ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

X
feed icon rss

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • English  (6,016)
  • German  (4,248)
  • Czech  (4)
  • 2010-2014  (6,250)
  • 1985-1989  (3,962)
Collection
Keywords
Publisher
Language
Years
Year
  • 1
    Series available for loan
    Series available for loan
    Die automatische fernmeldende meteorologische Station AFMS-2; Teil 1 (1986)
    Dresden : Ingenieurschule für Geodäsie und Kartographie
    Associated volumes
    Details Availability
    Call number: MOP 46734/1 / Mitte ; MOP 46732 / Mitte ; MOP 46733
    In: Die automatische fernmeldende meteorologische Station AFMS-2, Teil 1
    Type of Medium: Series available for loan
    Pages: 58 Seiten , Illustrationen
    Edition: 1. Auflage, abgeschlossen Juli 1996
    Edition: als Manuskript gedruckt
    Series Statement: Meteorologische Messtechnik 83-24
    URL: http://d-nb.info/1024984761/04
    Language: German
    Note: Inhaltsverzeichnis: 1. Einführung. - 2. Gründe für die Entwicklung rechnergeführter Stationen. - 3. Anlage AFMS-2. - 3.1. Anforderungen im Vergleich zur Anlage AFMS-1. - 3.2. Konzeptionelle Fragen. - 3.2.1. Flexibilität des Systems. - 3.2.2. Robustheit des Systems. - 3.2.3. Transparenz des Systems. - 3.2.4. Bedien- und Serviceaspekte. - 3.2.5. Sicherung des Echtbetriebs 3.3. Gerätesystem. - 3.3.1. Geber. - 3.3.2. Geberanschlußkasten. - 3.3.3. Stationskern. - 3.3.3.1. Hauptrechner. - 3.3.3.2. Kommunikationsrechner. - 3.3.4. Bedienperipherie. - 3.4. Signal- und Datenflüsse in der Anlage. - 3.4.1. Datenflüsse im Hauptrechner. - 3.4.2. Signal- und Datenflüsse im Koppelsystem. - 3.4.3. Datenfluß im Kommunikationsrechner. - Zusammenfassung . - Aufgaben. - Antworten. - Quellennachweis. - Quellenverzeichnis der Bilder. - Zusatzliteratur zur Mikroelektronik und Mikrorechentechnik. - Verzeichnis der Abkürzungen.
    Location: MOP - must be ordered
    Location: MOP - must be ordered
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 2
    Monograph available for loan
    Monograph available for loan
    Die automatische fernmeldende meteorologische Station AFMS-2; Teil 3 (1987)
    Dresden : Ingenieurschule für Geodäsie und Kartographie
    Associated volumes
    Details Availability
    Call number: MOP 46734/3 / Mitte ; MOP 46733 / Mitte ; MOp 46732 / Mitte
    In: Die automatische fernmeldende meteorologische Station AFMS-2, Teil 3
    Type of Medium: Monograph available for loan
    Pages: 34 Seiten , Illustrationen
    Edition: 1. Auflage, abgeschlossen Januar 1987
    Edition: als Manuskript gedruckt
    Series Statement: Meteorologische Messtechnik 83-26
    URL: http://d-nb.info/984409068/04
    Language: German
    Note: Inhaltsverzeichnis: 4. Einsatzfragen. - 4.1. Einsatzvorbereitung. - 4.2. Einsatzsicherung. - 4.3. Bedienfragen. - 4.3.1. Inbetriebnahme. - 4.3.2. Bedienung durch das Stationspersonal. - 4.3.3. Bedienung durch das Servicepersonal. - 4.4. Möglichkeiten zur Modifikation der Anlage. - 5. Entwicklungstendenzen bei automatischen meteorologischen Stationen. - Zusammenfassung. - Aufgaben. - Antworten. - Quellennachweis.
    Location: MOP - must be ordered
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 3
    Journal available for loan
    Journal available for loan
    Geo-Alp : Veröffentlichungen des Instituts für Geologie und Paläontologie der Universität Innsbruck und des Naturmuseums Südtirol, Museo Scienze Naturali Alto Adige, Bozen, Bolzano : a yearly journal devoted to Alpine geology (2007-)
    Bozen : Naturmuseum Südtirol ; 1.2007 -
    Details Availability
    Call number: Z 06.0500
    Type of Medium: Journal available for loan
    Pages: 30 cm
    ISSN: 1824-7741
    URL: http://www.naturmuseum.it/de/geo-alp_de.asp
    Former Title: Vorgänger Geologisch-paläontologische Mitteilungen, Innsbruck
    Language: German , English
    Note: Ersch. unregelmäßig , Beiträge teilweise in Englisch
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 4
    Monograph available for loan
    Monograph available for loan
    Die automatische fernmeldende meteorologische Station AFMS-2; Teil 2 (1986)
    Dresden : Ingenieurschule für Geodäsie und Kartographie
    Associated volumes
    Details Availability
    Call number: MOP 46733 / Mitte ; MOP 46734/2 / Mitte ; MOP 46732 / Mitte
    In: Die automatische fernmeldende meteorologische Station AFMS-2, Teil 2
    Type of Medium: Monograph available for loan
    Pages: 63 Seiten , Illustrationen
    Edition: 1. Auflage, abgeschlossen Juli 1986
    Edition: als Manuskript gedruckt
    Series Statement: Meteorologische Messtechnik 83-25
    URL: http://d-nb.info/984409041/04
    Language: German
    Note: Inhaltsverzeichnis: 3.5. Das Programmsystem METEX. - 3.5.1. Betriebssystem des Hauptrechners. - 3.5.1.1. Monitorprogramm des Hauptrechners. - 3.5.1.2. Echtzeit-Multitask-Betriebssystem. - 3.5.1.2.1. Echtzeit-Steuerprogrammsystem EIEX 1521. - 3.5.1.2.2. Weitere Komponenten des Echtzeit-Betriebssystems 3.5.2. Applikationsprogrammsystem des Hauptrechners. - 3.5.2.1. Initialisierung und Steuerung der Anwendertasks. - 3.5.2.2. Anzeige-, Bedien- und Diagnosefunktionen. - 3.5.2.3. Meßwerterfassung und Primärverarbeitung. - 3.5.2.4. Sekundärverarbeitung. - 3.5.2.5. Formatierung und Bereitstellung der Meldungen. - 3.5.2.6. Unterprogramm-Bibliothek. - 3.5.3. Programmsystem des Kommunikationsrechners. - 3.5.3.1. Monitorprogramm des Kommunikationsrechners. - 3.5.3.2. Applikationsprogrammsystem des Kommunikationsrechners. - Zusammenfassung. - Aufgaben. - Antworten. - Quellennachweis. - Quellenverzeiohnis der Bilder.
    Location: MOP - must be ordered
    Location: MOP - must be ordered
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 5
    Monograph available for loan
    Monograph available for loan
    Self-Services mit SAP ERP HCM : [Funktionen, Customizing und Erweiterung von ESS/MSS ; technische Grundlagen und Einsatz in der Praxis ; Tipps und Tricks für das Implementierungsprojekt] (2014)
    Bonn [u.a.] : Galileo Press
    Details Availability
    Call number: M 15.89463
    Type of Medium: Monograph available for loan
    Pages: 503 S. , Ill., graph. Darst. , 25 cm
    Edition: 1. Aufl.
    ISBN: 3836218054 (Gb.) , 9783836218054 (Gb.)
    Series Statement: SAP Press
    URL: Inhaltstext
    URL: Inhaltsverzeichnis
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 6
    Monograph available for loan
    Monograph available for loan
    HR-Reporting mit SAP : [Standardreports, Querys und Kundenreports ; Reporting in SAP ERP HCM, SAP NetWeaver BW und SAP BusinessObjects ; mit zahlreichen Beispielen aus der Praxis] (2013)
    Bonn : Galileo Press
    Details Availability
    Call number: M 15.89085
    Type of Medium: Monograph available for loan
    Pages: 492 S , zahlr. Ill., graph Darst
    Edition: 2. aktualisierte u. erw. Aufl.
    ISBN: 3836219867 , 9783836219860
    Series Statement: SAP PRESS
    URL: Inhaltstext
    URL: Inhaltsverzeichnis
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 7
    Monograph available for loan
    Monograph available for loan
    SAP-Änderungs- und Transportmanagement : [das umfassende Handbuch zu Architektur, Installation, Werkzeugen, Betrieb und Wartung ; detaillierte Anleitungen zur Änderungs- und Transportverwaltung ; Transport Organizer, SAP Solution Manager, erweitertes Transportwesen (CTS+), Enhancement Packages u.v.m.] (2013)
    Bonn : Galileo Press
    Details Availability
    Call number: M 15.89533
    Type of Medium: Monograph available for loan
    Pages: 1008 S.
    Edition: 4., aktualisierte und erw. Aufl.
    ISBN: 3836219174 , 9783836219174
    Series Statement: SAP PRESS
    URL: Inhaltstext
    URL: Inhaltsverzeichnis
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 8
    Unknown
    Oxford guide to plain English (2013)
    Oxford : Oxford University Press
    Details Availability
    Call number: 22/M 15.89566 (1. Ex.) ; 22/M 15.89566 (2. Ex.) ; 22/M 15.89566 (3. Ex.) ; 22/M 15.89566 (4. Ex.) ; 22/M 15.89566 (5. Ex.) ; 22/M 15.89566 (6. Ex.) ; 22/M 15.89566 (7. Ex.) ; 22/M 15.89566 (8. Ex.) ; 22/M 15.89566 (9. Ex.) ; 22/M 15.89566 (10. Ex.)
    Description / Table of Contents: Completely revised and updated, this new edition of the Oxford Guide to Plain English is an essential tool for clear communication. It provides authoritative help on how to get your message across effectively. In 25 easy-to-follow chapters, it covers straightforward language, punctuation, grammar, writing emails, and much more.
    Pages: xxxii, 288 S. , Ill. , 20 cm
    Edition: 4. edition
    ISBN: 0199669171 ((pbk.) £7.99) , 9780199669172 ((pbk.) £7.99)
    Language: English
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 9
    Unknown
    Be the Captain of Your Career : A New Approach to Career Planning and Advancement (2014)
    Chicago : Precision Wordage Press
    Details
    Call number: 22/M 15.89567 (1. Ex.) ; 22/M 15.89567 (2. Ex.) ; 22/M 15.89567 (3. Ex.) ; 22/M 15.89567 (4. Ex.) ; 22/M 15.89567 (5. Ex.) ; 22/M 15.89567 (6. Ex.) ; 22/M 15.89567 (7. Ex.) ; 22/M 15.89567 (8. Ex.) ; 22/M 15.89567 (9. Ex.) ; 22/M 15.89567 (10. Ex.)
    Description / Table of Contents: Drawing from his own experience with corporations both large and small and as a business owner, Jack Molisani has seen every mistake the professional (or not-so-professional) can make in today's highly competitive job market. This book provides the tools for navigating these choppy waters. Starting with how to escape a dead-end job or an overbearing boss, to advancing one's career, and finally to achieving a higher standard of living, the book is divided into sections on finding new directions, making things happen, and optimizing the results. While most business guides focus on either job hun
    Pages: Online-Ressource (111 p)
    Edition: Online-Ausg.
    ISBN: 9780962709029
    URL: Volltext
    URL: Volltext
    URL: Inhaltsverzeichnis
    Parallel Title: Print version: Be the Captain of Your Career : A New Approach to Career Planning and Advancement
    Language: English
    Note: Cover; Copyright; Praise; Introduction; Contents; Section 1: THINK IT; The First Thing to Do When You Find Yourself in a Hole: Stop Digging; Stay Positive; Never Lose Faith; Seven Career Lessons I Learned from Selling Ginsu Knives; A Turning Point; Stop. Breathe. Think. Then Act.; Overcoming Inertia; Overcoming Fear; Keep Swimming; Section 2: DO IT; What Is a Resume?; What Are Managers Looking For?; Dirty Little Resume Secrets; The T-Bomb; Current Experience; What You Do Is More Important than What You're Called; The Top Ten Mistakes Professionals Make When Looking for Work. , Resumes: A SummaryCover Your Letter; Following Up; Getting Interviews; Be Proactive; Be Visible; Social Networking; Four Critical Steps to Getting a Job Offer; Send Out Ships; Gold Calling; Section 3: HAVE IT; Creating the Path; Recession-Proof Your Career; Creating a PR Campaign; Taking the Initiative; Increase Your Ability to Find Work; Advancing Your Career through Personal Branding; Advancing Your Career through Progressive Information Disclosure; Honing Your Workplace Negotiation Skills; The Sky's the Limit; What Are You Waiting For?; About Making Money; Creating the Life You Want. , Recommended ReadingAbout the Author.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 10
    Monograph available for loan
    Monograph available for loan
    Kooperationsmanagement in der Praxis : Gesellschaftliche Veränderungen gestalten mit Capacity WORKS (2014)
    Wiesbaden : Springer
    Details Availability
    Call number: PIK D 025-16-89602
    Type of Medium: Monograph available for loan
    Pages: IX, 283 S. , graph. Darst. , 240 mm x 168 mm
    ISBN: 3658062754 , 9783658062750 , 9783658062767
    URL: Inhaltstext
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 11
    Monograph available for loan
    Monograph available for loan
    EU energy law and policy : a critical account (2013)
    Oxford : Oxford Univ. Press
    Details Availability
    Call number: PIK N 071-15-89127
    Type of Medium: Monograph available for loan
    Pages: XXIII, 317 S.
    Edition: 1. ed.
    ISBN: 0199686394 , 9780199686391
    URL: http://www.gbv.de/dms/spk/sbb/toc/769783910.pdf
    URL: Autorenbiografie
    URL: Verlagsangaben
    Language: English
    Note: Introduction.EU energy law and the approach taken in this studyThe regulatory history of EU energy : the evolution of EU energy law from 1957 onwardsThe evolution of the sector-specific regulatory frameworkTreaty law and the energy sectorEnvironment and energy : on a bumpy road towards a clean energy futureThe international dimension of EU energy law and policyFrom state to market and back : the changing role(s) of markets and states in the EUConclusion.European energy law under the impact of globalization : from state to market, from plan to contract, from public ownership to economic regulation and beyond..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 12
    Monograph available for loan
    Monograph available for loan
    Praxishandbuch Report Painter/Report Writer : [schnell und einfach Bericht für das SAP-Finanzwesen erstellen, Report Painter/Report Writer bestmöglich nutzen ; mit ausführlichen Praxisbeispielen] (2012)
    Bonn : Galileo Press
    Details Availability
    Call number: M 16.89641
    Type of Medium: Monograph available for loan
    Pages: 320 S. , graph Darst., Tab. , 168 mm x 240 mm
    Edition: 1. Aufl.
    ISBN: 9783836217187
    Series Statement: SAP PRESS
    URL: Inhaltstext
    URL: Inhaltsverzeichnis
    URL: Inhaltsverzeichnis
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 13
    Monograph available for loan
    Monograph available for loan
    Smart power generation : [the future of electricity production] (2011)
    Helsinki : Avain Publ.
    Details Availability
    Call number: IASS 16.89649
    Type of Medium: Monograph available for loan
    Pages: 200 S. , Ill., graph. Darst.
    Edition: 2nd edition
    ISBN: 9789516928466
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 14
    Monograph available for loan
    Monograph available for loan
    Total alles über Südtirol =Alto Adige - tutto di tutto =The complete South Tyrol (2012)
    Wien : Folio
    Details Availability
    Call number: IASS 16.89650
    Type of Medium: Monograph available for loan
    Pages: 128 S , überw. Ill , 245 mm x 190 mm
    Edition: 1. Aufl.
    ISBN: 9783852566078
    URL: Inhaltsverzeichnis
    URL: Rezension
    URL: Inhaltsverzeichnis
    Language: German , Italian , English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 15
    Monograph available for loan
    Monograph available for loan
    Nachhaltige Ökonomie : ökonomische Theorie und Praxis einer Nachhaltigen Entwicklung ; [Grenzen der natürlichen Tragfähigkeit: Ökonomie, Ökologie, Soziales] (2012)
    Marburg : Metropolis-Verl.
    Details Availability
    Call number: IASS 16.89646
    Type of Medium: Monograph available for loan
    Pages: 812 S , graph. Darst. , 23 cm
    Edition: 2., überarb. und erw. Aufl
    ISBN: 3895188654 (Geb.) , 9783895188657 (Geb.)
    Series Statement: Grundlagen der Wirtschaftswissenschaft 15
    URL: http://www.gbv.de/dms/zbw/683382446.pdf
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 16
    Monograph available for loan
    Monograph available for loan
    Econometric analysis of cross section and panel data (2010)
    Cambridge, Mass. [u.a.] : MIT Press
    Details
    Call number: PIK B 020-16-89772
    Type of Medium: Monograph available for loan
    Pages: XXVII, 1064 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 0262232588 (hbk.) , 9780262232586
    Language: English
    Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 17
    Monograph available for loan
    Monograph available for loan
    Buying time : the delayed crisis of democratic capitalism (2014)
    London [u.a.] : Verso
    Details Availability
    Call number: IASS 16.90268
    Description / Table of Contents: "The financial crisis keeps us on edge and creates a diffuse sense of helplessness. Well-nigh unfathomable problems lead to measures that seem like emergency operations on the open heart of the Western world, performed with no knowledge of the patient's clinical history. The gravity of the situation is matched by the paucity of our understanding of it, and of how it came about in the first place. In this book, compiled from his Adorno Lectures given in Frankfurt, Wolfgang Streeck lays bare the roots of the present financial, fiscal and economic crisis, seeing it as part of the long neoliberal transformation of postwar capitalism that began in the 1970s. Linking up with the crisis theories of that decade, he analyses the subsequent tensions and conflicts involving states, governments, voters and capitalist interests--a process in which the defining focus of the European state system has shifted from taxation through debt to budgetary "consolidation." The book then ends by exploring the prospects for a restoration of social and economic stability. Buying Time is a model of enlightenment. It shows that something deeply disturbing underlies the current situation: a metamorphosis of the whole relationship between democracy and capitalism"--
    Description / Table of Contents: "The financial and economic crisis that began in 2008 still has the world on tenterhooks. The gravity of the situation is matched by a general paucity of understanding about what is happening and how it started. In this book, based on his 2012 Adorno Lectures given in Frankfurt, Wolfgang Streeck places the crisis in the context of the long neoliberal transformation of postwar capitalism that began in the 1970s. He analyses the subsequent tensions and conflicts involving states, governments, voters and capitalist interests, as expressed in inflation, public debt, and rising private indebtedness. Streeck traces the transformation of the tax state into a debt state, and from there into the consolidation state of today. At the centre of the analysis is the changing relationship between capitalism and democracy, in Europe and elsewhere, and the advancing immunization of the former against the latter"--
    Type of Medium: Monograph available for loan
    Pages: XVIII, 220 S. , graph. Darst. , 21 cm
    ISBN: 1781685495 (hbk) , 9781781685495 (hbk) , 1781685487 (pbk) , 9781781685488 (pbk) , 9781781685501 (electr.; US) , 9781781685518 (electr.; UK)
    Uniform Title: Gekaufte Zeit. 〈engl.〉
    URL: Inhaltsverzeichnis
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 18
    Monograph available for loan
    Monograph available for loan
    Rethinking private authority : agents and entrepreneurs in global environmental governance (2014)
    Princeton, NJ [u.a.] : Princeton Univ. Press
    Details Availability
    Call number: PIK D 020-15-0141
    Description / Table of Contents: "Rethinking Private Authority examines the role of non-state actors in global environmental politics, arguing that a fuller understanding of their role requires a new way of conceptualizing private authority. Jessica Green identifies two distinct forms of private authority--one in which states delegate authority to private actors, and another in which entrepreneurial actors generate their own rules, persuading others to adopt them.Drawing on a wealth of empirical evidence spanning a century of environmental rule making, Green shows how the delegation of authority to private actors has played a small but consistent role in multilateral environmental agreements over the past fifty years, largely in the area of treaty implementation. This contrasts with entrepreneurial authority, where most private environmental rules have been created in the past two decades. Green traces how this dynamic and fast-growing form of private authority is becoming increasingly common in areas ranging from organic food to green building practices to sustainable tourism. She persuasively argues that the configuration of state preferences and the existing institutional landscape are paramount to explaining why private authority emerges and assumes the form that it does. In-depth cases on climate change provide evidence for her arguments.Groundbreaking in scope, Rethinking Private Authority demonstrates that authority in world politics is diffused across multiple levels and diverse actors, and it offers a more complete picture of how private actors are helping to shape our response to today's most pressing environmental problems"--
    Description / Table of Contents: Rethinking Private Authority examines the role of non-state actors in global environmental politics, arguing that a fuller understanding of their role requires a new way of conceptualizing private authority. Jessica Green identifies two distinct forms of private authority--one in which states delegate authority to private actors, and another in which entrepreneurial actors generate their own rules, persuading others to adopt them.Drawing on a wealth of empirical evidence spanning a century of environmental rule making, Green shows how the delegation of authority to private actors has played a small but consistent role in multilateral environmental agreements over the past fifty years, largely in the area of treaty implementation. This contrasts with entrepreneurial authority, where most private environmental rules have been created in the past two decades. Green traces how this dynamic and fast-growing form of private authority is becoming increasingly common in areas ranging from organic food to green building practices to sustainable tourism. She persuasively argues that the configuration of state preferences and the existing institutional landscape are paramount to explaining why private authority emerges and assumes the form that it does. In-depth cases on climate change provide evidence for her arguments.Groundbreaking in scope, Rethinking Private Authority demonstrates that authority in world politics is diffused across multiple levels and diverse actors, and it offers a more complete picture of how private actors are helping to shape our response to today's most pressing environmental problems.
    Type of Medium: Monograph available for loan
    Pages: XII, 215 S. , graph. Darst.
    ISBN: 9780691157580 (hardback) , 9780691157597 (paperback)
    URL: http://www.gbv.de/dms/zbw/757505562.pdf
    Language: English
    Note: A theory of private authorityAgents of the state : a century of delegation in international environmental lawGovernors of the market : the evolution of entrepreneurial authorityAtmospheric police : delegated authority in the clean development mechanismAtmospheric accountants : entrepreneurial authority and the greenhouse gas protocol..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 19
    Monograph available for loan
    Monograph available for loan
    Grundriss der Wirtschaftsethik : von der Stammesmoral zur Ethik der Globalisierung (2010)
    Stuttgart : Kohlhammer
    Details
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    URL: Inhaltsverzeichnis
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 20
    Monograph available for loan
    Monograph available for loan
    Diskurse des Climate Engineering : Argumente, Akteure und Koalitionen in Deutschland und Großbritannien (2014)
    Wiesbaden : Springer VS
    Details Availability
    Call number: IASS 15.89620
    Keywords: Deutschland ; Großbritannien ; Klimaänderung ; Klimaschutz ; Technikbewertung ; Politische Auseinandersetzung
    Type of Medium: Monograph available for loan
    Pages: 263 S. , Ill., graph. Darst. , 210 mm x 148 mm, 351 g
    ISBN: 3658053658 (pbk.) , 9783658053659 (pbk.)
    URL: Inhaltstext
    URL: Inhaltsverzeichnis
    Language: German
    Note: Univ., Diss.--Heidelberg, 2013
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 21
    Monograph available for loan
    The handbook of global agricultural markets : the business and finance of land, water, and soft commodities (2014)
    Basingstoke [u.a.] : Palgrave Macmillan
    Details Availability
    Call number: IASS 15.89619
    Description / Table of Contents: "The Handbook of Global Agricultural Markets is a one-stop reference for practitioners and academics in finance, business, and economics, providing a holistic reference to the international agriculture business. The book takes a multidisciplinary approach to the topic, looking at the issues, opportunities, and investible themes in the global agricultural space, combining both research and practical tools for analyzing topics and assessing risks. A central theme of the book is the role of the agriculture industry as an emerging market, how the industry has developed and grown to date, and prospects for the future. Readers will gain an understanding of the industry from the perspectives of producers, consumers, and catalysts. The book provides coverage of the following key commodity industries: wheat, soybean, corn, coffee, cotton, rice, ethanol, oats, lumber, cacao, orange juice, soy oil, live cattle, live hogs and feed cattle, water. This book will appeal to a range of readers, from the institutional investor who wants to invest in commodities; businesses, angels, and private equity houses who want to invest in agriculture projects; businesses looking for market entry; and academics who are researching the global agriculture industry. "--
    Type of Medium: Monograph available for loan
    Pages: XVIII, 585 S. , graph. Darst. , 24 cm
    ISBN: 9781137302335 (hardback)
    URL: Cover
    URL: http://www.gbv.de/dms/bowker/toc/9781137302335.pdf
    Language: English
    Note: Machine generated contents note:1. Introduction2. The Investible Agricultural Space3. Climate Change and Agriculture4. Agricultural Risk Management & Insurance5. Biofuels and Agriculture5b. Biofuels and the Sustainability Conundrum6. Financing the Agricultural Firm7. Farmland as an Investible Asset Class7b. Farmland7c. Land Expectation Value and Timberland Valuation8. Advanced Technologies and Agriculture9. Challenges in Agricultural Production and Natural Resources Management10. Sustainability of Agricultural Productivity Growth11. Commodity Derivative Markets11b. Trading Agricultural Commodities11c. Speculation on (Agricultural) Commodity Markets & Financialization of Commodity Price Formation12. The Global Water Challenge13. Future Agricultural Dynamics..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 22
    Monograph available for loan
    Monograph available for loan
    Fields, currents and aerosols in the lower troposphere (1986)
    Darmstadt : Steinkopff
    Details Availability
    Call number: MOP 46575 / Mitte
    Type of Medium: Monograph available for loan
    Pages: XIX, 714 S.
    ISBN: 9061914698
    Series Statement: Scientific research reports. Natural sciences series 71
    Uniform Title: Felder, Ströme und Aerosole in der unteren Troposphäre
    Language: English
    Location: MOP - must be ordered
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 23
    Monograph available for loan
    Monograph available for loan
    Geodesy : introduction to geodetic datum and geodetic systems (2014)
    Berlin : Springer
    Details
    Call number: 6/M 16.89656
    Description / Table of Contents: Geodetic datum (including coordinate datum, height datum, depth datum, gravimetry datum) and geodetic systems (including geodetic coordinate system, plane coordinate system, height system, gravimetry system) are the common foundations for every aspect of geomatics. This course book focuses on geodetic datum and geodetic systems, and describes the basic theories, techniques, methods of geodesy. The main themes include: the various techniques of geodetic data acquisition, geodetic datum and geodetic control networks, geoid and height systems, reference ellipsoid and geodetic coordinate systems, Gaussian projection and Gaussian plan coordinates and the establishment of geodetic coordinate systems. The framework of this book is based on several decades of lecture noted and the contents are developed systematically for a complete introduction to the geodetic foundations of geomatics.
    Description / Table of Contents: REVIEW: "The present work integrates both classical materials and modern developments in geodesy, it describes pure theoretical approaches and recent practical applications. The book can be used as a general textbook for undergraduates studying geomatics and survejing and mapping in higher education institutions. For technicians who are engaged in geomatic and surveying engineering, the book is strongly recommended as a basic and useful reference guide."
    Type of Medium: Monograph available for loan
    Pages: XXI, 401 S.
    ISBN: 9783642412455 , 9783642412448
    DOI: 10.1007/978-3-642-41245-5
    Classification:
    Geodesy
    Language: English
    Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 24
    Monograph available for loan
    Monograph available for loan
    Praxishandbuch SAP Query-Reporting : [Schritt für Schritt mit SAP Query zur konkreten Auswertung ; optimale Berichte für sämtliche Geschäftsprozesse ; für alle SAP-Komponenten geeignet ; mit 100 sofort einsetzbaren Queries] (2014)
    Bonn, Boston : Galileo Press
    Details Availability
    Call number: M 16.89640
    Type of Medium: Monograph available for loan
    Pages: 445 S. , zahlr. Ill., graph. Darst. , 168 mm x 240 mm
    Edition: 2., aktualisierte und erweiterte Aufl.
    ISBN: 9783836218405
    Series Statement: SAP Press
    URL: Inhaltstext
    URL: Inhaltsverzeichnis
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 25
    Monograph available for loan
    Monograph available for loan
    Automatisierte Verhandlungen in Multi-Agenten-Systemen : Entwurf eines argumentationsbasierten Mechanismus für nur imperfekt beschreibbare Verhandlungsgegenstände (2011)
    Wiesbaden : Gabler
    Details Availability
    Call number: PIK B 020-16-89503
    Type of Medium: Monograph available for loan
    Pages: XXII, 287 S. , graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9783834921314 (PB.)
    Series Statement: Gabler research
    URL: http://www.gbv.de/dms/zbw/620830050.pdf
    URL: Inhaltsverzeichnis
    Language: German
    Note: Univ., Diss., Hohenheim, 2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 26
    Monograph available for loan
    Monograph available for loan
    Reliability modeling and analysis of smart power systems (2014)
    New Delhi [u.a.] : Springer
    Details Availability
    Call number: PIK P 120-16-89507
    Type of Medium: Monograph available for loan
    Pages: XIV, 202 S. , graph. Darst.
    ISBN: 9788132217978
    Series Statement: Reliable and sustainable electric power and energy systems management
    URL: Publisher description
    URL: Inhaltsverzeichnis
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 27
    Monograph available for loan
    Monograph available for loan
    Graph theory (2010)
    Heidelberg [u.a.] : Springer
    Details Availability
    Call number: PIK M 390-16-89505
    Type of Medium: Monograph available for loan
    Pages: XVIII, 436 S. , graph. Darst. , 235 mm x 155 mm
    Edition: 4. ed., 2. corr. print.
    ISBN: 9783642142789 (PB.) , 9783642142796
    Series Statement: Graduate texts in mathematics 173
    URL: Inhaltsverzeichnis
    URL: Inhaltstext
    URL: http://www.gbv.de/dms/bowker/toc/9783642142789.pdf
    Language: English
    Note: The basics -- Matching, covering and packing -- Connectivity -- Planar graphs -- Colouring -- Flows -- Extremal graph theory -- Infinite graphs -- Ramsey theory for graphs -- Hamilton cycles -- Random graphs -- Minors, trees, and WQO..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 28
    Monograph available for loan
    Monograph available for loan
    Graphs, networks and algorithms (2013)
    Berlin [u.a.] : Springer
    Details Availability
    Call number: PIK M 370-16-89506
    Type of Medium: Monograph available for loan
    Pages: XX, 675 S. , graph. Darst. , 25 cm
    Edition: 4th ed.
    ISBN: 3642322778 (Pp.) , 9783642322778 (Pp.) , 9783642322785
    Series Statement: Algorithms and computation in mathematics 5
    Uniform Title: Graphen, Netzwerke und Algorithmen 〈engl.〉
    URL: Inhaltsverzeichnis
    URL: Inhaltstext
    Language: English
    Note: 1. Basic graph theory2. Algorithms and complexity -- 3. Shortest paths -- 4. Spanning trees -- 5. The greedy algorithm -- 6. Flows -- 7. Combinatorial applications -- 8. Connectivity and depth first search -- 9. Colorings -- 10. Circulations -- 11. The network simplex algorithm -- 12. Synthesis of networks -- 13. Matchings -- 14. Weighted matchings -- 15. A hard problem: the TSP -- Appendix A. Some NP-complete problems -- Appendix B. Solutions -- Appendix C. List of symbols..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 29
    Monograph available for loan
    Monograph available for loan
    Zur Nachahmung empfohlen! : Expeditionen in Ästhetik und Nachhaltigkeit = Examples to follow! : expeditions in aesthetics and sustainability; [2]: Lesebuch = Storybook (2010)
    Ostfildern : Hatje Cantz
    Associated volumes
    Details Availability
    Call number: IASS 16.89630/2
    Type of Medium: Monograph available for loan
    Pages: S. 118 - 235 , Ill. , 28 cm
    URL: http://www.gbv.de/dms/weimar/toc/637038495_toc.pdf
    Language: German , English
    Note: Text dt. und engl.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 30
    Monograph available for loan
    Monograph available for loan
    Zur Nachahmung empfohlen! : Expeditionen in Ästhetik und Nachhaltigkeit = Examples to follow! : expeditions in aesthetics and sustainability; [1]: Katalog = Catalogue (2010)
    Ostfildern : Hatje Cantz
    Associated volumes
    Details Availability
    Call number: IASS 16.89630/1
    Type of Medium: Monograph available for loan
    Pages: 107 S. , zahlr. Ill., graph. Darst. , 1 Bl. Bauanleitung - 1 Bl. Entwurf , 28 cm
    URL: http://www.gbv.de/dms/weimar/toc/637038134_toc.pdf
    Language: German , English
    Note: Text dt. und engl. - Text in Faltbl. [1] dt.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 31
    Monograph available for loan
    Monograph available for loan
    Zur Nachahmung empfohlen! : Expeditionen in Ästhetik und Nachhaltigkeit = Examples to follow! : expeditions in aesthetics and sustainability (2010)
    Ostfildern : Hatje Cantz
    Details Availability
    Type of Medium: Monograph available for loan
    ISBN: 9783775727723
    Language: German , English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 32
    Monograph available for loan
    Monograph available for loan
    Urbane Niederschlagsbeeinflussung : Genese und räumliche Differenzierung am Beispiel von Berlin (2011)
    Berlin
    Details
    Call number: PIK 16-89825
    Type of Medium: Monograph available for loan
    Pages: Getr. Zählung , Ill., graph. Darst.
    Edition: Online-Ausg. Berlin Humboldt-Universität zu Berlin, Universitätsbibliothek 2011 〈〈Nach einem Exemplar der Humboldt-Universität zu Berlin, Universitätsbibliothek mit der Signatur: 〉〉Diss Geo11 P134
    URL: http://edoc.hu-berlin.de/docviews/abstract.php?lang=ger&id=38998
    Language: German
    Note: Berlin, Humboldt-Univ., Diss., 2011
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 33
    Monograph available for loan
    Monograph available for loan
    Models, simulations, and the reduction of complexity (2013)
    Berlin [u.a.] : de Gruyter
    Details
    Call number: PIK A 190-16-89749
    Description / Table of Contents: Modern science is a model-building activity. But how are models contructed? How are they related to theories and data? How do they explain complex scientific phenomena, and which role do computer simulations play? To address these questions which are highly relevant to scientists as well as to philosophers of science, 8 leading natural, engineering and social scientists reflect upon their modeling work, and 8 philosophers provide a commentary
    Description / Table of Contents: Modern science is a model-building activity. But how are models contructed? How are they related to theories and data? How do they explain complex scientific phenomena, and which role do computer simulations play? To address these questions which are highly relevant to scientists as well as to philosophers of science, 8 leading natural, engineering and social scientists reflect upon their modeling work, and 8 philosophers provide a commentary. U. Gähde and J. H. Wolf, University of Hamburg; S. Hartmann, Ludwig-Maximilians-Universität Munich.
    Type of Medium: Monograph available for loan
    Pages: VIII, 274 Seiten , graph. Darst.
    ISBN: 9783110313680 , 9783110313604
    Series Statement: Abhandlungen der Akademie der Wissenschaften in Hamburg 4
    Language: English
    Note: Preface; Contributors; Content; Introduction; Cosmology - The Largest Possible Model?; The Standard Model of Cosmology as a Tool for Interpretation and Discovery; Patterns in Physical and Biological Systems; Symmetry and the Explanation of Organismal Form; Pluralistic Modeling of Complex Systems; The Methodological Challenges of Complex Systems; Contested Modeling: The Case of Economics; A Unifying Approach to High- and Low-Level Cognition; High-vs Low-Level Cognition and the Neuro- Emulative Theory of Mental Representation. , Evaluating a Computational Model of Eye-Movement Control in ReadingConsidering Criteria for Model Modification and Theory Change in Psychology; Identification of Kinetic Models by Incremental Refinement; Kinetics, Models, and Mechanism; Modeling Complexity: The Case of Climate Science; Chaos, Plurality, and Model Metrics in Climate Science; Subject Index; Author Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 34
    Monograph available for loan
    Monograph available for loan
    Der Briefwechsel Richard Dedekind - Heinrich Weber (2014)
    Berlin [u.a.] : De Gruyter
    Details Availability
    Call number: PIK M 900-16-89750
    Description / Table of Contents: Main description: Der Briefwechsel zwischen den Mathematikern Richard Dedekind und Heinrich Weber liegt nun erstmals in transkribierter Form vor. Es handelt sich um einen der wichtigsten Briefwechsel von Mathematikern im 19. Jahrhundert, da nahezu jedes Teilgebiet der Mathematik angesprochen wird und damals beginnende Entwicklungen intensiv diskutiert wurden. Personen- und Werkverzeichnisse erleichtern den Überblick über die in den Briefen diskutierten Themen.
    Description / Table of Contents: Main description: This volume provides the very first transcription of correspondence between Richard Dedekind and Heinrich Weber, one of the most important instances of written dialog between mathematicians in the 19th century. Nearly every subarea of mathematics is addressed in the letters, which intensively discuss nascent developments in the field. A register of persons and index of works ease access to the topics discussed in the letters.
    Type of Medium: Monograph available for loan
    Pages: XX, 490 S. , Ill. , 24 cm
    ISBN: 3110373661 (Gb.) , 9783110373660 (Gb.) , 9783110368048 (electr.; PDF) , 9783110398656 (electr.; ePub)
    Series Statement: Abhandlungen der Akademie der Wissenschaften in Hamburg 5
    URL: http://www.degruyter.com/view/product/431805
    URL: Inhaltstext
    URL: http://www.gbv.de/dms/tib-ub-hannover/797412298.pdf
    Language: German
    Note: Techn. Univ., Diss. u.d.T.: Scheel, Katrin: Der Briefwechsel von Richard Dedekind mit Heinrich Weber--Braunschweig, 2015 , Frontmatter -- Grußwort Geleitwort Vorwort des Herausgebers Danksagung Editionskriterien Abkürzungsverzeichnis Inhalt: 1. Einleitung 2. Richard Dedekind 3. Heinrich Weber 4. Briefwechsel Dedekind - Weber 5. Elise Riemann 6. Verlag B. G. Teubner 7. Karl Hattendorff 8. Hermann Amandus Schwarz 9. Friedrich Wöhler A. Verlagsverträge B.G.Teubner-Verlag B. Chronologisches Dokumentenverzeichnis C. Verzeichnis der Fundstellen D. Literaturverzeichnis zum Briefwechsel E. Kurzbiographien Literatur Personenindex..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 35
    Monograph available for loan
    Monograph available for loan
    The structure of scientific revolutions (2012)
    Chicago [u.a.] : The University of Chicago Press
    Details Availability
    Call number: IASS 16.90032
    Type of Medium: Monograph available for loan
    Pages: XLVI, 217 S.
    Edition: 4. ed., 50th anniversary ed.
    ISBN: 0226458113 (cloth) , 9780226458113 (cloth) , 0226458121 (paperback) , 9780226458120 (paperback)
    URL: Inhaltsverzeichnis
    Language: English
    Note: Introductory essay / by Ian Hacking -- Preface -- Introduction: a role for history -- The route to normal science -- The nature of normal science -- Normal science as puzzle-solving -- The priority of paradigms -- Anomaly and the emergence of scientific discoveries -- Crisis and the emergence of scientific theories -- The response to crisis -- The nature and necessity of scientific revolutions -- Revolutions as changes of world view -- The invisibility of revolutions -- The resolution of revolutions -- Progress through revolutions -- Postscript-1969..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 36
    Unknown
    The art of conjecture / (2012)
    New Brunswick (U.S.A.) and London (U.K.) :Transaction Publishers,
    Details Availability
    Call number: IASS 16.89965
    Pages: xviii, 307 pages ; , 23 cm
    ISBN: 9781412847483
    Uniform Title: Art de la conjecture.
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 37
    Monograph available for loan
    Monograph available for loan
    Elektrizität und Magnetismus (1987)
    Berlin [u.a.] : de Gruyter
    Details Availability
    Call number: PIK N 160-16-90352
    Type of Medium: Monograph available for loan
    Pages: XII, 872 S. , Ill., graph. Darst. , 1 Beil.: Periodensystem der Elemente
    Edition: 7. Aufl., neubearb. und erw.
    ISBN: 3110102617
    Series Statement: Lehrbuch der Experimentalphysik : zum Gebrauch bei akademischen Vorlesungen und zum Selbststudium / von L. Bergmann und Cl. Schaefer ; Bd. 2
    URL: Inhaltsverzeichnis
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 38
    Monograph available for loan
    Monograph available for loan
    LPIC-2 : Vorbereitung auf die Prüfungen des Linux Professional Institute (2013)
    München : Open Source Press
    Details Availability
    Call number: 18/M 16.90221
    Type of Medium: Monograph available for loan
    Pages: 575 Seiten , Ill., graph. Darst , 24 cm
    Edition: 5. Aufl.
    ISBN: 9783955390402
    Series Statement: Root's reading
    URL: Inhaltsverzeichnis
    URL: Ausfuehrliche Beschreibung
    URL: Inhaltstext
    Classification:
    Informatics
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 39
    Monograph available for loan
    Monograph available for loan
    Fundamentals of deformation and fracture : Eshelby Memorial Symposium, Sheffield, 2 - 5 April 1984 (1985)
    Cambridge, Mass. [u.a.] : Cambridge Univ. Press
    Details Availability
    Call number: M 17.90366
    Description / Table of Contents: This book comprises the papers presented at the symposium of the Internation Union of Theoretical and Applied Mechanics, Sheffield April 1984, held in memory of the late J. D. Eshelby FRS, Professor of the Theory of Materials at the University of Sheffield. The papers reflect the range of Professor Eshelby's interests. Topics include conservation laws and their applications; inclusions, inhomogeneities and composites; short cracks; the dynamics of dislocations and cracks; dislocations and point defects; and creep fracture. There is also an obituary of Professor Eshelby, together with a complete list of his publications. The 45 papers in this volume provide an international survey of work in the field of deformation and fracture, with theoretical examinations, reports of empirical investigations and descriptions of experimental techniques. It will be of interest to professionals and researchers in the science of materials, mechanics of solids and mechanical engineering and to related areas of science and technology
    Type of Medium: Monograph available for loan
    Pages: XXII, 630 S , graph. Darst
    ISBN: 9780521105323
    URL: Inhaltsverzeichnis
    Classification:
    Engineering Geophysics
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 40
    Monograph available for loan
    Monograph available for loan
    Urban economics and urban policy : challenging conventional policy wisdom (2014)
    Cheltenham [u.a.] : Elgar
    Details Availability
    Call number: PIK B 010-16-90321
    Description / Table of Contents: "Urban Economics and Urban Policy" pulls together cutting-edge developments in urban and regional economics and draws out their implications for urban policy. This new urban economics goes beyond simple comparative advantage and cost competitiveness of cities, and beyond simple views of capital and labor. It develops a much more complex and realistic view of what constitutes local advantage, due to the spatial sorting of different types of people and different types of firms, giving rise to a lumpy landscape of people, activities, and incomes. By taking seriously the new ways we understand the forces shaping the geography of economic development, the authors suggest fresh new ways to work with the grain of markets, but without letting them rip. It is a tour de force.'--Michael Storper, London School of Economics, UK. In this bold, exciting and readable volume, Paul Cheshire, Max Nathan and Henry Overman illustrate the insights that recent economic research brings to our understanding of cities, and the lessons for urban policy-making. The authors present new evidence on the fundamental importance of cities to economic wellbeing and to the enrichment of our lives. They also argue that many policies have been trying to push water uphill and have done little to achieve their stated aims; or, worse, have had unintended and counterproductive consequences. It is remarkable that our cities have been so successful despite the many shortcomings of urban policies and governance. These shortcomings appear in both rich and poor countries. Many powerful policies intended to influence urban development and spatial differences have been developed since the late 1940s, but they have been subject to little rigorous economic evaluation. The authors help us to understand why economic growth has emerged so unevenly across space and why this pattern persists. The failure to understand the forces leading to uneven development underlies the ineffectiveness of many current urban policies. The authors conclude that future urban policies need to take better account of the forces that drive unevenness and that their success should be judged by their impact on people, not on places - or buildings. This groundbreaking book will prove to be an invaluable resource and a rewarding read for academics, practitioners and policymakers interested in the economics of urban policy, urban planning and development, as well as international studies and innovation.
    Type of Medium: Monograph available for loan
    Pages: XII, 238 Seiten , Diagramme, Karten
    Edition: Paperback edition reprint
    ISBN: 9781783475254 , 9781781952511 ((hdb.)) , 9781781952528 (electronic)
    URL: http://www.gbv.de/dms/zbw/772855390.pdf
    Language: English
    Note: Contents: Contents: Foreword by Ed Glaeser ; 1. Introduction ; 2. Urban Economic Performance ; 3. Residential Segregation and People Sorting Within Cities ; 4. Planning for a Housing Crisis: Or the Alchemy by Which We Turn Houses into Gold ; 5. Planning and Economic Performance ; 6. Planning: Reforms that Might Work and Ones that Won’t ; 7. Devolution, City Governance and Economic Performance ; 8. Urban Policies ; 9. Conclusions ; Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 41
    Monograph available for loan
    Monograph available for loan
    Transnational corporations and international production : concepts, theories and effects (2012)
    Cheltenham [u.a.] : Elgar
    Details Availability
    Call number: PIK B 160-16-90323
    Type of Medium: Monograph available for loan
    Pages: XIV, 260 Seiten , graph. Darst.
    Edition: 2. ed.
    ISBN: 9780857932259 (hbk.) , 9780857932273 (pbk.)
    URL: http://www.gbv.de/dms/zbw/671557920.pdf
    Language: English
    Note: Contents: Preface to the Second Edition ; Preface to the First Edition ; Introduction ; Part I: Evolution and Concepts ; 1. Evolution and Concepts ; Appendix to Chapter 1: Definitions and Data Issues ; Part II: Pre-WWII Approaches to International Investment ; Introduction to Part II 2. Marxist Approaches ; 3. Foreign Investment Within the Neoclassical Paradigm ; Part III: Modern Theories ; Introduction to Part III 4. Hymer’s Seminal Work ; 5. The Product Life Cycle and International Production ; 6. Oligopolistic Reactions and the Geographical Pattern of FDI ; 7. Currency Areas and Internationalization ; 8. Internalization and the Transnational Corporation ; 9. Dunning’s Eclectic Framework ; 10. Stages in the Internationalization Process: The Scandinavian School ; 11. Evolutionary Theories of the TNC ; 12. New Trade Theories and the Activities of TNCs ; 13. Transnational Monopoly Capitalism ; 14. Nation-states and TNCs’ Strategic Behaviour ; 15. Resources, Networks and the TNC ; Part IV: Effects ; Introduction to Part IV 16. Boundaries in the Assessment of Effects ; 17. Innovation and the TNCs ; 18. Effects on Labour ; 19. Effects on Trade ; 20. Effects on the Balance of Payments ; Reference ; Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 42
    Monograph available for loan
    Monograph available for loan
    International practice theory : new perspectives (2014)
    Basingstoke [u.a.] : Palgrave Macmillan
    Details Availability
    Call number: IASS 16.90511
    Description / Table of Contents: "International Practice Theory has become one of the core perspectives in International Relations. Since the practice turn, there has been significant interest in developing new theories and methodologies for understanding world politics and global governance. This unique study reviews these new approaches, offering a focused discussion of the strategies, techniques and issues. Examining how International Practice Theory is linked to social theory and international relations theory, Bueger and Gadinger explore Bourdieu's praxeology, the community of practice approach, narrative approaches, Actor-Network Theory and Boltanski's pragmatic sociology to address core questions of transformation, scale, normativity and materiality. Advocating greater attention to translating International Practice Theory into empirical research, this book will be a valuable resource for all those interested in social theory, practice theory and the international"--
    Type of Medium: Monograph available for loan
    Pages: VIII, 128 S.
    ISBN: 1137395524 (hardback) , 9781137395528 (hardback) , 9781137395535 (electronic; PDF) , 9781137395542 (electronic; ePUB)
    Series Statement: Palgrave Pivot
    URL: http://scans.hebis.de/HEBCGI/show.pl?34773275_toc.pdf
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 43
    Monograph available for loan
    Monograph available for loan
    Berechtigungen in SAP ERP HCM : Konzeption, Implementierung, Betrieb ; [ein prozessorientiertes Berechtigungskonzept erstellen ; komplexe Berechtigungswerkzeuge einsetzen ; Customizing und Erweiterungen, Auswertungen und Fehlersuche] (2012)
    Bonn : Galileo Press
    Details Availability
    Call number: 18/M 17.90533
    Type of Medium: Monograph available for loan
    Pages: 428 S , 256 cm
    Edition: 2., aktualisierte und erw. Aufl
    ISBN: 3836218267 , 9783836218269
    Series Statement: SAP Press
    URL: Inhaltsverzeichnis
    URL: Inhaltstext
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 44
    Monograph available for loan
    Monograph available for loan
    The two sides of innovation : creation and destruction in the evolution of capitalist economies (2013)
    Cham [u.a.] : Springer
    Details Availability
    Call number: IASS 16.90414
    Type of Medium: Monograph available for loan
    Pages: VI, 309 Seiten , Illustrationen
    ISBN: 9783319014951 , 9783319014968 (electronic)
    Series Statement: Economic complexity and evolution
    URL: Inhaltsverzeichnis
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 45
    Monograph available for loan
    Monograph available for loan
    Active hope : how to face the mess we're in without going crazy (2012)
    Novato, Calif. :New World Library,
    Details Availability
    Call number: IASS 16.90550
    Type of Medium: Monograph available for loan
    Pages: xiv, 272 p. : , ill. ; , 22 cm.
    ISBN: 9781577319726 (pbk. : alk. paper)
    Language: English
    Note: Three stories of our time -- Trusting the spiral -- Coming from gratitude -- Honoring our pain for the world -- A wider sense of self -- A different kind of power -- A richer experience of community -- A larger view of time -- Catching an inspiring vision -- Daring to believe it is possible -- Building support around you -- Maintaining energy and enthusiasm -- Strengthened by uncertainty.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 46
    Monograph available for loan
    Monograph available for loan
    Diskursforschung : eine Einführung für SozialwissenschaftlerInnen (2011)
    Wiesbaden : VS Verlag
    Details Availability
    Call number: IASS 16.90468
    Type of Medium: Monograph available for loan
    Pages: 136 Seiten , Illustrationen
    Edition: 4. Auflage
    ISBN: 9783531173528
    Series Statement: Qualitative Sozialforschung Band 14
    URL: http://d-nb.info/1002862450/04
    Parallel Title: Erscheint auch als Diskursforschung
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 47
    Monograph available for loan
    Monograph available for loan
    Geo-engineering climate change : environmental necessity or Pandora's box? (2010)
    Cambridge : Cambridge Univ. Press
    Details Availability
    Call number: IASS 16.90469
    Type of Medium: Monograph available for loan
    Pages: XVII, 314 S. , Ill., graph. Darst.
    ISBN: 0521198038 (hbk) , 9780521198035 (hbk)
    URL: http://www.gbv.de/dms/bowker/toc/9780521198035.pdf
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 48
    Monograph available for loan
    Monograph available for loan
    Hack the planet : science's best hope - or worst nightmare - for adverting climate catastrophe (2010)
    Hoboken, NJ : Wiley
    Details Availability
    Call number: IASS 16.90470
    Type of Medium: Monograph available for loan
    Pages: V, 279 S.
    ISBN: 047052426X (hbk) , 9780470524268 (hbk)
    URL: http://www.gbv.de/dms/bowker/toc/9780470524268.pdf
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 49
    Monograph available for loan
    Monograph available for loan
    Lifeworld and system : a critique of functionalist reason (1989)
    Boston : Beacon Press
    Details Availability
    Call number: IASS 16.90474
    Type of Medium: Monograph available for loan
    Pages: 457 S , graph. Darst.
    ISBN: 0807014001 (hbk) , 080701401X (pbk) , 9780807014011 (pbk)
    Series Statement: The theory of communicative action Vol. 2
    Uniform Title: Zur Kritik der funktionalistischen Vernunft 〈engl.〉
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 50
    Monograph available for loan
    Monograph available for loan
    Global Arctic : sovereignty and the future of the North (2013)
    Highclere : Berkshire Academic Press
    Details Availability
    Call number: IASS 16.90588
    Type of Medium: Monograph available for loan
    Pages: XVII, 269 S.
    ISBN: 9781907784095
    URL: http://www.gbv.de/dms/bowker/toc/9781907784095.pdf
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 51
    Monograph available for loan
    Monograph available for loan
    Farthing on international shipping (2013)
    Berlin : Springer
    Details Availability
    Call number: IASS 16.90586
    Type of Medium: Monograph available for loan
    Pages: XXIX, 411 S. , graph. Darst.
    Edition: 4. ed.
    ISBN: 3642345972 , 9783642345975 , 9783642345982 (electronic)
    Series Statement: WMU studies in maritime affairs 1
    URL: Inhaltstext
    URL: http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=026118098&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 52
    Monograph available for loan
    Monograph available for loan
    Promoting compliance in an evolving climate regime (2012)
    Cambridge [u.a.] : Cambridge Univ. Press
    Details Availability
    Call number: IASS 16.90626
    Type of Medium: Monograph available for loan
    Pages: XV, 495 S. , graph. Darst
    ISBN: 0521199484 (hbk) , 9780521199483 (hbk) , 052113613X (pbk) , 9780521136136 (pbk)
    URL: http://www.gbv.de/dms/bowker/toc/9780521136136.pdf
    Language: English
    Note: Introduction.The role of compliance in an evolving climate regime / Lavanya Rajamani, Jutta Brunnée, and Meinhard Doelle -- The emerging post-Cancun climate regime / Jennifer Morgan -- Promoting compliance with multilateral environmental agreements / Jutta Brunnée -- Compliance regimes in multilateral environmental agreements / Jane Bulmer -- Key features of the Kyoto Protocol's compliance system / René Lefeber and Sebastian Oberthür -- Experience with the facilitative and enforcement branches of the Kyoto compliance system / Meinhard Doelle -- Experiences with Articles 5, 7, and 8 defining the monitoring, reporting and verification system under the Kyoto Protocol / Anke Herold -- The role of non-state actors in climate compliance / Eric Dannenmaier -- Facilitation of compliance / Catherine Redgwell -- Enforcing compliance in an evolving climate regime / Michael Mehling -- Financial mechanisms under the climate regime / Haroldo Machado-Filho -- Post-2012 compliance and carbon markets / Franceso Sindico -- Compliance and the use of trade measures / Jacob Werksman -- 'Comparability of efforts' among developed country parties and the post-2012 compliance system / M.J. Mace -- From the Kyoto Protocol compliance system to MRV : what is at stake for the European Union? / Sandrine Maljean-Dubois and Anne-Sophie Tabau -- Compliance in transition countries / Christina Voigt -- Developing countries and compliance in the climate regime / Lavanya Rajamani -- The role of dispute settlement in the climate regime / Ruth Mackenzie -- Depoliticizing compliance / Geir Ulfstein -- Conclusion.Promoting compliance in an evolving climate regime / Meinhard Doelle, Jutta Brunnée, and Lavanya Rajamani..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 53
    Monograph available for loan
    Monograph available for loan
    Technik und Wissenschaft als "Ideologie" (2014)
    Frankfurt am Main : Suhrkamp
    Details Availability
    Call number: IASS 17.90630
    Type of Medium: Monograph available for loan
    Pages: 167 S.
    Edition: 20. Aufl.
    ISBN: 9783518102879
    Series Statement: Edition Suhrkamp 287
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 54
    Monograph available for loan
    Monograph available for loan
    Empowering public wisdom : a practical vision of citizen-led politics (2012)
    Berkeley, Calif : Evolver Editions
    Details Availability
    Call number: IASS 17.90846
    Type of Medium: Monograph available for loan
    Pages: XXII, 256 S
    ISBN: 9781583945001 (pbk.)
    URL: http://www.gbv.de/dms/sub-hamburg/685349489.pdf
    Language: English
    Note: Preface -- Manifesto: a call to establish a legitimate, wise, powerful collective voice of the people -- Democracy is about power and the people -- Direct democracy, representative democracy, and their shadows -- Why we need public wisdom -- Public wisdom: its role, its sources and its limitations -- Citizenship and the random selection of ad hoc mini publics -- Citizen deliberative councils: their character, variety and history -- How citizen deliberative councils could and should be used -- Public empowerment, public engagement, and the role of journalism -- Polarization, transpartisanship, and public wisdom -- Wisdom councils in 100 cities; with study circles, world cafes, and open space to engage the public with the results -- Deliberation for direct democracy -- Empowered public wisdom rising from the grassroots -- A new branch of government? -- Protecting the power and integrity of public wisdom -- What role will you play? -- Appendices -- An annotated list of powerful participatory processes, with links -- Some areas for research and development..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 55
    Monograph available for loan
    Monograph available for loan
    The next catastrophe : reducing our vulnerabilities to natural, industrial, and terrorist disasters (2011)
    Princeton, NJ [u.a.] : Princeton Univ. Press
    Details Availability
    Call number: IASS 17.90852
    Type of Medium: Monograph available for loan
    Pages: XLVIII, 377 S.
    Edition: 1. paperback print.
    ISBN: 9780691150161 , 978069112997 , 0691129975
    URL: http://www.gbv.de/dms/bowker/toc/9780691150161.pdf
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 56
    Monograph available for loan
    Monograph available for loan
    E-Bilanz und SAP (2012)
    Göttingen : Optimus-Verl.
    Details Availability
    Call number: M 17.90710
    Type of Medium: Monograph available for loan
    Pages: V, 162 S. , Ill., graph. Darst. , 21 cm, 290 g
    Edition: 2. Aufl.
    ISBN: 9783863760175
    Series Statement: Espresso-Tutorials
    URL: Inhaltsverzeichnis
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 57
    Monograph available for loan
    Monograph available for loan
    Tidal gravimetry : physical models and numerical methods for the reduction of environmental and instrumental problems in applications to earth and ocean tide measurements (1986)
    Uppsala
    Details Availability
    Call number: M 17.90889
    Type of Medium: Monograph available for loan
    Pages: VI, 180 S. , Ill., graph. Darst.
    ISBN: 9150605046
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 58
    Monograph available for loan
    Monograph available for loan
    Envisioning real utopias (2010)
    London [u.a.] : Verso
    Details Availability
    Call number: IASS 17.90937
    Type of Medium: Monograph available for loan
    Pages: XVIII, 394 S. , graph. Darst. , 23 cm
    ISBN: 184467617X (pbk) , 9781844676170 (pbk) , 1844676188 (hbk) , 9781844676187 (hbk)
    URL: http://www.gbv.de/dms/sub-hamburg/620862610.pdf
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 59
    Monograph available for loan
    Monograph available for loan
    Infrared spectra of mineral species : Extended library ; [Vol. 1] (2014)
    Dordrecht : Springer Netherlands
    Details
    Call number: M 17.90938
    Description / Table of Contents: Over the last 30 years, Dr. Nikita V. Chukanov has collected IR spectra of about 2000 mineral species, including 247 holotype samples. In this book, he presents 3309 spectra of these minerals with detailed  description and analytical data for reference samples. In the course of this work, about 150 new mineral species have been discovered. This book presents spectra of each mineral together with a description and comments on standard samples used (occurrence, appearance, associated minerals, empirical formula etc.). Sections are organized according to different classes of compounds (silicates, phosphates, arsenates, oxides etc.)
    Type of Medium: Monograph available for loan
    Pages: IX, 1726 p. 3547 illus., 1 illus. in color
    Edition: Online edition Springer eBook Collection. Earth and Environmental Science
    ISBN: 9789400771284 , 9789400771277 (print)
    Series Statement: Springer Geochemistry / Mineralogy
    DOI: 10.1007/978-94-007-7128-4
    Parallel Title: Print version Infrared spectra of mineral species : Extended library
    Language: English
    Note: The Application of IR Spectroscopy to the Investigation of MineralsThe Discrete Approach -- The Full-Profile Analysis -- Polymerization of coordination polyhedra and structure topology -- Hydrogen-bearing groups and hydrogen bonding -- Solid-solution series -- Force parameters of cations in silicates -- IR spectra of minerals and reference samples data -- Borates, including sulfato-borates and arsenato-borates -- Carbides and carbonates -- Organic compounds and salts of organic acids -- Ammino-complexes, nitrates and sulfato-nitrates -- Oxides and hydroxides -- Fluorides -- Silicates -- Phosphates -- Sulfates, carbonato-sulfates, phosphato-sulfates and sulfides -- Chlorides -- Vanadates and vanadium oxides -- Chromates -- Arsenates, arsenites and sulfato-arsenates -- Selenites, molybdates, tellurites, tellurates, iodites, wolframates and wolfram oxides..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 60
    Series available for loan
    Series available for loan
    2013 - 2015; [7.] (2013)
    Associated volumes
    Details Availability
    Call number: S 00.0652(2013-2015
    In: Erdbebenbeobachtung im Freistaat Sachsen
    Type of Medium: Series available for loan
    Pages: 54 Seiten , farbige Illustrationen und graphische Darstellungen
    Series Statement: Erdbebenbeobachtung in Mitteldeutschland
    Classification:
    Seismology
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 61
    Monograph available for loan
    Monograph available for loan
    Erzählen (2014)
    Zürich : Diaphanes
    Details Availability
    Call number: IASS 17.91041
    Type of Medium: Monograph available for loan
    Pages: 196 S
    Edition: 1. Aufl
    ISBN: 3037347120 , 9783037347126
    ISSN: 2235-4654
    Series Statement: Nach Feierabend 10.2014
    URL: http://www.gbv.de/dms/weimar/toc/78715895X_toc.pdf
    URL: Inhaltstext
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 62
    Monograph available for loan
    Monograph available for loan
    Antifragile : things that gain from disorder (2013)
    London : Penguin Books
    Associated volumes
    Details Availability
    Call number: IASS 17.91049
    In: Incerto
    Type of Medium: Monograph available for loan
    Pages: xix, 519 Seiten , Illustrationen, Diagramme
    ISBN: 9780141038223
    Series Statement: Incerto / Nassim Nicholas Taleb
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 63
    Monograph available for loan
    Monograph available for loan
    The bed of procrustes : philosophical and practical aphorisms (2011)
    [London] : Penguin Books
    Associated volumes
    Details Availability
    Call number: IASS 17.91052
    In: Incerto
    Type of Medium: Monograph available for loan
    Pages: XI, 156 Seiten
    ISBN: 9780141985022
    Series Statement: Incerto / Nassim Nicholas Taleb
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 64
    Monograph available for loan
    Monograph available for loan
    The Black Swan : the impact of the highly improbable (2010)
    [London] : Penguin Books
    Associated volumes
    Details Availability
    Call number: IASS 17.91050
    In: Incerto
    Type of Medium: Monograph available for loan
    Pages: xxxiii, 444 Seiten , Illustrationen, Diagramme
    Edition: revised edition
    ISBN: 9780141034591
    Series Statement: Incerto / Nassim Nicholas Taleb
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 65
    Monograph available for loan
    Monograph available for loan
    A color guide to the petrography of sandstones, siltstones, shales and associated rocks (2014)
    Tulsa, OK : American Association of Petroleum Geologists
    Associated volumes
    Details Availability
    Call number: 9/S 90.0096(109)
    In: AAPG memoir
    Description / Table of Contents: Grains: Quartz and silica -- Monocrystalline -- Polycrystalline -- Feldspars -- Plagioclase -- Potassium feldspars -- Rock fragments -- Sedimentary rock fragments -- Metamorphic rock fragments -- Igneous rock fragments -- Accessory minerals -- Light minerals: Muscovite ; Biotite ; Chlorite -- Ultrastable heavy minerals: Zircon, tourmaline and rutile -- Intermediate-stability heavy minerals: Apatite ; Epidote ; Zoisite and clinozoisite ; Garnet ; Kyanite ; Monzonite, sillimanite and staurolite ; Titanite -- Unstable heavy minerals: Amphibole, pyroxene and olivine -- Opaque minerals -- Associated detrital grains and rocks: Carbonate grains ; Siliceous grains and rocks ; Phosphatic grains and rocks ; Organic grains and rocks ; Evaporite grains and rocks ; Green marine clays and rocks ; Green marine clays and ironstones ; Iron-rich grains and iron formations ; Tuffaceous deposits -- Texture and classification: Sand and sandstone textures -- Sandstone classification -- Mudrocks: Siltstones, mudstones, claystones and shales -- Diagenesis: Synsedimentary and surficial diagenetic features -- Compaction -- Cementation: Introduction. Quartz and silica ; Quartz overgrowths ; Polycrystalline quartz cements ; Amorphous silica cements -- Cementation: Feldspars -- Cementation: Clays ; Chamosite ; Glauconite ; Kaolinite/dickite ; Smectite and illite/smectite ; Illite/sericite ; Chlorite -- Cementation: Zeolites -- Cementation: Carbonates ; Calcite ; Siderite ; Dolomite ; Ankerite -- Cementation: Sulfates and halides ; Gypsum ; Anhydrite ; Barite ; Celestite and halite -- Cementation: Iron oxides and sulfides -- Cementation: Other cements -- Dissolution -- Replacement and recrystallization: Feldspars ; Carbonates ; Sulfates ; Other -- Deformation features -- Other topics: Porosity -- Paragenesis -- Emerging techniques
    Type of Medium: Monograph available for loan
    Pages: XVI, 526 Seiten , Ill. , 1 DVD-ROM
    ISBN: 0891813896 , 9780891813897
    Series Statement: AAPG Memoir 109
    Classification:
    Petrology, Petrography
    Language: English
    Note: GrainsChapter 1: Quartz and silica - Monocrystalline - Polycrystalline -- Chapter 2: Feldspars - Plagioclase - Potassium feldspars -- Chapter 3: Rock fragments - Sedimentary rock fragments - Metamorphic rock fragments - Igneous rock fragments -- Chapter 4: Accessory minerals - Light minerals: Muscovite - Biotite - Chlorite ; Ultrastable heavy minerals: Zircon, tourmaline and rutile ; Intermediate-stability heavy minerals: Apatite - Epidote - Zoisite and clinozoisite - Garnet - Kyanite - Monzonite, sillimanite and staurolite - Titanite ; Unstable heavy minerals: Amphibole, pyroxene and olivine ; Opaque minerals -- Chapter 5: Associated detrital grains and rocks: Carbonate grains - Siliceous grains and rocks - Phosphatic grains and rocks - Organic grains and rocks - Evaporite grains and rocks - Green marine clays and rocks - Green marine clays and ironstones - Iron-rich grains and iron formations - Tuffaceous deposits.. , Texture and ClassificationChapter 6: Sand and sandstone textures -- Chapter 7: Sandstone classification.. , MudrocksChapter 8: Siltstones, mudstones, claystones and shales.. , DiagenesisChapter 9: Synsedimentary and surficial diagenetic features -- Chapter 10: Compaction -- Chapter 11: Cementation - Introduction / Quartz and silica - Quartz overgrowths - Polycrystalline quartz cements - Amorphous silica cements -- Chapter 12: Cementation - Feldspars -- Chapter 13: Cementation - Clays - Chamosite - Glauconite - Kaolinite/dickite - Smectite and illite/smectite - Illite/sericite - Chlorite -- Chapter 14: Cementation - Zeolites -- Chapter 15: Cementation - Carbonates - Calcite - Siderite - Dolomite - Ankerite -- Chapter 16: Cementaton - Sulfates and halides - Gypsum - Anhydrite - Barite - Celestite and halite -- Chapter 17: Cementation - Iron oxides and sulfides -- Chapter 18: Cementation - Other cements -- Chapter 19: Dissolution -- Chapter 20: Replacement and recrystallization - Feldspars - Carbonates - Sulfates - Other -- Chapter 21: Deformation features.. , Other topicsChapter 22: Porosity -- Chapter 23: Paragenesis -- Chapter 24: Emerging techniques..
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 66
    Monograph available for loan
    Monograph available for loan
    Knowledge and power in collaborative research : a reflexive approach (2014)
    New York : Routledge Taylor & Francis Group
    Details Availability
    Call number: IASS 17.91220
    Type of Medium: Monograph available for loan
    Pages: xii, 301 Seiten , Illustrationen
    ISBN: 9781138920613 (pbk) , 9780415540247 (hbk) , 9780203083673 (ebk)
    Series Statement: Routledge advances in research methods 6
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 67
    Monograph available for loan
    Monograph available for loan
    Planning with complexity : an introduction to collaborative rationality for public policy (2010)
    London [u.a.] : Routledge
    Details Availability
    Call number: IASS 17.91236
    Type of Medium: Monograph available for loan
    Pages: XVI, 237 S , graph. Darst.
    Edition: 1. ed
    ISBN: 9780415779319 (hbk) , 9780415779326 (pbk) , 9780203864302 (ebk) , 0415779316 (hbk) , 0415779324 (pbk) , 0203864301 (ebk)
    URL: http://www.gbv.de/dms/weimar/toc/601952243_toc.pdf
    Language: English
    Note: Thinking differently for an age of complexity -- How can theory improve practice? -- Stories from the field -- The praxis of collaboration -- Dialogue as a community of inquiry -- Knowledge into action : the role of dialogue -- Using local knowledge for justice and resilience -- Beyond collaboration : democratic governance for a resilient society..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 68
    Monograph available for loan
    Monograph available for loan
    101 design methods : a structured approach for driving innovation in your organization (2013)
    Hoboken, NJ : Wiley
    Details Availability
    Call number: IASS 17.91239
    Type of Medium: Monograph available for loan
    Pages: X, 326 S. , zahlr. Ill., graph. Darst. , 24 cm
    ISBN: 9781118083468 (pbk.) , 9781118330241 (electronic) , 9781118330883 (electronic) , 9781118333068 (electronic) , 9781118392188 (electronic) , 9781118392195 (electronic)
    URL: http://www.gbv.de/dms/zbw/689317697.pdf
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 69
    Monograph available for loan
    Monograph available for loan
    Encyclopedia of power (2011)
    Los Angeles, Calif. [u.a.] : SAGE
    Details Availability
    Call number: IASS 17.91241
    Type of Medium: Monograph available for loan
    Pages: XXVI, 755 S. , graph. Darst.
    ISBN: 141292748X (hbk., cloth, acidfree paper) , 9781412927482 (hbk., cloth, acidfree paper)
    Series Statement: SAGE reference
    URL: http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=021110291&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 70
    Monograph available for loan
    Monograph available for loan
    Political power : the development of the field (2012)
    Opladen [u.a.] : Budrich Publ.
    Details Availability
    Call number: IASS 17.91240
    Description / Table of Contents: Although the concept of power is central to the study of politics, there is no agreement as to what exactly power is. Power is often viewed negatively, as domination, though it is also the case that power is created by people acting in concert, in which case it can have positive effects. Making sense of this puzzle is one of the aims of this book, which provides the reader with a clear and coherent way of understanding the various forms and manifestations of power, and it does so by bringing together the most important and influential perspectives on power within the political and social sciences.
    Type of Medium: Monograph available for loan
    Pages: 230 S. , graph. Darst.
    ISBN: 3866491050 (Pb.) , 9783866491052 (Pb.) , 9783866495169 (electronic; ebook)
    Series Statement: The World of political science - The development of the discipline
    URL: Inhaltstext
    URL: http://d-nb.info/1018254188/04
    Language: English
    Note: Introduction / Mark Haugaard and Kevin Ryan -- Power in social and political theory / Mark Haugaard and Kevin Ryan -- Power in political anthropology / John Gledhill -- Foundations of organizational power / Stewart Clegg -- Gendering power : feminist approaches / Jill Vickers -- The political sociology of power / John A. Hall and Siniša Malešević -- Power and international relations / Phillip G. Cerny -- Concluding reflections / Kevin Ryan and Mark Haugaard..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 71
    Monograph available for loan
    Monograph available for loan
    The Sage handbook of power (2013)
    Los Angeles : SAGE
    Details Availability
    Call number: IASS 17.91242
    Type of Medium: Monograph available for loan
    Pages: xii, 484 Seiten , 25 cm
    Edition: First paperback edition
    ISBN: 9781446270455 , 9781412934008
    URL: http://www.gbv.de/dms/bowker/toc/9781412934008.pdf
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 72
    Monograph available for loan
    Monograph available for loan
    Wetter und Klima in Deutschland : ein meteorologisches Jahreszeitenbuch mit aktuellen Wetterthemen ; mit 25 Tabellen (1986)
    Stuttgart : Hirzel
    Details Availability
    Call number: MOP 46671
    Type of Medium: Monograph available for loan
    Pages: 152 S. , Ill., graph. Darst.
    Edition: 2., um das Kap. "Wetter-Stress und heilendes Klima" erw. Aufl.
    ISBN: 3777604267
    Language: German
    Note: Vorwort 5 --- Teil 1. Das „Monatsklima" in Deutschland --- Einführung . 11 --- Das Wetter im Januar 13 --- Das Wetter im Februar . 19 --- Das Wetter im März 24 --- Das Wetter im April 28 --- Das Wetter im Mai 32 --- Das Wetter im Juni 37 --- Das Wetter im Juli 41 --- Das Wetter im August 46 --- Das Wetter im September 50 --- Das Wetter im Oktober 54 --- Das Wetter im November 58 --- Das Wetter im Dezember . . . .- 62 --- Teil 2. Aktuelle Wetterthemen --- Zwölf Luftmassen gestalten das Wetter in Deutschland 69 --- Mitteleuropäische Großwetterlagen, ihre Struktur und Auswirkung 77 --- Die schmutzige Atmosphäre - ein Problem unserer Zeit 87 --- Die Sonnenflecken und ihre Beziehung zum Wetter 91 --- Vorhersage von nassen und trockenen Sommern 97 --- Strenge Winter - heiße Sommer 100 --- Wetterfühligkeit und was man dagegen tun kann 105 --- Das biologische Klima der deutschen Landschaften 107 --- Wetter-Streß und heilendes Klima 110 --- Der Mond und das Wetter 114 --- Rund um den „Hundertjährigen Kalender" 118 --- Alte und neue Wetterregeln 121 --- Teil 3. Das Klima von Deutschland in Zahlen --- Der Wandel der Temperaturverhältnisse in Mitteleuropa im 20. Jahrhundert 125 --- Der Wandel der Niederschlagsverhältnisse in Deutschland im 20. Jahrhundert 131 --- Die Temperaturverhältnisse in acht deutschen Großstädten . . . 136 --- Die Niederschlagsverhältnisse in acht deutschen Großstädten . . . 136 --- Die Temperaturverhältnisse in Deutschland 137 --- Die Niederschlagsverhältnisse in Deutschland . . . 139 --- Die Datumsgrenzen von Frost und Schneefall in Deutschland . . . 141 --- Die wärmsten und kältesten Monate und Jahreszeiten in Mitteleuropa 143 --- Extreme Niederschlagswerte in Deutschland zwischen 1851 und 1980 144 --- Die Temperaturverhältnisse auf Mitteleuropas Bergen 145 --- Die Niederschlagsverhältnisse im mitteleuropäischen Bergland . . 145 --- Die Sonnenscheindauer in acht deutschen Großstädten 146 --- Die Sonnenscheinverhältnisse auf Mitteleuropas Bergen 147 --- Die Schneehöhen in den Alpen 148 --- Zehnjahres-Mittelwerte von Temperatur und Niederschlag 148 --- Sonnenaufgangszeiten in sechs deutschen Großstädten 149 --- Sonnenuntergangszeiten in sechs deutschen Großstädten 150 --- Literaturverzeichnis 151
    Location: MOP - must be ordered
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 73
    Series available for loan
    Series available for loan
    SCAR Working Group on Biology : meeting at Hobart, Tasmania, 5-9 September 1988 (1989)
    Cambridge : SCAR
    Associated volumes
    Details Availability
    Call number: ZSP-708-5
    In: SCAR report, No. 5
    Type of Medium: Series available for loan
    Pages: 46 S.
    Series Statement: SCAR report 5
    URL: https://www.scar.org/library/scar-reports-and-bulletins/scar-reports/4178-scar-report-5/file
    Language: English
    Note: Enth. auch: SCAR Group of Specialists on Southern Ocean Ecology : meeting at Hobart, Tasmania, 3-5 September 1988. - SCAR Working Group on Geology : meetings at Hobart, Tasmania, 5 and 9 September 1988. - SCAR Working Group on Solid Earth Geophysics : meetings at Hobart, Tasmania, 5 and 9 September 1988. - SCAR Working Groups on Geology and Solid Earth Geophysics : joint meeting at Hobart, Tasmania, 5-8 September 1988. - SCAR Working Group on Logistics and Managers of National Antarctic Programmes : meeting at Hobart, Tasmania 5-9 September 1988.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 74
    Monograph available for loan
    Monograph available for loan
    Planetary magnetism (2010)
    New York, NY [u.a.] : Springer
    Associated volumes
    Details Availability
    Call number: 5/M 18.91371
    In: Space science series of ISSI
    Type of Medium: Monograph available for loan
    Pages: 664 Seiten , Ill., graph. Darst., Kt. , 235 mm x 155 mm
    ISBN: 9781441959003
    Series Statement: Space Sciences Series of ISSI 33
    URL: Inhaltsverzeichnis
    Classification:
    Geomagnetism, Geoelectromagnetism
    Language: English
    Note: Planetary magnetism : foreword / A. Balogh ... [et al.] -- Space exploration of planetary magnetism / N.F. Ness -- Planetary magnetic field measurements : missions and instrumentation / A. Balogh -- Current systems in planetary magnetospheres and ionospheres / W. Baumjohann ... [et al.] -- Separation of the magnetic field into external and internal parts / N. Olsen, K.-H. Glassmeir, X. Jia -- The magnetic field of planet Earth / G. Hulot ... [et al.] -- Crustal magnetic fields of terrestrial planets / B. Langlais ... [et al.] -- Magnetic fields of the outer planets / C.T. Russell, M.K. Dougherty -- Magnetic fields of the satellites of Jupiter and Saturn / X. Jia ... [et al.] -- The magnetic field of mercury / B.J. Anderson ... [et al.] -- Paleomagnetic records of meteorites and early planetesimal differentiation / B.P. Weiss ... [et al.] -- Induced magnetic fields in solar system bodies / J. Saur, f.M. Neubauer, K.-H. Glassmeier -- The interior structure, composition, and evolution of giant planets / J.J. Fortney, N. Nettelmann -- Thermal evolution and magnetic field generation in terrestrial planets and satellites / D. Breuer, S. Labrosse, T. Spohn -- Theory and modeling of planetary dynamos / J. Wicht, A. Tilgner -- Laboratory dynamo experiments / G. Verhille ... [et al.] -- Dynamo scaling laws and applications to the planets / U.R. Christensen -- The solar dynamo / C.A. Jones, M.J. Thompson, S.M. Tobias -- Dynamo models for planets other than Earth / S. Stanley, G.A. Glatzmaier -- Planetary magnetic fields : achievements and prospects / D.J. Stevenson..
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 75
    Monograph available for loan
    Monograph available for loan
    Klimadaten der DDR : ein Handbuch für die Praxis; Bd. 8,1, Niederschlag : Niederschlagshöhen in Zeitintervallen ≧ 1 Tag ; [F/E-Abschlussbericht] (1988)
    Berlin : Meteorologischer Dienst der DDR, FIH
    Details Availability
    Call number: MOP 47214 / Mitte
    Type of Medium: Monograph available for loan
    Pages: 52 S.
    Series Statement: Klimadaten der Deutschen Demokratischen Republik : Reihe B 8,1
    Language: German
    Location: MOP - must be ordered
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 76
    Monograph available for loan
    Monograph available for loan
    Klimadaten der DDR : ein Handbuch für die Praxis; Bd. 8, Niederschlag ; [F/E-Bericht] (1986)
    [s.l.] : FIH
    Details Availability
    Call number: MOP 46649
    Type of Medium: Monograph available for loan
    Pages: div. S.
    Series Statement: Klimadaten der Deutschen Demokratischen Republik : Reihe B 8
    Language: German
    Location: MOP - must be ordered
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 77
    Non-book medium
    Non-book medium
    DIN EN ISO 50001: Energiemanagementsysteme : Anforderungen mit Anleitung zur Anwendung (ISO 50001:2011); Deutsche Fassung EN ISO 50001:2011 (2011)
    Beuth
    Details
    Call number: ISO 50001
    Type of Medium: Non-book medium
    Pages: Online Ressource
    Series Statement: ISO 50001:2011
    URL: http://bib.gfz-potsdam.de/intern/pubint/1855053.pdf
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 78
    Monograph available for loan
    Monograph available for loan
    WAS IST WAS Vulkane : Feuer aus der Tiefe (2013)
    Nürnberg : Tessloff Verlag Ragnar Tessloff GmbH & Co. KG
    Details Availability
    Call number: 22/M 18.91648
    Description / Table of Contents: Es gibt mehr als 1.500 Vulkane auf der Erde, die in den letzten 10.000 Jahren aktiv waren. Etwa 500 davon sind in historischer Zeit, also seit die Menschen von Ereignissen berichten, mindestens einmal ausgebrochen. Wie entsteht Vulkanismus? Ist er nur gefährlich oder auch nützlich? Wo befinden sich die berüchtigsten Vulkane? Wie arbeiten Vulkanologen?
    Type of Medium: Monograph available for loan
    Pages: 48 Seiten , Mit vielen Fotos, Illustrationen und Infografiken , 28 cm
    ISBN: 978-3-7886-2044-8
    Series Statement: Was ist Was Band 57
    URL: Inhaltsverzeichnis
    Language: German
    Location: Reading room/gallery
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 79
    Monograph available for loan
    Monograph available for loan
    Monitoring Atmospheric Water Vapour : Ground-Based Remote Sensing and In-situ Methods (2013)
    New York, NY : Springer
    Details Availability
    Call number: M 18.91660
    Description / Table of Contents: Atmospheric water plays a key role in climate. Water vapour is the most important greenhouse gas and its condensed forms exert a profound influence on both incoming solar and outgoing infrared radiation. Unfortunately, accurate, height-resolved global-scale measurements of atmospheric humidity are difficult to obtain. The change in concentration of five orders of magnitude form the ground to the stratosphere means there is no standard instrument that will measure everywhere. This has led to different measuring techniques, all with strengths and weaknesses. This book assesses all presently available techniques that are used in monitoring networks. Special weight is given to presenting the different technical concepts, the accuracy of different sensor types, addresses calibration issues and retrieval aspects.
    Type of Medium: Monograph available for loan
    Edition: Online-Ausg. 2011 Springer eBook Collection. Earth and Environmental Science Electronic reproduction; Available via World Wide Web
    ISBN: 9781489997050
    Series Statement: ISSI Scientific Report Series 10
    DOI: 10.1007/978-1-4614-3909-7
    Language: English
    Note: Preface; Contents; Chapter 1 Introduction; 1.1 Importance of Water Vapour; 1.1.1 Stratospheric and Mesospheric Water Vapour; 1.1.2 Tropospheric Humidity; 1.1.3 Observations; 1.2 Aim and Structure the Book; References; Part I In Situ Sensors; Chapter 2 Thin Film Capacitive Sensors; 2.1 Introduction: Principle of Operation; 2.2 Radiosondes; 2.2.1 Introduction; 2.2.2 RS80 Radiosonde; 2.2.3 RS90 Radiosonde; 2.2.4 RS92 Radiosonde; 2.2.5 Summary; 2.3 Humidity Monitoring from Aboard Commercial Aircraft: MOZAIC-Program; 2.3.1 Introduction to MOZAIC-Program; 2.3.2 MOZAIC Humidity Device (MHD). , 2.3.3 Pre- and Post-Flight Calibration in Environmental Simulation Chamber2.3.4 Assessment of In-Flight Uncertainties; 2.3.5 In-Flight Comparison of MHD With Other Hygrometer: Time Response and Spatial Resolution; 2.3.6 Performance at High Relative Humidities: Ice Super Saturation; 2.3.7 New Developments: In-Flight Calibration Method; 2.3.8 Summary and Conclusions; References; Chapter 3 Balloon-Borne Frostpoint-Hygrometry; 3.1 Introduction; 3.2 Fundamental Principle; 3.3 The Optical Detector; 3.4 The Surface Acoustic Wave Detector; 3.5 The Feedback Controller; 3.6 Mirror Temperature Control. , 3.6.1 Peltier Cooler3.6.2 Cryogenic Cooling; 3.7 Airflow; 3.8 Artifacts of Frostpoint Hygrometers; 3.8.1 Controller Tuning; 3.8.2 Air Temperature Variations; 3.8.3 Liquid/Ice Ambiguity; 3.8.4 Cloud Influences; 3.8.5 Radio Frequency Interference; 3.9 Time Response; 3.10 Specific Instrument Implementations; 3.10.1 The Naval Research Laboratory Frostpoint Hygrometer; 3.10.2 NOAA Frostpoint Hygrometer; 3.10.3 CFH; 3.10.4 Snow White; 3.10.5 The LMD-CNRS Frost Point Hygrometers; 3.10.6 Surface Acoustic Wave Hygrometers; 3.10.7 Others; References. , Chapter 4 Application of Fluorescence Methodfor Measurements ofWater Vapourin the Atmosphere4.1 Method Description; 4.2 Fluorescence Lyman- Hygrometers; 4.2.1 The NOAA Fluorescence Lyman-alpha Hygrometers; 4.2.2 The Harvard Fluorescence Lyman-alpha Hygrometers; 4.2.3 The Jülich Fluorescence Lyman-bold0mu mumu Raw Hygrometers (FISH); 4.2.4 The CAO Fluorescence Lyman- Hygrometers (FLASH); 4.3 The FLASH-B Instrument; 4.3.1 Instrumental Layout; 4.3.2 FLASH-B Calibration; 4.3.3 FLASH-B Operational Layout; 4.4 FLASH-B Performance: Comparison with Other Sensors. , 4.5 Water Vapour Observations Using FLASH-B4.6 Summary and Conclusions; References; Part II Remote Sensing Sensors; Chapter 5 Microwave Radiometry; 5.1 Introduction; 5.2 Spectroscopy and Forward Modeling; 5.3 Technical Aspects; 5.3.1 Receivers; 5.3.2 Optics; 5.3.3 Spectrometers; 5.3.3.1 Filterbanks with Discrete Elements; 5.3.3.2 Acousto Optical Spectrometers, AOS; 5.3.3.3 Chirp Transform Spectrometers, CTS; 5.3.3.4 Digital FFT Spectrometers; 5.3.4 Calibration; 5.3.4.1 Total Power Measurements; 5.3.4.2 Balancing Measurements; 5.3.4.3 Sky as Cold Calibration Target. , 5.3.4.4 Determination of the Opacity from Tipping Curve Measurements.
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 80
    Monograph available for loan
    Monograph available for loan
    Nano Risiko Governance : der gesellschaftliche Umgang mit Nanotechnologien (2014)
    Wien [u.a.] : Springer
    Details Availability
    Call number: IASS 18.91689
    Type of Medium: Monograph available for loan
    Pages: VIII, 346 S. , Ill., graph. Darst., Tab. , 235 mm x 155 mm
    ISBN: 3709114047 (Gb.) , 9783709114049 (Gb.) , 9783709114056 (electronic; eBook)
    URL: Inhaltstext
    URL: http://d-nb.info/1038371538/04
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 81
    Monograph available for loan
    Monograph available for loan
    Resilient cities 2 : cities and adaptation to climate change ; proceedings of the Global Forum 2011 (2012)
    Dordrecht : Springer
    Details Availability
    Call number: PIK N 531-18-91762
    Type of Medium: Monograph available for loan
    Pages: XLIX, 436 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9789400742222 , 9789400742239 (electronic; eBook)
    Series Statement: Local sustainability 2
    URL: https://link.springer.com/content/pdf/10.1007%2F978-94-007-4223-9.pdf
    Language: English
    Note: Contents: Part 1: Introduction ; The Global Adaptation Community Expands Its Scope ; Part 2: Urban Risk and Assessing Vulnerability at the Local Level ; Introduction: Urban Risk and Assessing Vulnerability at the Local Level ; A Region at Risk: Policy Determination Through Vulnerability Hotspot Assessment ; Developing a Framework for Assessing Coastal Vulnerability to Sea Level Rise in Southern New England, USA ; Quantifying Impacts of Potential Sea-Level Rise Scenarios on Irish Coastal Cities ; Mapping Risk and Vulnerability in São Paulo Metropolitan Region ; Water Crisis: Public Management of a Critical Situation ; Environmental Assessment and Restoration of Typhoon Morakot Disaster: A Case Study in Kaohsiung, Chinese Taipei ; Flood Risk Protection Concept for the Urban Region Geising/Altenberg in the Flood Formation Area of the Eastern Ore Mountains, Germany ; Part 3: Toward the Resilient City ; Introduction: Toward the Resilient City ; Water, Energy and Food Security in Mexico City ; Nature at the Heart of Urban Design for Resilience ; Smart City: Energy Efficiency in a New Scope ; Resilient Food Systems for Resilient Cities ; Urban Agriculture Casablanca ; Adapting Cities to Climate Change: Scenarios for Urban Neighbourhoods in the City of Essen ; Combining Urban Development with Climate Change Adaptation Using a Systems Approach ; Towards Resilient Architecture ; Towards More Resilient Water Infrastructures ; Building ‘Equitable’ Urban Resilience: The Challenge for Cities ; Climate Change and the Urban Poor: Support of the German Development Cooperation to a City in Bangladesh ; The Green Infrastructure Transect: An Organizational Framework for Mainstreaming Adaptation Planning Policies ; Part 4: Frameworks for Local Response to Climate Change: Challenges and Recommendations ; Introduction: Framework for Local Responses to Climate Change: Challenges and Recommendations ; Building Resilience in Asian Cities ; A Science-Policy Approach Towards Local Adaptation Planning: The Case of Santiago de Chile ; Participatory Action Adaptation: Tools for Increasing Climate Change Capacity and Preparedness at the Local Government Level ; Knowledge and Information for Resilient Cities ; Climate Change Guidelines for Urban Planning in the Basque Country ; Integrated Roadmapping to Shape Adaptation Processes in Metropolitan Areas ; The Significance of Adaptation Framing in Local and Regional Climate Change Adaptation Initiatives in Australia ; Decision-Making Frameworks for Adaptation to Extremes in Two Local Government Areas: Comparing and Contrasting India and Australia ; Urban Climate Governance in the Philippines, Mexico and South Africa: National- and State-Level Laws and Policies ; Space for Adapting: Reconciling Adaptation and Mitigation in Local Climate Change Plans ; The Early Experiences of Local Climate Change Adaptation in Norway Compared with That of Local Agenda 21 ; Climate Change Adaptation Plan of Vitoria-Gasteiz, Spain ; Integrated Climate Action: Linking Mitigation and Adaptation to Make Indonesian Cities Resilient ; Enhancing the Climate Change Adaptation Capabilities of Local Governments in Korea: Supporting Programs for Local Adaptation Plan ; Reality Check: Ho Chi Minh City, Vietnam ; Part 5: Financing the Resilient City ; Introduction: Financing the Resilient City ; A Demand-Driven Approach to Development, Disaster Risk Reduction, and Climate Adaptation ; Smarter Interventions in an Age of Uncertainty ; Linking Resilience and Green Growth: How Green Business Can Contribute to More Resilient Cities in India ; Green Areas Inner-City Agreement (GAIA): How Local Enterprises Can Contribute to Local Adaptation to Climate Change ; Financing Climate Change Adaptation: The Copenhagen Case ; Challenges on the Way to Financing Urban Climate Change Adaptation
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 82
    Monograph available for loan
    Monograph available for loan
    Conservation on the high seas : harmonizing international regimes for the sustainable use of living resources (2012)
    Cheltenham [u.a.] : Elgar
    Details Availability
    Call number: IASS 18.91779
    Type of Medium: Monograph available for loan
    Pages: XIX, 313 S.
    ISBN: 9780857935632
    Series Statement: New horizons in environmental and energy law
    URL: https://www.e-elgar.com/shop/conservation-on-the-high-seas
    URL: http://www.gbv.de/dms/spk/sbb/toc/721539971.pdf
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 83
    Monograph available for loan
    Monograph available for loan
    Im Banne der Arktis : aus dem Leben des norwegischen Polarforschers Fridtjof Nansen (1989)
    Halle : VEB Postreiter-Verlag
    Details Availability
    Call number: AWI E1-18-91884
    Description / Table of Contents: Am 2. Mai 1888 bricht Fridtjof Nansen mit fünf Kameraden auf, Grönland zu durchqueren. Dieser Expedition stehen mehr als 90 Tage in Eis und Schnee bevor ... Am 24. Juni 1893 fährt die "Fram" in arktische Gewässer. Das Schiff soll im Eis eingeschlossen über den Nordpol driften. Geleitet wird dieses Unternehmen von Fridtjof Nansen. Wer war dieser Mann? Was reizte ihn an der unwirtlichen Welt nördlich des Polarkreises?
    Type of Medium: Monograph available for loan
    Pages: 173 Seiten , Illustrationen , 21 cm
    Edition: 1. Auflage
    ISBN: 3742102850 (Pp.)
    Language: German
    Note: Inhaltsverzeichnis: 1 Store Fröen - eine Kindheit am Rand der dunklen Wälder. - 2 Kristiania, Schule und Examen - aber was danach?. - 3 Mit der "Viking" an die Küste des Märchenlandes. - 4 Die Bergener Jahre, Studium und Träume - und der Alte sagt doch ja. - 5 Auf Schneeschuhen durch Grönland - sechs Männer bezwingen die Eiswüste. - 6 Eine Frau fürs Leben - und der Pol lockt. - 7 Ein Schiff wird zur Heimat - mit der "Fram" ins Niemandsland. - 8 In Nacht und Eis - ein Forschungsprogramm, wie es noch keines gab. - 9 Aufbruch zum Pol und der Kampf ums Überleben. - 10 Stürmische Jahre - Weiterleben gegen die Schläge des Schicksals. - Zeittafel zur Biografie Fridtjof Nansens. - Worterklärungen. - Literatur.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 84
    facet.materialart.12
    Amtssprache : historisch-kritische Hinweise auf Ärgernisse durch Recht und Verwaltung in Deutschland ; Forschungsarbeit (1985)
    [s.l.] : GRIN Verlag
    Details
    Call number: 9783638376723 (ebook)
    Type of Medium: 12
    Pages: 1 Online Ressource (13 Seiten)
    ISBN: 9783638376723
    URL: http://bib.gfz-potsdam.de/intern/pubint/91893.pdf
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 85
    Monograph available for loan
    Monograph available for loan
    SOS aus dem Eis (1989)
    Berlin : Verlag Neues Leben
    Details Availability
    Call number: AWI E2-18-91899
    Type of Medium: Monograph available for loan
    Pages: 32 Seiten , Illustrationen , 20 cm
    ISBN: 3355009172 (geh.)
    Series Statement: Das neue Abenteuer 509
    Language: German
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 86
    Monograph available for loan
    Monograph available for loan
    Oxford handbook of climate change and society (2013)
    Oxford [u.a.] : Oxford Univ. Press
    Details Availability
    Call number: IASS 19.92041
    Type of Medium: Monograph available for loan
    Pages: XIV, 727 Seiten , Illustrationen, Diagramme, Karten , 25 cm
    Edition: 1. published in paperback
    ISBN: 9780199683420 (pbk.)
    URL: http://www.gbv.de/dms/sub-hamburg/666051224.pdf
    URL: Autorenbiografie
    URL: Verlagsangaben
    Language: English
    Note: Pt. 1. Introduction -- pt. 2. The challenge and its history -- pt. 3. Science, society, and public opinion -- pt. 4. Social impacts -- pt. 5. Security -- pt. 6. Justice -- pt. 7. Publics and movements -- pt. 8. Government responses -- pt. 9. Policy instruments -- pt. 10. Producers and consumers -- pt. 11. Global governance -- pt. 12. Reconstruction..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 87
    Series available for loan
    Series available for loan
    FR Germany Antarctic Research Report to SCAR : I. Past Activities (Oct. 1988 - March 1989) ; II. Planned activities (April 1989 - March 1990) (1989)
    Bremerhaven : National Commitee on Antarctic Research
    Associated volumes
    Details Availability
    Call number: ZSP-SCAR-570-11
    In: National Antarctic Research Report to SCAR, No. 11
    Type of Medium: Series available for loan
    Pages: 55 Seiten , Illustrationen
    ISSN: 0179-0072
    Series Statement: National Antarctic Research Report to SCAR 11
    Language: English
    Note: CONTENTS: I. National Committee for Antarctic Research, and National Operating Organization/Agency. - II. Map of Stations. - Ill. Permanent Observatories, Regular Observations and Long-term Monitoring. - IV. Report on Highlights of Science Activities from Previous Reporting Period (1 Oct. 88 - 31 March 89). - A. Biology. - B. Geodesy & Geographic Information. - C. Geology. - D. Solid Earth Geophysics. - E. Glaciology. - F. Human Biology & Medicine. - G Atmospheric Sciences. - H. Logistics. - I. Ocean Physical Sciences. - V. List of Permits and Rationale for Entry into SPAs and SSSIs. - VI. Prospectus of Planned Activities for Coming Reporting Period (1 April 89 - 31 March 90). - A. Biology. - B. Geodesy & Geographic Information. - C. Geology. - D. Solid Earth Geophysics. - E. Glaciology. - F. Human Biology & Medicine. - G. Atmospheric Sciences. - H. Logistics. - I. Ocean Physical Sciences. - VII. Future Activities Planned & Funded (beyond 31 March 90). - VIII. Bibliography. - IX. List of Principal Investigators and Responsible Authorities. - X. Summary Listing of Projects.
    Location: AWI Archive
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 88
    Series available for loan
    Series available for loan
    National Antarctic Research Report to SCAR : I. Record of activities (past and ongoing) April 1987 - October 1988 ; II. Planned activities October 1988 - October 1989 (1988)
    Bremerhaven : Federal Republic of Germany, National Commitee on Antarctic Research
    Associated volumes
    Details Availability
    Call number: ZSP-SCAR-570-10
    In: National Antarctic Research Report to SCAR, 10
    Type of Medium: Series available for loan
    Pages: 61 Seiten
    ISSN: 0179-0072
    Series Statement: National Antarctic Research Report to SCAR 10
    Language: English
    Note: Contents: Membership of the National Committee on Antarctic Research in the Federal Republic of Germany. - Members of Permanent Working Groups and Groups of Specialists of SCAR. - Introduction. - Stations. - I. Record of Activities (past and ongoing), April 1987 - October 1988. - II. Planned Activities, October 1988 - October 1989. - References. - Addenda to Former Reports. - Index of Activities.
    Location: AWI Archive
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 89
    facet.materialart.12
    Understanding Earth (2014)
    New York, Basingstoke : Freeman
    Details
    Call number: 9781464138744
    Type of Medium: 12
    Pages: 1 Online-Ressource (755 Seiten) , Illustrationen, Diagramme, Karten
    Edition: 7th edition
    ISBN: 978-1-4641-3874-4 , 1-4641-3874-5
    URL: http://bib.gfz-potsdam.de/intern/pubint/understanding-earth-grotzinger-and-jordan.pdf
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 90
    Monograph available for loan
    Monograph available for loan
    Interpreting international politics (2014)
    New York : Routledge
    Details Availability
    Call number: IASS 19.91996
    Description / Table of Contents: "Interpretive approaches to the study of international relations span not only the traditional areas of security, international political economy, and international law and organizations, but also emerging and newer areas such as gender, race, religion, secularism, and continuing issues of globalization. But how are we to bring interpretivist methods and concerns to bear on these topics? Cecelia Lynch focuses on the philosophy of science and conceptual issues that make work in international relations distinctly interpretive. This work both legitimizes and demonstrates the necessity of post- and non-positivist scholarship. Lynch address each of the major, "traditional," subfields in International Relations, including International Law and Organization, International Security, and International Political Economy, situating, describing, and analyzing major interpretive works in each of these fields to draw out critical research challenges posed and progress in the field made by interpretive work. Furthermore, the book also pushes forward interpretive insights to areas that have entered the IR radar screen more recently, including race and religion, demonstrating how work in these areas can inform all subfields of the discipline and suggesting paths for future research"--
    Type of Medium: Monograph available for loan
    Pages: X, 114 Seiten
    ISBN: 0415896908 , 9780415896900 , 0415896916 , 9780415896917 , 9780203801086 (electronic)
    Series Statement: Routledge series on interpretive methods
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 91
    Monograph available for loan
    Monograph available for loan
    Bayerische Gletscher im Klimawandel : ein Statusbericht (2012)
    München : StMUG
    Details Availability
    Call number: AWI G7-19-92167
    Type of Medium: Monograph available for loan
    Pages: 34 Seiten , Illustrationen
    Edition: Stand: Juni 2012
    URL: https://geo.badw.de/fileadmin/user_upload/Files/GLAZ/pdf/Bayerische_Gletscher_im_Klimawandel_2012.pdf
    Language: German
    Note: Inhaltsverzeichnis: Vorwort. - 1. Gletscherrückgang – eine dramatische Folgereaktion des Klimawandels in den Alpen. - 2. Methoden der Gletscherforschung. - 3. Einflussfaktoren auf die Entwicklung von Gletschern in den Alpen. - 4. Bedeutung der Alpengletscher im Wasserkreislauf. - 5. Gletscher in Bayern heute – eine Bestandsaufnahme. - Nördlicher Schneeferner. - Südlicher Schneeferner. - Höllentalferner. - Watzmanngletscher. - Blaueis. - 6. Entwicklung der Gletscher in Bayern. - Historische Aufzeichnungen seit dem 18. Jahrhundert. - Systematische Erfassung der bayerischen Gletscher ab 1950. - Ausblick in die Zukunft der bayerischen Gletscher. - 7. Ein Blick nach Europa: Haben die Gletscher der Alpen eine Zukunft?. - Alpengletscher im Überblick. - Schweizer Alpengletscher. - Österreichische Alpengletscher. - Zusammenfassung. - Glossar. - Fachliteratur und Quellen. - Allgemeine Literatur zum Thema Gletscher. - Internetquellen. - Impressum.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 92
    Monograph available for loan
    Monograph available for loan
    Diatom taxonomy and ecology : from local discoveries to global impacts ; Festschrift in honor of Prof. Dr. Horst Lange-Bertalot's 75th birthday (2012)
    Stuttgart : Cramer
    Associated volumes
    Details Availability
    Call number: AWI Bio-19-92456
    In: Nova Hedwigia / Beiheft, 144
    Type of Medium: Monograph available for loan
    Pages: IV, 545 Seiten , Illustrationen
    ISBN: 9783443510633
    Series Statement: Nova Hedwigia / Beiheft 141
    URL: Table of Contents
    URL: Inhaltstext
    Language: English
    Note: Contents Preface Curriculum Vitae List of Publications by Horst Lange-Bertalot Bahls, L.: Seven new species in Navicula sensu stricto from the Northern Great Plains and Northern Rocky Mountains. Blanco, S., B. Van de Vijver, A. Vinocur, G. Mataloni, J. Goma, M. H. Novais & L. Ector: Hippodonta lange-bertalotii Van de Vijver, Mataloni & Vinocur sp. nov. and related small-celled Hippodonta taxa. Burliga, A. L. & J. P. Kociolek : Four new Eunotia Ehrenberg species (Bacillariophyceae) from pristine regions of Carajas National Forest, Amazonia, Brazil. Cantonati, M., M. Leira, N. Angeli & C. Lopez Rodriguez: Naviculadicta langebertcdotii sp. nov. (Bacillariophyta) from streams in Galicia (N-W Spain). Karthick, B., P. B. Hamilton & J. P. Kociolek: Taxonomy and biogeography of some Surirella Turpin (Bacillariophyceae) taxa from Peninsular India. Karthick, B. & Kociolek, J. P.: A new species of Pleurosigma from Western Ghats, South India. Metzeltin, D.: Eunotia langebertalotii, a new species from Lambir Hills National Park in Sarawak, tropical East Malaysia Monnier, O., L. Ector, F. Rimet, M. Ferreol & L. Hoffmann: Adlafia langebertalotii sp. nov. (Bacillariophyceae), a new diatom from the Grand-Duchy of Luxembourg morpho­logically similar to A. suchlandtii comb. nov. Morales, E. A., K. M. Manoylov & L. L. Bahls: Fragilariforma horstii sp. nov. (Ba­cillariophyceae) a new araphid species from the northern United States of America Reichardt, E.: Der Artenkomplex um Gomphonema occultum E. Reichardt & Lange-Bertalot (Bacillariophyceae): Variability und drei neue Arten Stachura-Suchoples, K.: On taxonomy of Pliocaenicus costatus species complex, varieties, demes or/and morphological variability? Trobajo, R., D. G. Mann & E. J. Cox: Studies on the type material of Nitzschia abbreviata (Bacillariophyta) Van de Vijver, B., B. Chattova, D. Metzeltin & M. Lebouvier: The genus Pinnularia (Bacillariophyta) on lie Amsterdam (TAAF, Southern Indian Ocean) Van de Vijver, B., A. Jarlman, M. de Haan & L. Ector: New and interesting diatom species (Bacillariophyceae) from Swedish rivers Williams, D. M.: Diatoma moniliforme: Commentary, relationships and an appropriate name Ake-Castillo, J. A., Y. B. Okolodkov, S. Espinosa-Matias, F. del C. Merino-Virgilio, J. A. Herrera-Silveira & L. Ector: Cyclotella marina (Tanimura, Nagumo et Kato) Ake-Castillo, Okolodkov et Ector comb, et stat. nov. (Thalassiosiraceae): a bloom-forming diatom in the southeastern Gulf of Mexico Belando, M. D., A. Marin & M. Aboal: Licmophora species from a Mediterranean hyper-saline coastal lagoon (Mar Menor, Murcia, SE Spain) Reid, G.: Toxonidea langebertalotii sp. nov. A new marine diatom from the Salvages Islands Riaux-Gobin, C., R Compere, A. Y. Al-Handal & F. Straub: SEM survey of some small-sized Planothidium (Bacillariophyta) from coral sands off Mascarenes. (Western Indian Ocean) Khursevich, G. & Kociolek, J. P.: A preliminary, worldwide inventory of the extinct, freshwater fossil diatoms from the orders Thalassiosirales, Stephanodiscales, Paraliales, Aulacoseirales, Melosirales, Coscindiscales, and Biddulphiales 315 Kulikovskiy, M. S., G. K. Khursevich & A. Witkowski: Encyonema horstii sp. nov., a species of unusual valve outline from the Pleistocene deposits of Lake Baikal Witkowski, J., D. M. Harwood & M. Kulikovskiy: Observations on Late Cretaceous ma­rine diatom resting spore genera Pseudoaulacodiscus and Archaegoniothecium gen. nov. Jasprica, N., M. Caric, F Krsinic, T. Kapetanovic, M. Batistic & J. Njire: Planktonic dia­toms and their environment in the lower Neretva River estuary (Eastern Adriatic Sea, NE Mediterranean) Solak, C. N., L. Ector, A. Z. Wojtal, E. Acs & E. A. Morales: A review of investigations on diatoms (Bacillariophyta) in Turkish inland waters Bak, M. & A. Szlauer-Lukaszewska: Bioindicative potential of diatoms and ostracods in the Odra mouth environment quality assessment Starrat, S. W.: Holocene diatom flora and climate history of Medicine Lake, Northern California, USA. Medlin, L., I. Yang & S. Sato: Evolution of the Diatoms. VII. Four gene Phylogeny as­sesses the validity of celected araphid genera Lang, I. & I. Kaczmarska: Morphological and molecular identity of diatom cells retrieved from ship ballast tanks destined for Vancouver, Canada Buczko, K.: The Pantocsek diatom and photomicrograph collectio n from 19th to 21th cen­tury
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 93
    Monograph available for loan
    Monograph available for loan
    Evolution of the Western Black sea : kinematic and sedimentological inferences from geological observations and analoque modelling (2012)
    Utrecht : [Utrecht University, Faculty of Geosciences, Department of Earth Sciences]
    Associated volumes
    Details Availability
    Call number: M 19.92464
    In: Utrecht studies in earth sciences, 016
    Type of Medium: Monograph available for loan
    Pages: 169 Seiten , Illustrationen
    ISBN: 9789062663002
    Series Statement: Utrecht studies in earth sciences 016
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 94
    Monograph available for loan
    Monograph available for loan
    Connections between sedimentary basins during continetal collision : How tectonic, surface and sedimentary processes shaped the Paratethys (2013)
    Utrecht : [Utrecht University, Faculty of Geosciences, Department of Earth Sciences]
    Associated volumes
    Details Availability
    Call number: M 19.92466
    In: Utrecht studies in earth sciences, 045
    Type of Medium: Monograph available for loan
    Pages: 204 Seiten , Illustrationen, Karten
    ISBN: 9789062663415
    Series Statement: Utrecht studies in earth sciences 045
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 95
    Monograph available for loan
    Monograph available for loan
    Aufbau-Bericht : 1980-1985 (1986)
    Bremerhaven : Alfred-Wegener-Institut für Polar- und Meeresforschung
    Details Availability
    Call number: ad ZSP-994(1980/1985)
    Type of Medium: Monograph available for loan
    Pages: 144 Seiten , Illustrationen
    Language: German
    Note: Inhalt 1. Einleitung 2. Der Institutsaufbau 2.1 Die Gründungsphase 2.2 Organisatorische Entwicklung und Personalaufbau 3. Die Provisorische Unterbringung und der Neubau 4. Zentrale Einrichtungen 4.1 Die Bibliothek 4.2 Das Rechenzentrum 4.3 Das Elektroniklabor 5. Logistik 5.1 Die Antarktisstationen 5.2 Das Forschungsschiff "Polarstern" 5.3 Hubschrauber und Flugzeuge 5.4 Die Schneefahrzeuge 6. Forschungsarbeiten 6.1 Die wissenschaftlichen Arbeitsrichtungen 6.1.1 Biologie 6.1.2 Geowissenschaften (Geophysik/Geologie) 6.1.3 Glaziologie 6.1.4 Physik des Ozeans und der Atmosphäre 6.2 Die Expeditionen 6.2.1 Die Expeditionen 1979/80 und 1980/81 zum Filchner und Ekström-Schelfeis 6.2.2 Unternehmen "Eiswarte" 1981/82 6.2.3 Die deutsch-britische Expedition mit RRS "John Biscoe" 1982 6.2.4 Die Antarktisunternehmen 1982/83 6.2.4.1 "Polarbjörn" und die geologische Traverse in die Kraulberge 6.2.4.2 Die Jungfernreise der "Polarstern" (ANT I) 6.2.5 Die Erprobungsfahrt der "Polarstern" in die Iberische Tiefsee, Mai 1983 6.2.6 Die Arktisexpedition 1983 (ARK I) mit dem Marginal Ice Zone Experiment (MIZEX) 6.2.7 Die Antarktisexpedition 1983/84 (ANT II) 6.2.8 Die Arktisexpedition 1984 CARK 111) 6.2.9 Die Antarktisexpedition 1985/86 (ANT III) 6.2.10 Die Arktisexpedition 1985 (ARK III) 6.2.11 Die Antarktisexpedition 1985/86 (ANT IV) 7. Kooperation und Koordination 7.1 Nationale Kooperation und Koordination innerhalb der Bundesrepublik 7.2 Internationale Zusammenarbeit 8. Öffentlichkeitsarbeit und Publikationen 9. Aus den Forschungsarbeiten 10. Anhang
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 96
    Monograph available for loan
    Monograph available for loan
    Zweijahresbericht 1986/87 (1988)
    Bremerhaven : Alfred-Wegener-Institut für Polar- und Meeresforschung
    Associated volumes
    Details Availability
    Call number: ZSP-994(1986/1987)
    In: Zweijahresbericht / Stiftung Alfred-Wegener-Institut für Polar- und Meeresforschung, [1]
    Type of Medium: Monograph available for loan
    Pages: 160 Seiten , Illustrationen
    Series Statement: Zweijahresbericht / Stiftung Alfred-Wegener-Institut für Polar- und Meeresforschung [1]
    URL: http://hdl.handle.net/10013/epic.40938.d001
    Language: German
    Note: Inhaltsverzeichnis 1. Einleitende Übersicht 2. Nationale und internationale Zusammenarbeit 3. Forschungsarbeiten 3.1 Expeditionen 3.1.1 ANT 1V/3 (mit Kottas-und Filchner-Expeditionen) 3.1.2 ANT IV/4 3.1.3 ANT V/1, 2, 3 Die erste Winter-Weddellmeer-Expedition 3.1.4 ANT V/4 3.1.5 ANT V/5 3.1.6 ARK IV 3.2 Forschungsarbeiten der Sektionen 3.2.1 Biologie I (Zoologie) 3.2.2 Biologie II (Botanik + Mikrobiologie) 3.2.3 Chemie 3.2.4 Geologie 3.2.5 Geophysik, Glaziologie 3.2.6 Meeresphysik und Meßwesen 3.2.7 Theoretische Physik des Ozeans und der Atmosphäre 3.2.8 Experimentelle Physik des Ozeans und der Atmosphäre 3.3 Aus den Forschungsarbeiten 4. Logistik 4.1 Antarktisstationen 4.2 FS "Polarstern" und FS "Victor Hensen" 4.3 Flugzeuge und Hubschrauber 4.4 Schneefahrzeuge 4.5 Hafenlager 5. Zentrale Einrichtungen 5.1 Öffentlichkeitsarbeit 5.2 Bibliothek 5.3 Rechenzentrum 5.4 Elektroniklabor 6. Personeller Aufbau des Instituts und Entwicklung des Institutshaushalts in den Jahren 1986 und 1987 6.1 Personal 6.2 Haushalt Anhang I Anhang II Anhang III Anhang IV Anhang V
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 97
    Series available for loan
    Series available for loan
    Eiszeitalter und Gegenwart; Vol. 67, No. 1-2 (2010)
    Göttingen : Copernicus
    Associated volumes
    Details Availability
    Call number: S 01.0495(67,1-2)
    In: Eiszeitalter und Gegenwart
    Type of Medium: Series available for loan
    Pages: 84 Seiten , Illustrationen, Diagramme, Karten , 21 x 29,7 cm
    ISSN: 0424-7116
    Series Statement: Eiszeitalter und Gegenwart Vol 67, No. 1-2
    URL: https://www.eg-quaternary-sci-j.net/67/
    Language: English
    Note: Editorial E&G Quaternary Science Journal, Vol. 67 (2018) Christopher Lüthgens and Margot Böse E&G Quaternary Sci. J., 67, 85-86, 2019. 〈a href="https://doi.org/10.5194/egqsj-67-85-2019" target="_blank"〉https://doi.org/10.5194/egqsj-67-85-2019〈/a〉 , Middle to Late Holocene mobilization of DOC-bound Pb and Y in the Magellanic moorlands (53° S) as a function of sea spray fertilization, climate variations and volcanic fallout? A preliminary report Björn Klaes, Rolf Kilian, Gerhard Wörner, Sören Thiele-Bruhn, and Helge W. Arz E&G Quaternary Sci. J., 67, 1-6, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-1-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-1-2018〈/a〉 , Capability of U–Pb dating of zircons from Quaternary tephra: Jemez Mountains, NM, and La Sal Mountains, UT, USA Jana Krautz, Mandy Hofmann, Andreas Gärtner, Ulf Linnemann, and Arno Kleber E&G Quaternary Sci. J., 67, 7-16, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-7-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-7-2018〈/a〉 , Reconsidering the origin of the Sedrun fans (Graubünden, Switzerland) Catharina Dieleman, Susan Ivy-Ochs, Kristina Hippe, Olivia Kronig, Florian Kober, and Marcus Christl E&G Quaternary Sci. J., 67, 17-23, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-17-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-17-2018〈/a〉 , Disestablishing “Glacial Lake Speight”, New Zealand? An example for the validity of detailed geomorphological assessment with the study of mountain glaciations Stefan Winkler, David Bell, Maree Hemmingsen, Kate Pedley, and Anna Schoch E&G Quaternary Sci. J., 67, 25-31, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-25-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-25-2018〈/a〉 , Proglacial streams and their chronology in the glacier forefields of the Himalayas Gerrit Tombrink E&G Quaternary Sci. J., 67, 33-36, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-33-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-33-2018〈/a〉 , Glacial history of the upper Drac Blanc catchment (Écrins massif, French Alps) Felix Martin Hofmann E&G Quaternary Sci. J., 67, 37-40, 2018. 〈a href="https://doi.org/10.5194/egqsj-67-37-2018" target="_blank"〉https://doi.org/10.5194/egqsj-67-37-2018〈/a〉 , New data from the Middle Palaeolithic Cotencher cave (Swiss Jura): site formation, environment, and chronology Judit Deák, Frank Preusser, Marie-Isabelle Cattin, Jean-Christophe Castel, and François-Xavier Chauvière E&G Quaternary Sci. J., 67, 41-72, 2019. 〈a href="https://doi.org/10.5194/egqsj-67-41-2019" target="_blank"〉https://doi.org/10.5194/egqsj-67-41-2019〈/a〉 , Fortification, mining, and charcoal production: landscape history at the abandoned medieval settlement of Hohenwalde at the Faule Pfütze (Saxony, Eastern Ore Mountains) Johann Friedrich Tolksdorf, Matthias Schubert, Frank Schröder, Libor Petr, Christoph Herbig, Petr Kočár, Mathias Bertuch, and Christiane Hemker E&G Quaternary Sci. J., 67, 73-84, 2019. 〈a href="https://doi.org/10.5194/egqsj-67-73-2019" target="_blank"〉https://doi.org/10.5194/egqsj-67-73-2019〈/a〉
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 98
    Monograph available for loan
    Monograph available for loan
    The logic of connective action : digital media and the personalization of contentious politics (2013)
    New York, NY : Cambridge University Press
    Details Availability
    Call number: IASS 19.92444
    Type of Medium: Monograph available for loan
    Pages: xiii, 240 Seiten , Illustrationen, Diagramme , 24 cm
    ISBN: 9781107642720 , 9781107025745
    Series Statement: Cambridge studies in contentious politics
    URL: http://www.gbv.de/dms/sub-hamburg/740080946.pdf
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 99
    Monograph available for loan
    Monograph available for loan
    Demokratie (2012)
    Köln : PapyRossa Verlag
    Details Availability
    Call number: IASS 19.92505
    Type of Medium: Monograph available for loan
    Pages: 131 Seiten , 180 mm x 112 mm
    ISBN: 9783894384876 (Pb.)
    Series Statement: Basiswissen Politik - Geschichte - Ökonomie
    URL: Inhaltstext
    URL: Inhaltsverzeichnis
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 100
    Monograph available for loan
    Monograph available for loan
    Linked : how everything is connected to everything else and what it means for Business, Science, and Everyday Life (2014)
    New York : Basic Books
    Details Availability
    Call number: M 19.92730 ; M 19.92730
    Description / Table of Contents: "Albert-Laszlo Barabasi, the nation's foremost expert in the new science of networks, takes us on an intellectual adventure to prove that social networks, corporations, and living organisms are more similar than previously thought. A full understanding of network science will someday enhance our ability to design blue-chip businesses, stop the outbreak of deadly diseases, and influence the exchange of ideas and information. Engaging and authoritative, Linked provides an exciting glimpse into the next century of science and an urgent new perspective on our interconnected world. Book jacket."--
    Type of Medium: Monograph available for loan
    Pages: 294 Seiten , Diagramme
    ISBN: 978-0-465-08573-6
    Classification:
    Mathematics
    Language: English
    Note: IntroductionThe random universe -- Six degrees of separation -- Small worlds -- Hubs and connectors -- The 80/20 rule -- Rich get richer -- Einstein's legacy -- Achilles' heel -- Viruses and fads -- The awakening Internet -- The fragmented web -- The map of life -- Network economy -- Web without a spider -- Afterlink: Hierarchies and communities..
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...