1 Mechanical properties and constitutive relations; 2.1.1 Elastic deformation; 2.1.2 Ductile deformation; 2.1.3 Fracture; 2.1.4 Friction; 2.2 Basics of rock fracture mechanics; 2.2.1 Energy release rate and resistance to rupture growth; 2.2.2 Stress concentration and cohesive zone model; 2.2.3 Breakdown zone model for shear failure; 2.2.4 j-integral and energy criterion for shear failure; 2.2.5 Relation between resistance to rupture growth and constitutive relation parameters. , 3 Laboratory-derived constitutive relations for shear failure3.1 Shear failure of intact rock; 3.1.1 Method and apparatus used; 3.1.2 Constitutive relations derived from data on the shear failure of intact rock; 3.1.3 Geometric irregularity of shear-fractured surfaces and characteristic length; 3.2 Frictional slip failure on precut rock interface; 3.2.1 Method and apparatus used; 3.2.2 Geometric irregularity of precut fault surfaces and characteristic length; 3.2.3 Constitutive relations derived from data on frictional stick-slip failure. , 3.2.4 Laboratory-derived relationships between physical quantities observed during dynamic slip rupture propagation3.3 Unifying constitutive formulation and a constitutive scaling law; 3.3.1 Unification of constitutive relations for shear fracture and for frictional slip failure; 3.3.2 A constitutive scaling law; 3.3.3 Critical energy required for shear fracture and for frictional stick-slip failure; 3.3.4 Stabilityinstability of the breakdown process; 3.3.5 Breakdown zone size; 3.4 Dependence of constitutive law parameters on environmental factors; 3.4.1 Introduction. , 3.4.2 Dependence of shear failure strength on environmental factors3.4.3 Dependence of breakdown stress drop on environmental factors; 3.4.4 Dependence of breakdown displacement on environmental factors; 4 Constitutive laws for earthquake ruptures; 4.1 Basic foundations for constitutive formulations; 4.2 Rate-dependent constitutive formulations; 4.3 Slip-dependent constitutive formulations; 4.4 Depth dependence of constitutive law parameters; 5 Earthquake generation processes; 5.1 Shear failure nucleation processes observed in the laboratory; 5.1.1 Introduction; 5.1.2 Experimental method. , 5.1.3 Nucleation phases observed on faults with different surface roughnessesRough fault; Smooth fault; Extremely smooth fault; 5.1.4 Scaling of the nucleation zone size; 5.2 Earthquake rupture nucleation; 5.2.1 Seismogenic background; 5.2.2 Physical modeling and theoretical derivation of the nucleation zone size; 5.2.3 Comparison of theoretical relations with seismological data; 5.2.4 Foreshock activity associated with the nucleation process; 5.3 Dynamic propagation and generation of strong motion seismic waves; 5.3.1 Slip velocity and slip acceleration in the breakdown zone. , 5.3.2 The cutoff frequency fs max of the power spectral density of slip acceleration at the source.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
    Call number: PIK N 454-16-89758
    Type of Medium: Monograph available for loan
    Pages: 521 S. , Ill., graph. Darst., Kt. , 235 mm x 165 mm
    ISBN: 3865814808 (Pb.) , 9783865814807 (Pb.)
    Series Statement: Klimawandel in Regionen zukunftsfähig gestalten - KLIMZUG 3
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 46
    Monograph available for loan
    Monograph available for loan
    Cheltenham, UK : Edward Elgar
    Call number: PIK N 073-16-89994
    Type of Medium: Monograph available for loan
    Pages: XXIII, 227 Seiten , 25 cm
    ISBN: 9780857934154 (hbk.) , 0857934155 (hbk.)
    Language: English
    Note: Contents: 1. Introduction: The Climate Change Problem and Solutions Part 1: Theory 2. The Basis of an Obligation Towards Future Generations in Justice and Ethics in the Context of Climate Change 3. Content of Justice-based Obligations Towards Future Generations in the Context of Climate Change Part II: International Law and Politics 4. Current International Law, Intergenerational Justice and Climate Change 5. International Human Rights Law, Intergenerational Justice and Climate Change 6. Climate Change Discources and Intergenerational Justice Part III: The Way Forward and Conclusion 7. The Way Forward – Incorporating Intergenerational Justice Principles into International Climate Law 8. Conclusion Bibliography Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 47
    Call number: PIK B 160-16-89999
    Description / Table of Contents: 'The financial means embedded in subsidies for unsustainable systems of production and consumption are increasingly well studied and reported. This has led to policy recommendations (e.g. OECD, EU) on how to reform subsidy systems in support of the necessary transitions to a low carbon and ecosystem resilient society based on a strong resource efficient economy. The authors in this book contribute to the debate based on recent, high quality and policy relevant research. It is a timely contribution to a pressing financial issue in environmental policy.'--Hans Bruyninckx , Executive Director of the European Environment Agency. 'Recently the IPCC finished their 5th Assessment report and we see that while emissions continue unabated - and in some areas even increase, relatively little is done in terms of policy making. Instead of sound policies to deal with climate issues, we are still faced with perverse incentives that promote fossil fuels. This book sets itself a very important agenda of trying to find a workable path towards abolishing such subsidies. This is vital reading for all policy makers.'--Thomas Sterner, Visiting Chief Economist, Environmental Defense Fund Professor of environmental economics, University of Gothenburg. 'EU countries increasingly receive recommendations through the European Semester and OECD Environmental Performance Reviews to assess and progressively phase out environmentally harmful subsidies. It is not only a matter of avoiding damage to the environment, it is also a question of transparency, equity, and of eliminating unjustified privileges. Subsidy reform can help reduce public deficits, restore fair market conditions and eliminate distortions in competition. This book is a precious tool for Governments and experts.'--Aldo Ravazzi Douvan, Italian Ministry of Environment, Professor of Sustainable Development at University Roma Luiss. 'Tax spending and public subsidies harmful to the environment have attracted high level attention at the Rio and Johannesburg Sustainable Development Conferences, in the context of the Kyoto Protocol and of the Convention on Biological Diversity, in OECD and EU recommendations, and are now firmly on the public agenda. They are often also poorly designed, do not reach their goals, are costly, not transparent and can be inefficient. With the present public budget crises in many countries, rarely has the timing been more favorable to lower such harmful support. The book is thus timely and shows throu ...
    Type of Medium: Monograph available for loan
    Pages: XIII, 348 S. , graph. Darst.
    ISBN: 9781782545309
    Language: English
    Note: 1. Introduction : high hopes and down-to-earth realism / Frans Oosterhuis and Patrick ten Brink2. A global survey of potentially environmentally harmful subsidies / Ronald Steenblik -- 3. Hidden subsidies : the invisible part of the EHS iceberg / Sirini Withana ... [et al.] -- 4. Can we recognise an environmentally harmful subsidy if we see one? / Jan Pieters -- 5. Quantifying the impacts of environmentally harmful subsidies / Cees van Beers and Jeroen van den Bergh -- 6. Energy subsidies / Frans Oosterhuis and Katharina Umpfenbach -- 7. Environmentally harmful subsidies in the transport sector / Laurent Franckx and Inge Mayeres -- 8. Agriculture, food and water / Frans Oosterhuis and Kris Bachus -- 9. Environmentally harmful subsidies and biodiversity / Patrick ten Brink ... [et al.] -- 10. Reforming EHS in Europe : success stories, failures and agenda setting / Jacqueline Cottrell -- 11. Phasing out environmentally harmful subsidies worldwide / Anja von Moltke -- 12. Reform of environmentally harmful subsidies : distributional issues / Annegrete Bruvoll and Haakon Vennemo -- 13. The way forward : reforming EHS in the transition to a green economy / Patrick ten Brink, Sirini Withana and Frans Oosterhuis..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    Monograph available for loan
    Monograph available for loan
    London : Routledge
    Call number: PIK N 454-17-90902
    Type of Medium: Monograph available for loan
    Pages: XI, 452 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9781444104882 , 1444104888
    Language: English
    Note: Contents: 1. A looming crisis Part I Status and challenges 2. Rising demand and dwindling per capita resources 3. Water and poverty 4. Governance and finance 5. Pollution and water-related disease 6. Water, land and wildlife 7. Dams and diversions 8. Trading water - real and virtual 9. Water, war and terrorism 10. The threat of global warming Part II Nature's resources 11. The restless water cycle 12. Shrinking freshwater stores Part III Towards sustainability 13. Cutting demand 14. Increasing supplies 15. Cleaning up and protecting the aquatic environment 16. Using seawater 17. Controlling the weather 18. Improved monitoring and data management 19. Improving prediction and risk assessment 20. Improving management and justice 21. Aid for the developing world Conclusions 22. Is sustainability achievable?
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    Call number: IASS 16.89805
    Description / Table of Contents: Chronicles the efforts of nature photographer James Balog to document the receding of the Solheim glacier in Iceland, a consequence of climate change and global warming, in which strategically placed cameras would take one picture every hour for three years
    Type of Medium: Non-book medium
    Pages: 1 DVD (ca. 75 Min)
    Language: English
    Note: Extra features: Film festival Q&AsMaking chasing ice -- Science update-- Original theatrical trailer.. , DVD; NTSC, Region 1; widescreen presentation; Dolby Digital 5.1 Surround , In English with optional subtitles in German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: PIK P 120-16-89806
    Description / Table of Contents: Deutschland wird seine bisher weitgehend auf fossilen Brennstoffen basierende Energieversorgung bis zum Jahr 2050 auf großtenteils regenerative Energien umstellen. Die Burgerinnen und Burger dieses Landes kennen dieses weltweit einzigartige Projekt unter dem Namen Energiewende. Von ihren gesellschaftlichen Wurzeln, dem Beginn ihrer Umsetzung und ihrer rasanten Entwicklung in den letzten Jahren berichtet Klaus-Dieter Maubach. Er beschreibt, wie das deutsche Energiesystem der Zukunft aussehen muss, und schlagt einen kurzfristigen Aktionsplan vor, der die volkswirtschaftlichen Kosten eindammt und
    Type of Medium: Monograph available for loan
    Pages: XX, 293 Seiten
    Edition: 2. Auflage
    ISBN: 3658054735 , 9783658054731
    Language: German
    Note: Vorwort zur zweiten Auflage; Vorwort; Inhalt; Abkürzungen; Einführung; Teil I; Eine kurze Geschichte der Energiewende; Fukushima und Ausstieg (2011); Fundamente der Energiewende (1980 - 1998); EnWG und EEG (1998 - 2003); Emissionshandel und Energiepreise (2003 - 2008); Netzregulierung und EEG (2004 - 2008); Krise in Europa (2009 - 2012); Teil II; Die Zukunft der Energiewende; Standortbestimmung (2013); 2050: Energiewende; Fossile Primärenergien; Die Regenerativen; Energiesystem der Zukunft; Politik für die Energiewende; 1 Braunkohle und Erdgas; 2 Auslaufbetrieb der Kernenergie ; 3 Energieeffizienz ; 4 Emissionshandel ; 5 EEG Reform ; 6 Regulierung der Stromnetze ; 7 Strommarktgestaltung ; 8 Koordinierung der Energiewende ; Zusammenfassung.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
    Call number: S 92.0551(61, 1)
    Type of Medium: Series available for loan
    Pages: 103 Seiten , Illustrationen, Diagramme , 30 cm
    ISBN: 9783910006546
    Series Statement: Geologica Saxonica 61,1
    Language: German
    Note: Beiträge teilweise in deutscher, teilweise in englischer Sprache
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 52
    Monograph available for loan
    Monograph available for loan
    Oxford : Oxford Univ. Press
    Call number: IASS 16.89898
    Type of Medium: Monograph available for loan
    Pages: XV, 270 S. , Ill., graph. Darst.
    Edition: 3. ed.
    ISBN: 0199696004 , 9780199696000
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 53
    Monograph available for loan
    Monograph available for loan
    New York, N.Y. : Worth Publ.
    Call number: PIK B 730-16-89469
    Type of Medium: Monograph available for loan
    Pages: XXXII, 410 S.
    Edition: 3. ed.
    ISBN: 9781429278447 (pbk.)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: PIK E 719-15-89468
    Description / Table of Contents: Der Wandel der Energiewirtschaft hin zu mehr Stromerzeugung aus erneuerbaren Energien spielt sich in physisch-materieller Hinsicht in Landschaften ab. Er wird von Praktikern der Raum- und Landschaftsplanung teils mit Skepsis und teils mit positiven Erwartungen begleitet. In dem Band wird den Fragen nachgegangen, welche Folgen die Energiewende auf die ästhetische Bewertung von Landschaften hat, welche neuen Akteurskonstellationen entstanden sind und welche Konflikte um das Landschaftsbild, die Landnutzung oder die Verteilung von Macht zu verzeichnen sind. Es werden die Konsequenzen der Umbrüche hin zu "neuen Energielandschaften" für die Landschaftsforschung, aber auch für räumliche Planung und Governance thematisiert.
    Type of Medium: Monograph available for loan
    Pages: 219 S. , Ill., graph. Darst., Kt. , 240 mm x 168 mm
    ISBN: 3531197940 (Pb.) , 9783531197944 (Pb.)
    Series Statement: RaumFragen: Stadt - Region - Landschaft
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 55
    Call number: IASS 16.89938
    Description / Table of Contents: Unverändert gilt die Einschätzung von O. Kaptein zur 1. Auflage (ID-B 29/11), dass dieses Buch weniger einen touristischen Sinn erfüllt, sondern vielmehr als Hilfsmittel zur Projektplanung oder zu schulischen Zwecken dienen kann, für alle, die auf der Suche nach Vorzeigeprojekten der verschiedenen Formen von erneuerbaren Energien in einer bestimmten Gegend sind. Viele Kaufinteressenten hatten dies unter dem Label "Baedeker" missverstanden, was entsprechend säuerliche Bewertungen im Internet zur Folge hatte. Daher ist dieser Führer definitiv besser im Bestand zu den erneuerbaren Energien als bei der Reiseliteratur aufgehoben und rechtfertigt dort durchaus die breite Empfehlung für die genannte Zielgruppe. Gegenüber der 1. Auflage wurden die Touren herausgenommen und durch "Specials" zu Metropolregionen ersetzt, rund 30 neue Ziele wurden aufgenommen und die Angaben aktualisiert. Wo die Vorauflage gut genutzt wird, sollte sie um die vorliegende ergänzt werden. (2 A) (LK/LEV: Junker)
    Description / Table of Contents: Vorstellung von rund 190 in Deutschland umgesetzten Projekten zu erneuerbaren Energien, mit Basisinformationen, Wegbeschreibungen und Weblinks. Nützlich für thematisch Interessierte, die Praxisbeispiele in einer bestimmten Region besichtigen möchten. (LK/LEV: Junker)
    Type of Medium: Monograph available for loan
    Pages: 195 S. , zahlr. Ill. (farb.), graph. Darst., Kt. , 19 cm
    Edition: 2. Aufl., Red.-Schluss: 12/2013
    ISBN: 9783829714952
    Series Statement: Baedeker
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 56
    Call number: PIK B 020-16-89503
    Type of Medium: Monograph available for loan
    Pages: XXII, 287 S. , graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9783834921314 (PB.)
    Series Statement: Gabler research
    Language: German
    Note: Univ., Diss., Hohenheim, 2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
    Monograph available for loan
    Monograph available for loan
    Heidelberg [u.a.] : Springer
    Call number: PIK M 390-16-89505
    Type of Medium: Monograph available for loan
    Pages: XVIII, 436 S. , graph. Darst. , 235 mm x 155 mm
    Edition: 4. ed., 2. corr. print.
    ISBN: 9783642142789 (PB.) , 9783642142796
    Series Statement: Graduate texts in mathematics 173
    Language: English
    Note: The basics -- Matching, covering and packing -- Connectivity -- Planar graphs -- Colouring -- Flows -- Extremal graph theory -- Infinite graphs -- Ramsey theory for graphs -- Hamilton cycles -- Random graphs -- Minors, trees, and WQO..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 58
    Call number: M 15.89533
    Type of Medium: Monograph available for loan
    Pages: 1008 S.
    Edition: 4., aktualisierte und erw. Aufl.
    ISBN: 3836219174 , 9783836219174
    Series Statement: SAP PRESS
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 59
    Monograph available for loan
    Monograph available for loan
    Bonn [u.a.] : Galileo Press
    Call number: M 16.89534
    Type of Medium: Monograph available for loan
    Edition: 3. Aufl.
    ISBN: 978-3-8362-3768-0
    Series Statement: SAP Press
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
    Call number: M 15.89535
    Type of Medium: Monograph available for loan
    Pages: 548 S. , Ill. , 24 cm
    Edition: 3., aktualisierte und erw. Aufl.
    ISBN: 3836226758 , 9783836226752
    Series Statement: SAP Press
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 61
    Monograph available for loan
    Monograph available for loan
    Weinheim : Wiley
    Call number: M 17.90962
    Description / Table of Contents: Das bewährte Konzept der Fallstricke - jetzt auch für ICP! Eingängige, hervorragend durchdachte Kombinationen von Bildmaterial und knappen, aber aussagekräftigen Texten vermitteln die gewünschte Lösung ohne Umwege
    Type of Medium: Monograph available for loan
    Pages: V, 204 Seiten
    ISBN: 9783527318971
    Language: German
    Note: Decken; Inhaltsverzeichnis; Titelblatt; Copyright; 1 Einleitung; 2 Bevor Sie mit der Fehlersuche loslegen; 2.1 Die wichtigsten Grundlagen der ICP OES zusammengefasst; 2.2 Allgemeine praktische Hinweise; 3 Die ""Symptomliste"; 3.1 Keine oder unzureichende Empfindlichkeit; 3.2 Kalibrierfunktion; 3.3 Die Messwerte sind falsch; 3.4 Die Messwerte schwanken (schlechte Präzision oder Drift); 3.5 Merkwürdige Peaks; 3.6 Hardware; 3.7 Gefahr im Verzug; 3.8 Bekannte Problemfälle; Stichwortverzeichnis.
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 62
    Monograph available for loan
    Monograph available for loan
    Princeton, NJ [u.a.] : Princeton Univ. Press
    Call number: IASS 16.90484
    Type of Medium: Monograph available for loan
    Pages: XXI, 279 S.
    ISBN: 9780691155654 (hbk : alk. paper)
    Parallel Title: Online-Ausg. Landemore, Hélène: Democratic reason
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Call number: S 93.0422(147)
    Type of Medium: Series available for loan
    Pages: 329 S. , Ill., Kt.
    Series Statement: Scripta geologica 147
    Language: English
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
    Monograph available for loan
    Monograph available for loan
    Frankfurt am Main : Fischer-Taschenbuch-Verl.
    Call number: IASS 16.90436
    Type of Medium: Monograph available for loan
    Pages: 93 S.
    Edition: Erw. Ausg., 13. Aufl.
    ISBN: 9783596100835
    Series Statement: Fischer-Taschenbücher 10083
    Uniform Title: L' ordre du discours 〈dt.〉
    Language: German
    Note: Die Vorlage enth. insgesamt 2 Werke
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 65
    Monograph available for loan
    Monograph available for loan
    Boston, Mass. : Mariner | Boston [u.a.] : Houghton Mifflin Harcourt
    Call number: IASS 16.90441
    Type of Medium: Monograph available for loan
    Pages: 262 S.
    ISBN: 9780618990610 , 9780547520230 (pbk.)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Monograph available for loan
    Monograph available for loan
    Cambridge [u.a.] : Cambridge Univ. Press
    Call number: IASS 16.90516
    Description / Table of Contents: "James Madison wrote, 'Had every Athenian citizen been a Socrates, every Athenian assembly would still have been a mob.' The contributors to this volume discuss and for the most part challenge this claim by asking whether many minds can be wiser than one"--
    Type of Medium: Monograph available for loan
    Pages: X, 409 S. , graph. Darst.
    ISBN: 1107010330 (hbk) , 9781107010338 (hbk) , 1107630274 (pbk) , 9781107630277 (pbk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    Call number: M 17.90450
    Type of Medium: Monograph available for loan
    Pages: 326 S. , Ill., graph. Darst., Kt , 25 cm
    ISBN: 9783816784111 (Pp.)
    Classification:
    E.4.
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Call number: IASS 16.90467
    Type of Medium: Monograph available for loan
    Pages: 266 S. , Ill., graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9783531163031 (Pb.)
    Series Statement: Interdisziplinäre Diskursforschung
    Parallel Title: Online-Ausg. Keller, Reiner: Diskurs - Macht - Subjekt
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : VS Verlag
    Call number: IASS 16.90468
    Type of Medium: Monograph available for loan
    Pages: 136 Seiten , Illustrationen
    Edition: 4. Auflage
    ISBN: 9783531173528
    Series Statement: Qualitative Sozialforschung Band 14
    Parallel Title: Erscheint auch als Diskursforschung
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Monograph available for loan
    Monograph available for loan
    Berlin [u.a.] : Springer
    Call number: PIK N 456-16-89760
    Description / Table of Contents: Der "Klimabericht für die Metropolregion Hamburg" wurde im Rahmen des Exzellenzclusters CliSAP am KlimaCampus der Universität Hamburg und ihrer außeruniversitären Partner erarbeitet. Zweck ist eine Zusammenstellung des in wissenschaftlich legitimierter Weise veröffentlichten Wissens über Klima, Klimavariabilität und Klimawandel in dieser Region. Es werden sowohl das Wissen über die vergangenen 100 Jahre, soweit vorhanden, als auch die erwarteten bzw. möglichen Veränderungen in den kommenden 100 Jahren beschrieben. Neben grundlegenden Kapiteln urden Kapitel erarbeitet, in denen über Klimafolgen in bestimmten Bereichen berichtet wird. Dazu zählen zum Beispiel Landwirtschaft, Stadtklima und Küstenschutz. Der Bericht stellt dar, inwiefern Übereinstimmung über Wissen besteht, in welchen Fragen Uneinigkeit oder Unwissen herrscht und inwiefern weiterer Forschungsbedarf besteht.
    Type of Medium: Monograph available for loan
    Pages: XVI, 321 S. , graph. Darst., Kt. (z.T. farb.) , 27 cm
    ISBN: 3642160344 (GB.) , 9783642160349 (GB.) , 9783642160356
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Monograph available for loan
    Monograph available for loan
    Berkeley, Calif. [u.a.] : Univ. of California Press
    Call number: IASS 16.90487
    Type of Medium: Monograph available for loan
    Pages: VI, 323 S.
    Edition: 1. paperback ed., [Nachdr.]
    ISBN: 0520021568 , 9780520021563
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    Monograph available for loan
    Monograph available for loan
    Novato, Calif. :New World Library,
    Call number: IASS 16.90550
    Type of Medium: Monograph available for loan
    Pages: xiv, 272 p. : , ill. ; , 22 cm.
    ISBN: 9781577319726 (pbk. : alk. paper)
    Language: English
    Note: Three stories of our time -- Trusting the spiral -- Coming from gratitude -- Honoring our pain for the world -- A wider sense of self -- A different kind of power -- A richer experience of community -- A larger view of time -- Catching an inspiring vision -- Daring to believe it is possible -- Building support around you -- Maintaining energy and enthusiasm -- Strengthened by uncertainty.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
    Monograph available for loan
    Monograph available for loan
    Princeton, NJ [u.a.] : Princeton Univ. Press
    Call number: IASS 17.91176
    Type of Medium: Monograph available for loan
    Pages: XII, 174 S. , graph. Darst.
    ISBN: 9780691143989 (hbk.)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 74
    Monograph available for loan
    Monograph available for loan
    Princeton, NJ [u.a.] : Princeton Univ. Press
    Call number: IASS 16.90619
    Type of Medium: Monograph available for loan
    Pages: LIV, 391 S. , Ill.
    Edition: Paperback reissue, with a new introd.
    ISBN: 0691150206 (pbk.) , 9780691150208 (pbk.)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Monograph available for loan
    Monograph available for loan
    Pittsburgh, Pa. : Univ. of Pittsburgh Press
    Call number: IASS 16.90612
    Description / Table of Contents: "Advancements in computing, instrumentation, robotics, digital imaging, and simulation modeling are changing science into a technology-driven institution. The pragmatic interests of government, industry, and society increasingly exert their influence over science, raising questions of values and objectivity. These and other profound changes in the world of science have led many to speculate that we are in the midst of an epochal break in scientific history. This edited volume presents an in-depth examination of these issues from philosophical, historical, social, and cultural perspectives. It presents arguments both for and against the epochal break thesis in light of historical antecedents, offering an important occasion for philosophical analysis of the epistemic, institutional and moral questions affecting current and future scientific pursuits. "--P. 4 of cover
    Type of Medium: Monograph available for loan
    Pages: VII, 222 S. , Ill.
    ISBN: 0822961636 (pbk.) , 9780822961635 (pbk.)
    Language: English
    Note: Science after the end of science? An introduction to the "epochal break thesis" / Alfred Nordmann, Hans Radder, Gregor Schiemann -- The age of technoscience / Alfred Nordmann -- We are not witnesses to a new scientific revolution / Gregor Schiemann -- "Knowledge is power," or how to capture the relationship between science and technoscience / Martin Carrier -- Climbing the hill: seeing (and not seeing) epochal breaks from multiple vantage points / Cyrus C. M. Mody -- Breaking up with the epochal break: the case of engineering sciences / Mieke Boon, Tarja Knuuttila -- Science and its recent history: from an epochal break to novel, nonlocal patterns / Hans Radder -- Knowledge-making in transition: on the changing contexts of science and technology / Andrew Jamison -- Alliances between styles: a new model for the interaction between science and technology / Chunglin Kwa -- Experimenting with the concept of experiment: probing the epochal break / Astrid Schwarz, Wolfgang Krohn -- Intensification, not transformation: digital media's effects on scientific practice / Valerie Hanson -- Technologies of viewing: aspects of imaging in natural sciences / Angela Krewani -- Technoscience as popular culture: on pleasure, consumer technologies, and the economy of attention / Jutta Weber -- The good old days: medical research then and now / James Robert Brown -- Toward a new culture of prediction: computational modeling in the era of desktop computing / Ann Johnson, Johannes Lenhard -- Epilogue: the sticking points of the epochal break thesis / Hans Radder..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    Monograph available for loan
    Monograph available for loan
    Köln : Luchterhand
    Call number: PIK B 405-17-90623
    Type of Medium: Monograph available for loan
    Pages: XXXIV, 2474 S.
    Edition: 9. Aufl.
    ISBN: 9783472084273
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Monograph available for loan
    Monograph available for loan
    Dordrecht : Springer Netherlands
    Call number: M 17.90938
    Description / Table of Contents: Over the last 30 years, Dr. Nikita V. Chukanov has collected IR spectra of about 2000 mineral species, including 247 holotype samples. In this book, he presents 3309 spectra of these minerals with detailed  description and analytical data for reference samples. In the course of this work, about 150 new mineral species have been discovered. This book presents spectra of each mineral together with a description and comments on standard samples used (occurrence, appearance, associated minerals, empirical formula etc.). Sections are organized according to different classes of compounds (silicates, phosphates, arsenates, oxides etc.)
    Type of Medium: Monograph available for loan
    Pages: IX, 1726 p. 3547 illus., 1 illus. in color
    Edition: Online edition Springer eBook Collection. Earth and Environmental Science
    ISBN: 9789400771284 , 9789400771277 (print)
    Series Statement: Springer Geochemistry / Mineralogy
    Parallel Title: Print version Infrared spectra of mineral species : Extended library
    Language: English
    Note: The Application of IR Spectroscopy to the Investigation of MineralsThe Discrete Approach -- The Full-Profile Analysis -- Polymerization of coordination polyhedra and structure topology -- Hydrogen-bearing groups and hydrogen bonding -- Solid-solution series -- Force parameters of cations in silicates -- IR spectra of minerals and reference samples data -- Borates, including sulfato-borates and arsenato-borates -- Carbides and carbonates -- Organic compounds and salts of organic acids -- Ammino-complexes, nitrates and sulfato-nitrates -- Oxides and hydroxides -- Fluorides -- Silicates -- Phosphates -- Sulfates, carbonato-sulfates, phosphato-sulfates and sulfides -- Chlorides -- Vanadates and vanadium oxides -- Chromates -- Arsenates, arsenites and sulfato-arsenates -- Selenites, molybdates, tellurites, tellurates, iodites, wolframates and wolfram oxides..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    Monograph available for loan
    Monograph available for loan
    Waterloo, Ontario :CIGI,
    Call number: IASS 16.90382
    Description / Table of Contents: Acronyms -- Acknowledgments -- Introduction -- Kimie Hara and Ken Coates -- Forces for Change in the Arctic: Reflections on a Region in Transition -- Ken Coates -- The Process of Formulating Japan's Arctic Policy: From Involvement to Engagement -- Fujio Ohnishi -- China and the Arctic: China's Interests and Participation in the Region -- Kai Sun -- Arctic Prospects and Challenges from a Korean Perspective -- Young Kil Park -- East Asia and the Arctic: Alaskan and American Perspectives -- Jerry McBeath -- Canada's Northern Strategy and East Asian Interests in the Arctic
    Description / Table of Contents: P. Whitney Lackenbauer and James Manicom -- The Cooperation of Russia and Northeast Asian Countries in the Arctic: Challenges and Opportunities -- Tamara Troyakova -- From Cold War Thaws to the Arctic Thaw: The Changing Arctic and Its Security Implications to East Asia -- Kimie Hara -- The Business of Arctic Development: East Asian Economic Interests in the Far North -- Carin Holroyd -- Border Dynamics in Eurasia: Implications for the Arctic Thaw -- Akihiro Iwashita -- The Arctic and Geopolitics -- David A. Welch -- East Asian States and the Pursuit of Arctic Council Observer Status
    Description / Table of Contents: James Manicom and P. Whitney Lackenbauer -- Contributors
    Description / Table of Contents: The Arctic's profile as a region for engagement and opportunity is rising among both circumpolar and non-circumpolar states
    Type of Medium: Monograph available for loan
    Pages: viii, 217 Seiten , Illustrationen, Karten
    ISBN: 9781928096023 (print) , 9781928096030
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
    facet.materialart.12
    Wiesbaden, Germany : Springer Gabler
    Call number: 9783658065287 (e-book)
    Description / Table of Contents: Die zügige und ganzheitliche Einarbeitung und Integration eines neuen Mitarbeiters (Onboarding) ist ein zentraler Prozess, um die Leistungsfähigkeit einer Organisation dauerhaft sicherstellen zu können. Diese Investitionsleistung zahlt sich mehrfach aus, denn nur auf dieser Grundlage wird der neue Mitarbeiter seine volle Leistungsfähigkeit und Leistungsbereitschaft zum Nutzen der Organisation entwickeln. Dieses Essential bietet konkrete Hilfestellungen, um den Onboarding-Prozess für alle Beteiligten - den neuen Mitarbeiter, die Führungskraft und den HR Bereich - erfolgreich gestalten zu können.
    Type of Medium: 12
    Pages: 1 online resource (39 pages)
    ISBN: 9783658065287 (e-book)
    ISSN: 2197-6716
    Series Statement: Essentials
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 80
    Monograph available for loan
    Monograph available for loan
    Baden-Baden : Nomos
    Call number: IASS 17.91105
    Type of Medium: Monograph available for loan
    Pages: 243 S.
    Edition: 1. Aufl.
    ISBN: 9783848705153
    Series Statement: Zeitschrift für Politikwissenschaft 2013
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Monograph available for loan
    Monograph available for loan
    New York : McGraw-Hill
    Call number: 5/M 18.91140
    Type of Medium: Monograph available for loan
    Pages: 744 S.
    ISBN: 9780073408903
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Call number: N 17.91148
    Description / Table of Contents: Viele sozialwissenschaftliche Untersuchungen beruhen auf Rekonstruktionen von Situationen oder Prozessen. Das Lehrbuch vermittelt anhand zweier Beispieluntersuchungen anwendungsbereites Wissen über alle Phasen solcher rekonstruierender Untersuchungen und stellt je eine Erhebungs- und eine Auswertungsmethode ausführlich vor. Die Interviewpartner werden als Experten aufgefasst, die über spezifisches Wissen über die zu rekonstruierenden Sachverhalte verfügen. Die qualitative Inhaltsanalyse ermöglicht eine systematische Extraktion relevanter Informationen aus den Interviews und ist zugleich offen für nicht erwartete Befunde. Mit Lernfragen nach jedem Kapitel und einer übersichtlichen Gliederung eignet sich das Buch als praxisorientierte Einführung.
    Type of Medium: Monograph available for loan
    Pages: 347 Seiten , Illustrationen, Diagramme , 21 cm
    Edition: 4. Auflage
    ISBN: 3531172387 (Pb.) , 9783531172385 (Pb.)
    Series Statement: Lehrbuch
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Call number: IASS 17.91169
    Type of Medium: Monograph available for loan
    Pages: XXVI, 246 S. , Ill., graph. Darst., Kt
    Edition: first paperback
    ISBN: 9781138967038 (pbk) , 9781844078486 (hbk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Monograph available for loan
    Monograph available for loan
    New York [u.a.] : Routledge
    Call number: IASS 17.91217
    Type of Medium: Monograph available for loan
    Pages: 242 S. , graph. Darst. , 23cm
    ISBN: 0714682772 , 9780714682778 , 0714653357 (cloth)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Monograph available for loan
    Monograph available for loan
    Opladen [u.a.] : Budrich Publ.
    Call number: IASS 17.91240
    Description / Table of Contents: Although the concept of power is central to the study of politics, there is no agreement as to what exactly power is. Power is often viewed negatively, as domination, though it is also the case that power is created by people acting in concert, in which case it can have positive effects. Making sense of this puzzle is one of the aims of this book, which provides the reader with a clear and coherent way of understanding the various forms and manifestations of power, and it does so by bringing together the most important and influential perspectives on power within the political and social sciences.
    Type of Medium: Monograph available for loan
    Pages: 230 S. , graph. Darst.
    ISBN: 3866491050 (Pb.) , 9783866491052 (Pb.) , 9783866495169 (electronic; ebook)
    Series Statement: The World of political science - The development of the discipline
    Language: English
    Note: Introduction / Mark Haugaard and Kevin Ryan -- Power in social and political theory / Mark Haugaard and Kevin Ryan -- Power in political anthropology / John Gledhill -- Foundations of organizational power / Stewart Clegg -- Gendering power : feminist approaches / Jill Vickers -- The political sociology of power / John A. Hall and Siniša Malešević -- Power and international relations / Phillip G. Cerny -- Concluding reflections / Kevin Ryan and Mark Haugaard..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    Call number: PIK N 531-18-91762
    Type of Medium: Monograph available for loan
    Pages: XLIX, 436 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9789400742222 , 9789400742239 (electronic; eBook)
    Series Statement: Local sustainability 2
    Language: English
    Note: Contents: Part 1: Introduction ; The Global Adaptation Community Expands Its Scope ; Part 2: Urban Risk and Assessing Vulnerability at the Local Level ; Introduction: Urban Risk and Assessing Vulnerability at the Local Level ; A Region at Risk: Policy Determination Through Vulnerability Hotspot Assessment ; Developing a Framework for Assessing Coastal Vulnerability to Sea Level Rise in Southern New England, USA ; Quantifying Impacts of Potential Sea-Level Rise Scenarios on Irish Coastal Cities ; Mapping Risk and Vulnerability in São Paulo Metropolitan Region ; Water Crisis: Public Management of a Critical Situation ; Environmental Assessment and Restoration of Typhoon Morakot Disaster: A Case Study in Kaohsiung, Chinese Taipei ; Flood Risk Protection Concept for the Urban Region Geising/Altenberg in the Flood Formation Area of the Eastern Ore Mountains, Germany ; Part 3: Toward the Resilient City ; Introduction: Toward the Resilient City ; Water, Energy and Food Security in Mexico City ; Nature at the Heart of Urban Design for Resilience ; Smart City: Energy Efficiency in a New Scope ; Resilient Food Systems for Resilient Cities ; Urban Agriculture Casablanca ; Adapting Cities to Climate Change: Scenarios for Urban Neighbourhoods in the City of Essen ; Combining Urban Development with Climate Change Adaptation Using a Systems Approach ; Towards Resilient Architecture ; Towards More Resilient Water Infrastructures ; Building ‘Equitable’ Urban Resilience: The Challenge for Cities ; Climate Change and the Urban Poor: Support of the German Development Cooperation to a City in Bangladesh ; The Green Infrastructure Transect: An Organizational Framework for Mainstreaming Adaptation Planning Policies ; Part 4: Frameworks for Local Response to Climate Change: Challenges and Recommendations ; Introduction: Framework for Local Responses to Climate Change: Challenges and Recommendations ; Building Resilience in Asian Cities ; A Science-Policy Approach Towards Local Adaptation Planning: The Case of Santiago de Chile ; Participatory Action Adaptation: Tools for Increasing Climate Change Capacity and Preparedness at the Local Government Level ; Knowledge and Information for Resilient Cities ; Climate Change Guidelines for Urban Planning in the Basque Country ; Integrated Roadmapping to Shape Adaptation Processes in Metropolitan Areas ; The Significance of Adaptation Framing in Local and Regional Climate Change Adaptation Initiatives in Australia ; Decision-Making Frameworks for Adaptation to Extremes in Two Local Government Areas: Comparing and Contrasting India and Australia ; Urban Climate Governance in the Philippines, Mexico and South Africa: National- and State-Level Laws and Policies ; Space for Adapting: Reconciling Adaptation and Mitigation in Local Climate Change Plans ; The Early Experiences of Local Climate Change Adaptation in Norway Compared with That of Local Agenda 21 ; Climate Change Adaptation Plan of Vitoria-Gasteiz, Spain ; Integrated Climate Action: Linking Mitigation and Adaptation to Make Indonesian Cities Resilient ; Enhancing the Climate Change Adaptation Capabilities of Local Governments in Korea: Supporting Programs for Local Adaptation Plan ; Reality Check: Ho Chi Minh City, Vietnam ; Part 5: Financing the Resilient City ; Introduction: Financing the Resilient City ; A Demand-Driven Approach to Development, Disaster Risk Reduction, and Climate Adaptation ; Smarter Interventions in an Age of Uncertainty ; Linking Resilience and Green Growth: How Green Business Can Contribute to More Resilient Cities in India ; Green Areas Inner-City Agreement (GAIA): How Local Enterprises Can Contribute to Local Adaptation to Climate Change ; Financing Climate Change Adaptation: The Copenhagen Case ; Challenges on the Way to Financing Urban Climate Change Adaptation
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Monograph available for loan
    Monograph available for loan
    London [u.a.] : Zed Books
    Call number: IASS 18.91776
    Type of Medium: Monograph available for loan
    Pages: VIII, 254 S. , 24 cm
    ISBN: 9781780320069 (pb) , 9781780320076 (hb)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Call number: IASS 18.91779
    Type of Medium: Monograph available for loan
    Pages: XIX, 313 S.
    ISBN: 9780857935632
    Series Statement: New horizons in environmental and energy law
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Monograph available for loan
    Monograph available for loan
    Minneapolis [u.a.] : Univ. of Minnesota Press
    Call number: IASS 18.91835
    Type of Medium: Monograph available for loan
    Pages: VIII, 299 S. , 22x14x2 cm
    ISBN: 9780816656875 , 9780816656868 , 0816656878
    Series Statement: Posthumanities 9
    Uniform Title: Cosmopolitiques 〈engl.〉
    Language: English
    Note: Aus dem Franz. übers.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Call number: 3/S 07.0034(2016)
    In: Annual report
    Type of Medium: Monograph available for loan
    Pages: 51 Seiten
    ISSN: 1865-6439 , 1865-6447
    Parallel Title: Erscheint auch als Annual report ... / Helmholtz Association of German Research Centres
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Call number: IASS 19.91964
    Description / Table of Contents: For anyone seeking to create meaning out of life, inspire others with publication of research discoveries and insights, and help the world become a better place within which to live and work, action research holds great promise as an approach. The challenge is to do it well and with rigor. The Handbook is a magnificent collection of articles that will help the reader do all of that` - Richard E. Boyatzis, Case Western Reserve University and ESADE `This second volume will be a welcome extension of the landmark first volume of the SAGE Handbook of Action Research. It effectively secures the field`s `second wave` in a particularly powerful and creative articulation of well-theorised practice. It could not be more timely for a fast-growing field that has attracted recent appreciation from parties as disparate as Shell, 3M, Australian Aboriginal women in outback Australia working to prevent harm to children and the Secretary General of the UN` - Yoland Wadsworth `For anyone thinking about or doing action research, this book is an obligatory point of reference. If any one text both maps the action research paradigm, and at the same time moves it on, this is it` - Bill Cooke, Manchester Business School Building on the strength of the seminal first edition, the The SAGE Handbook of Action Research has been completley updated to bring chapters in line with the latest qualitative and quantitative approaches in this field of social inquiry. Peter Reason and Hilary Bradbury have introduced new part commentaries that draw links between different contributions and show their interrelations. Throughout, the contributing authors really engage with the pragmatics of doing action research and demonstrate how this can be a rich and rewarding reflective practice. They tackle questions of how to integrate knowledge with action, how to collaborate with co-researchers in the field, and how to present the necessarily `messy` components in a coherent fashion. The organization of the volume reflects the many different issues and levels of analysis represented. This volume is an essential resource for scholars and professionals engaged in social and political inquiry, organizational research and education.
    Type of Medium: Monograph available for loan
    Pages: xxxii, 720 Seiten , Illustrationen
    Edition: Second Edition
    ISBN: 9781446271148 ((pbk.) £39.99)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    facet.materialart.12
    New York, Basingstoke : Freeman
    Call number: 9781464138744
    Type of Medium: 12
    Pages: 1 Online-Ressource (755 Seiten) , Illustrationen, Diagramme, Karten
    Edition: 7th edition
    ISBN: 978-1-4641-3874-4 , 1-4641-3874-5
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Monograph available for loan
    Monograph available for loan
    Oxford [u.a.] : Oxford Univ. Press
    Call number: IASS 19.92041
    Type of Medium: Monograph available for loan
    Pages: XIV, 727 Seiten , Illustrationen, Diagramme, Karten , 25 cm
    Edition: 1. published in paperback
    ISBN: 9780199683420 (pbk.)
    Language: English
    Note: Pt. 1. Introduction -- pt. 2. The challenge and its history -- pt. 3. Science, society, and public opinion -- pt. 4. Social impacts -- pt. 5. Security -- pt. 6. Justice -- pt. 7. Publics and movements -- pt. 8. Government responses -- pt. 9. Policy instruments -- pt. 10. Producers and consumers -- pt. 11. Global governance -- pt. 12. Reconstruction..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Monograph available for loan
    Monograph available for loan
    Leiden : Nijhoff
    Associated volumes
    Call number: IASS 17.92082/3
    In: The yearbook of polar law, volume 3
    Type of Medium: Monograph available for loan
    Pages: viii, 738 Seiten , Illustrationen
    ISBN: 9789004210776
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    Monograph available for loan
    Monograph available for loan
    Leiden : Nijhoff
    Associated volumes
    Call number: IASS 17.92082/6
    In: The yearbook of polar law, volume 6
    Type of Medium: Monograph available for loan
    Pages: xv, 649 Seiten , Illustrationen
    ISBN: 9789004271548
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Call number: IASS 17.91220
    Type of Medium: Monograph available for loan
    Pages: xii, 301 Seiten , Illustrationen
    ISBN: 9781138920613 (pbk) , 9780415540247 (hbk) , 9780203083673 (ebk)
    Series Statement: Routledge advances in research methods 6
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    Call number: AWI Bio-19-92456
    In: Nova Hedwigia / Beiheft, 144
    Type of Medium: Monograph available for loan
    Pages: IV, 545 Seiten , Illustrationen
    ISBN: 9783443510633
    Series Statement: Nova Hedwigia / Beiheft 141
    Language: English
    Note: Contents Preface Curriculum Vitae List of Publications by Horst Lange-Bertalot Bahls, L.: Seven new species in Navicula sensu stricto from the Northern Great Plains and Northern Rocky Mountains. Blanco, S., B. Van de Vijver, A. Vinocur, G. Mataloni, J. Goma, M. H. Novais & L. Ector: Hippodonta lange-bertalotii Van de Vijver, Mataloni & Vinocur sp. nov. and related small-celled Hippodonta taxa. Burliga, A. L. & J. P. Kociolek : Four new Eunotia Ehrenberg species (Bacillariophyceae) from pristine regions of Carajas National Forest, Amazonia, Brazil. Cantonati, M., M. Leira, N. Angeli & C. Lopez Rodriguez: Naviculadicta langebertcdotii sp. nov. (Bacillariophyta) from streams in Galicia (N-W Spain). Karthick, B., P. B. Hamilton & J. P. Kociolek: Taxonomy and biogeography of some Surirella Turpin (Bacillariophyceae) taxa from Peninsular India. Karthick, B. & Kociolek, J. P.: A new species of Pleurosigma from Western Ghats, South India. Metzeltin, D.: Eunotia langebertalotii, a new species from Lambir Hills National Park in Sarawak, tropical East Malaysia Monnier, O., L. Ector, F. Rimet, M. Ferreol & L. Hoffmann: Adlafia langebertalotii sp. nov. (Bacillariophyceae), a new diatom from the Grand-Duchy of Luxembourg morpho­logically similar to A. suchlandtii comb. nov. Morales, E. A., K. M. Manoylov & L. L. Bahls: Fragilariforma horstii sp. nov. (Ba­cillariophyceae) a new araphid species from the northern United States of America Reichardt, E.: Der Artenkomplex um Gomphonema occultum E. Reichardt & Lange-Bertalot (Bacillariophyceae): Variability und drei neue Arten Stachura-Suchoples, K.: On taxonomy of Pliocaenicus costatus species complex, varieties, demes or/and morphological variability? Trobajo, R., D. G. Mann & E. J. Cox: Studies on the type material of Nitzschia abbreviata (Bacillariophyta) Van de Vijver, B., B. Chattova, D. Metzeltin & M. Lebouvier: The genus Pinnularia (Bacillariophyta) on lie Amsterdam (TAAF, Southern Indian Ocean) Van de Vijver, B., A. Jarlman, M. de Haan & L. Ector: New and interesting diatom species (Bacillariophyceae) from Swedish rivers Williams, D. M.: Diatoma moniliforme: Commentary, relationships and an appropriate name Ake-Castillo, J. A., Y. B. Okolodkov, S. Espinosa-Matias, F. del C. Merino-Virgilio, J. A. Herrera-Silveira & L. Ector: Cyclotella marina (Tanimura, Nagumo et Kato) Ake-Castillo, Okolodkov et Ector comb, et stat. nov. (Thalassiosiraceae): a bloom-forming diatom in the southeastern Gulf of Mexico Belando, M. D., A. Marin & M. Aboal: Licmophora species from a Mediterranean hyper-saline coastal lagoon (Mar Menor, Murcia, SE Spain) Reid, G.: Toxonidea langebertalotii sp. nov. A new marine diatom from the Salvages Islands Riaux-Gobin, C., R Compere, A. Y. Al-Handal & F. Straub: SEM survey of some small-sized Planothidium (Bacillariophyta) from coral sands off Mascarenes. (Western Indian Ocean) Khursevich, G. & Kociolek, J. P.: A preliminary, worldwide inventory of the extinct, freshwater fossil diatoms from the orders Thalassiosirales, Stephanodiscales, Paraliales, Aulacoseirales, Melosirales, Coscindiscales, and Biddulphiales 315 Kulikovskiy, M. S., G. K. Khursevich & A. Witkowski: Encyonema horstii sp. nov., a species of unusual valve outline from the Pleistocene deposits of Lake Baikal Witkowski, J., D. M. Harwood & M. Kulikovskiy: Observations on Late Cretaceous ma­rine diatom resting spore genera Pseudoaulacodiscus and Archaegoniothecium gen. nov. Jasprica, N., M. Caric, F Krsinic, T. Kapetanovic, M. Batistic & J. Njire: Planktonic dia­toms and their environment in the lower Neretva River estuary (Eastern Adriatic Sea, NE Mediterranean) Solak, C. N., L. Ector, A. Z. Wojtal, E. Acs & E. A. Morales: A review of investigations on diatoms (Bacillariophyta) in Turkish inland waters Bak, M. & A. Szlauer-Lukaszewska: Bioindicative potential of diatoms and ostracods in the Odra mouth environment quality assessment Starrat, S. W.: Holocene diatom flora and climate history of Medicine Lake, Northern California, USA. Medlin, L., I. Yang & S. Sato: Evolution of the Diatoms. VII. Four gene Phylogeny as­sesses the validity of celected araphid genera Lang, I. & I. Kaczmarska: Morphological and molecular identity of diatom cells retrieved from ship ballast tanks destined for Vancouver, Canada Buczko, K.: The Pantocsek diatom and photomicrograph collectio n from 19th to 21th cen­tury
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Monograph available for loan
    Monograph available for loan
    Utrecht : [Utrecht University, Faculty of Geosciences, Department of Earth Sciences]
    Associated volumes
    Call number: M 19.92464
    In: Utrecht studies in earth sciences, 016
    Type of Medium: Monograph available for loan
    Pages: 169 Seiten , Illustrationen
    ISBN: 9789062663002
    Series Statement: Utrecht studies in earth sciences 016
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Monograph available for loan
    Monograph available for loan
    München : Vahlen
    Call number: PIK B 160-19-92593
    Description / Table of Contents: Verlagsinfo: Die rasanten Entwicklungen in der Umweltpolitik in den vergangenen Jahren führten zu umfangreichen Anpassungen in diesem beliebten Lehrbuch, die insbesondere die anwendungsorientierten Abschnitte betreffen. Hier wurden vor allem die Kapitel über die Umweltinstrumente (Auflagen, Steuern, Zertifikate), die Kosten-Nutzen-Analyse sowie die internationalen Umweltaspekte (bspw. Klimakonferenzen) grundlegend aktualisiert. Darüber hinaus enthält das Kapitel zur Ressourcenökonomie nun ebenfalls eine anwendungsbezogene Diskussion.
    Type of Medium: Monograph available for loan
    Pages: XIV, 375 Seiten , Diagramme
    Edition: 4., vollständig überarbeitete Auflage
    ISBN: 3800646684 (kart.) , 9783800646685 (kart.) , 9783800643653 (electronic)
    Language: German
    Note: Contents: 1 Einführung ; 2 Einige spieltheoretische Grundlagen der Analyse ; 3 Theorie externer Effekte ; 4 Auflagen ; 5 Steuern und Abgaben (Preislösungen) ; 6 Zertifikate ; 7 Verhandlungslösungen ; 8 Umwelthaftung ; 9 Umwelttechnischer Fortschritt (dynamische Anreizwirkungen) ; 10 Internationale Aspekte des Umweltproblems ; 11 Umweltpolitik bei asymmetrischer Informationsverteilung ; 12 Kosten-Nutzen-Analyse ; 13 Ressourcenökonomie
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Monograph available for loan
    Monograph available for loan
    New York : Springer
    Call number: PIK N 531-19-92656
    Description / Table of Contents: In this book, plant biology is considered from the perspective of plants and their surrounding environment, including both biotic and abiotic interactions. The intended audience is undergraduate students in the middle or final phases of their programs of study. Topics are developed to provide a rudimentary understanding of how plant-environment interactions span multiple spatiotemporal scales, and how this rudimentary knowledge can be applied to understand the causes of ecosystem vulnerabilities in the face of global climate change and expansion of natural resource use by human societies. In all chapters connections are made from smaller to larger scales of ecological organization, providing a foundation for understanding plant ecology. Where relevant, environmental threats to ecological systems are identified and future research needs are discussed. As future generations take on the responsibility for managing ecosystem goods and services, one of the most effective resources that can be passed on is accumulated knowledge of how organisms, populations, species, communities and ecosystems function and interact across scales of organization. This book is intended to provide some of that knowledge, and hopefully provide those generations with the ability to avoid some of the catastrophic environmental mistakes that prior generations have made.--
    Type of Medium: Monograph available for loan
    Pages: XXIII, 659 Seiten , Illustrationen, Diagramme, Tabellen , 24 cm
    ISBN: 9781461475002
    Series Statement: The plant sciences 8
    Language: English
    Note: Contents: Plant-environment interactions across multiple scales -- Plant biodiversity and population dynamics -- Assembly of plant communities -- Plant pollination and dispersal -- Plant phenotypic expression in variable environments -- Evolutionary ecology of chemically mediated plant-insect interactions -- Plant-microbe interactions -- Patterns and controls of terrestrial primary production in a changing world -- Ecology of tropical rain forests -- Ecology of temperate forests -- Plants in deserts -- Plants in alpine environmnets -- Plants in arctic environments -- Grassland ecology -- Coastal wetland ecology and challenges for environmental management -- Near-coastal seagrass ecosystem -- Ecology of marine phytoplankton -- Plants in changing environmental conditions of the anthropocene -- Plant influences on atmospheric chemistry -- Biofuel development from cellulosic sources -- Plant ecology and sustainability science
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...