ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • German  (1,985)
  • Russian  (17)
  • Chinese  (3)
  • Finnish  (1)
  • Turkish
  • 2015-2019  (12)
  • 2010-2014  (2,006)
  • 2013  (384)
  • 2011  (901)
  • 2010  (744)
Collection
Language
Years
Year
  • 1
    Monograph available for loan
    Monograph available for loan
    Beijing : Seismological Press
    Call number: M 10.0305
    Type of Medium: Monograph available for loan
    Pages: 87 S.
    ISBN: 9787502836726
    Uniform Title: European Macroseismic Scale 1998
    Classification:
    Seismology
    Language: Chinese
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    Call number: AWI Bio-12-0024
    Description / Table of Contents: The book contains methodical overview of the main groups of biological indicators used in palaeoecology: pollen, diatoms, chironomids larvae, cladocera, ostracods, sponges, some other less widely used groups of invertebrates and a review on application of pedohumic method for palaeoecological reconstructions. Articles contain information on systematics, morphology, biology of the selected proxy groups and the modern approaches to palaeoclimatic reconstructions. Applicability of the biological indicators is illustrated by case studies from different regions: steppe Altay and Altay mountains, central and northern Yakutia, Northern Ural, west Siberia, lake Baikal, Tien Shan mountains, Middle Volga, etc. The book can be interesting for specialists in palaeoecology and students.
    Description / Table of Contents: В книге представлены методические обзоры по основным группам биологических индикаторов, применяемым в палеоэкологии: пыльца, диатомовые водоросли, личинки хирономид, ракообразные, остракоды, губки - и кратко охарактеризованы прочие группы беспозвоночных животных. В книгу также вошел обзор по применению педогумусового метода для палеоэкологических реконструкций. Обсуждаются современные подходы к использованию биологических индикаторов в качестве показателей палеоклиматических изменений и проблемные стороны проведения экологических и температурных реконструкций. Представлены примеры палеореконструкций, выполненных с применением различных индикаторных групп из различных регионов: Степной и Горный Алтай, Центральная и Северная Якутия, Северный Урал, Западная Сибирь, Байкал, Тянь-Шань, Среднее Поволжье и пр. Книга рассчитана на специалистов в области палеоэкологии и на студентов.
    Type of Medium: Monograph available for loan
    Pages: 278 Seiten , Illustrationen
    ISBN: 978-5-98180-934-7
    Language: Russian
    Note: СОДЕРЖАНИЕ Введение / (Л.Б. Назарова, Д.К. Нургалиев) Глава 1. Личинки хирономид (Diptera: Chironomidae) как индикаторы палеоклиматических изменений / (Л.Б. Назарова) Глава 2. Ветвистоусые ракообразные ( Cladocera Latreille, 1829, Branchiopoda, Crustacea) в палеоэкологических исследованиях / (Л.А. Фролова) Глава 3. Пресноводные остракоды и их применение в палеоэкологических исследованиях / (С . Веттерих, К. Зиrерт) Глава 4. Губки (Porifera, Spongia) в палеолимнолоrических исследованиях / (Е . Вейнберr) Глава 5. Водные беспозвоночные в палеолимнолоrии / (Л.Б . Назарова, О.Н. Туманов, Р.М. Сабиров) Глава 6. Палинологический анализ / (Н.А. Рудая) Глава 7. Использование метода диатомового анализа в палеолимнологических исследованиях / (О.В. Палагушкина, Л.А. Пестрякова) Глава 8. Диагностика и реконструкция палеоэкологических условий педогумусовым методом / (М.И. Дергачева) Заключение (Л.Б. Назарова, Д.К. Нургалиев) Литература Summary , In kyrillischer Schrift
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
    Monograph available for loan
    Monograph available for loan
    Bonn : Bundeszentrale für Politische Bildung
    Call number: IASS 12.0140
    Type of Medium: Monograph available for loan
    Pages: 350 S. : Ill. , Ill. , 238 mm x 145 mm
    Edition: Lizenzausg.
    ISBN: 9783838901428
    Series Statement: Schriftenreihe 1142
    Uniform Title: Dirt
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 4
    Monograph available for loan
    Monograph available for loan
    Heidelberg : Spektrum, Akad. Verl.
    Call number: PIK M 310-12-0105
    Description / Table of Contents: Contents: Teil 1 - Zum Auftakt ; Zweifelhafte Zahlen ; Allgemeine Hintergründe ; Teil 2 - Verschiedene Arten verdächtiger Daten ; Pfusch ; Quellen: Wer hat gezählt? Weshalb wurde gezählt? ; Definitionen: Was wurde gezählt? ; Kriterien: Wie wurde gezählt? ; Verpackung: Was wird uns gesagt? ; Debatten: Wenn Statistiken einander widersprechen ; Teil 3 - Allein im Datendschungel. Wie Sie fehlerhafte Statistiken im Alltag entlarven ; Zusammenfassung: Woran Sie verdächtige Daten erkennen ; Bessere Statistiken: Wie sie aussehen sollten ; Nachwort: Wenn Sie keine Ahnung davon hatten, dass die Dinge so schlecht stehen, stehen sie im Allgemeinen auch nicht so schlecht ; Anregungen für alle, die sich selbst detektivisch am Tatort Statistik betätigen wollen
    Type of Medium: Monograph available for loan
    Pages: IX, 157 S. : graph. Darst.
    ISBN: 9783827425232
    Series Statement: Spektrum Akademischer Verlag Sachbuch
    Uniform Title: Stat spotting
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    Monograph available for loan
    Monograph available for loan
    Sankt-Peterburg : Izdat. Karta
    Call number: AWI Atl-12-0059
    Description / Table of Contents: Contents: The Antarctic subglacial-submarine surface and its relief studies. - General geomorphological mapping of Antarctic. - Structural-morphometrical analysis of the Antarctic subglacial-submarine surface. - Morphotectonical investigations and mapping of the Antarctic. - Glaciomorphodynamical research. - Lithodynamical research of the Antarctic. - Investigation of the relief of the coastal zone of Antarctica. - Auxiliary part
    Type of Medium: Monograph available for loan
    Pages: 255 S. : Ill., zahlr. Kt.
    ISBN: 9785903819461
    Language: Russian
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    Call number: Z 06.0500
    Type of Medium: Journal available for loan
    Pages: 30 cm
    ISSN: 1824-7741
    Former Title: Vorgänger Geologisch-paläontologische Mitteilungen, Innsbruck
    Language: German , English
    Note: Ersch. unregelmäßig , Beiträge teilweise in Englisch
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Call number: PIK 16-89825
    Type of Medium: Monograph available for loan
    Pages: Getr. Zählung , Ill., graph. Darst.
    Edition: Online-Ausg. Berlin Humboldt-Universität zu Berlin, Universitätsbibliothek 2011 〈〈Nach einem Exemplar der Humboldt-Universität zu Berlin, Universitätsbibliothek mit der Signatur: 〉〉Diss Geo11 P134
    Language: German
    Note: Berlin, Humboldt-Univ., Diss., 2011
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Call number: AWI G3-16-90173
    In: Hamburger bodenkundliche Arbeiten ; 65, Bd. 65
    Type of Medium: Series available for loan
    Pages: XVI, 157 S. , Ill., graph. Darst., Kt.
    Series Statement: Hamburger bodenkundliche Arbeiten 65
    Language: German
    Note: Zugl.: Hamburg, Univ., FB Geowiss., Diss., 2011 , INHALT: Inhalt. - Zusammenfassung. - Abstract. - Abkürzungen. - Abbildungen. - Tabellen. - 1 Einleitung und Zielsetzung. - 2 Grundlagen. - 2.1 Die Bedeutung des Stickstoffkreislaufs. - 2.2 Die Nitrifikation - Ein Schlüsselprozess im Stickstoffkreislauf. - 2.2.1 Verbreitung Ammoniak oxidierender Bakterien. - 2.2.2 Verbreitung Ammoniak oxidierender Archaeen. - 2.2.3 Physiologie Ammoniak oxidierender Mikroorganismen. - 2.2.4 Bedeutung Ammoniak oxidierender Mikroorganismen. - 2.3 Psychrophile and psychrotolerante Bakterien. - 2.4 Grundlagen der methodischen Ansätze. - 2.4.1 Bodenklassifikation nach der US Soil Taxonomy. - 2.4.2 Charakterisierung der Ammoniak oxidierenden Mikroorganismen (AOM). - 2.4.3 Nachweis von nitrifizierenden Mikroorganismen. - 2.4.4 Denaturierende Gradienten Gelelektrophorese (DGGE). - 2.4.5 Fluoreszenz-in-situ-Hybridisierung (FISH) und Immunofluoreszenz (IF). - 2.4.6 Reverse Transkriptase RCR. - 3. Beschreibung der Untersuchungsgebiete. - 3.1. Untersuchungsgebiet im kalten Klimat – die Insel Samoylov im Lena-Delta. - 3.2. Untersuchungsgebiet im gemäßigten Klimat – Hahnheide bei Hamburg. - 4 Material und Methoden. - 4.1 Probenahme und bodenkundliche Standortaufnahme. - 4.2 Herkunft der verwendeten Anreicherungskulturen. - 4.3 Bodenchemische und -physikalische Laboruntersuchungen. - 4.4 Quantifizierung von gelösten Stickstoffverbindungen in Böden. - 4.4.1 Ammoniumbestimmungen. - 4.4.2 Nitrit- und Nitratbestimmung. - 4.4.3 Bestimmung der gelösten organischen Stickstoffverbindungen (DON). - 4.5 Nährmedien. - 4.6 Nachweis von mikrobiellen N-Umsetzungen in Böden. - 4.6.1 Bestimmung der potentiellen Nitrifikation. - 4.6.2 Bestimmung der potentiellen Mineralisationsaktivitäten. - 4.6.3 Bestimmungen der Temperaturoptima der Nitrifikation. - 4.6.4 Quantifizierung von nitrifizierenden Mikroorganismen mittels MPN. - 4.7 Kulturführungen von Anreicherungen und Reinkulturen. - 4.7.1. Anreicherung von Ammoniak oxidierenden Mikroorganismen (AOM). - 4.7.2. Kulturführung von Reinkulturen. - 4.7.3 Reinheitstest der Anreicherungs- und Reinkulturen. - 4.8 Mikroskopische Verfahren. - 4.9. Molekularbiologische Methoden. - 4.9.1 DNA Extraktion. - 4.9.2 Polymerasenkettenreaktion (PCR). - 4.9.3 Denaturierende Gradienten Gelelektrophorese (DGGE). - 4.9.4 RNA Isolation und Reverse Transkriptase (RT) PCR Anwendungen. - 4.9.5 Klonierung. - 4.9.6 Sequenzanalysen und Stammbäume. - 4.10 Statistische Verfahren. - 5. Ergebnisse. - 5.1. Bodenkundliche Charakterisierung der untersuchten Permafrostböden. - 5.1.1 Böden der Flussterrasse. - 5.1.2 Böden der jüngeren Überflutungsebene. - 5.1.3 Beschreibung des untersuchten Permafrostaufschlusses am Kliff. - 5.2 Bodenkundliche Charakterisierung der Vergleichsböden im gemäßigten Klimat. - 5.3 Gelöste anorganische Stickstoffverbindungen (DIN). - 5.3.1 DIN in den kalten Klimaten. - 5.3.2 DIN-Gehalte in den Böden der gemäßigten Klimaten. - 5.4. Mineralisation. - 5.4.1 Bestimmung der Mineralisationsraten. - 5.4.2 Mineralisation im Mikrokosmos Ansatz. - 5.5 Potentielle Nitrifikation. - 5.5.1 Gesamte potentielle Nitrifikation in den Böden der kalten Klimaten. - 5.5.2 Archaeale potentielle Nitrifikation in den Böden der kalten Klimate. - 5.5.3 Temperaturabhängige potentielle Ammoniakoxidation. - 5.5.4 Potentielle Nitrifikationsaktivität im gemäßigten Klimat. - 5.6 Quantifizierungen von Nitrifikanten. - 5.7. Molekularbiologische Befunde. - 5.7.1. Diversität des bakteriellen und archaealen 16S-rRNA-Gens. - 5.7.2 Nachweis AOB und AOA mittels der Ammoniakmonooxygenase (AMO) 5.8 DGGE Analysen der Anreichungskulturen. - 5.8.1 Anreicherungen bei 4 °C. - 5.8.2 Anreicherungen bei 10 °C. - 5.8.3 Anreicherungen bei 28 °C. - 5.9 Taxonomie der untersuchten Ammoniak oxidierenden Mikroorganismen (AOM). - 5.9.1 Taxonomie der AOB. - 5.9.2 Taxonomie der AOA. - 5.10 Charakterisierungen der Anreicherungskulturen. - 5.10.1 Morphologische Eigenschaften der Anreicherungskulturen. - 5.10.2 Lichtmikroskopische Untersuchungen der Anreicherungskulturen. - 5.10.3 Temperaturanpassung als physiologische Eigenschaft der AOM. - 5.11 Zusammenfassender Überblick der Ergebnisse. - 6. Diskussion. - 6.1 Permafrostböden und die Prozesse des Stickstoffkreislaufes. - 6.1.1 Stickstoffumsätze aufgrund kleinräumige Variabilität der Böden Samoylovs. - 6.1.2 Verteilung der gelösten anorganischen Stickstoffverbindungen (DIN). - 6.1.3 N-Limitierung in den Permafrostböden. - 6.1.4 Die Prozesse im Küstenaufschluss am Samoylov-Kliff. - 6.2 Die mikrobielle Diversität in den Permafrostböden. - 6.2.1 Diversität in Permafrostböden. - 6.2.3 Unterscheidung AOB und AOA. - 6.2.4 Wer ist wann aktiv? Die Bewertung der RT PCR Ergebnisse. - 6.3 Temperaturanpassung. - 6.4 Möglicher Einfluss des Klimawandels auf die Stickstoffumsetzung. - 7. Schlussbetrachtung und Ausblick. - Literatur. - Veröffentlichungen. - Dank.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Ulmer
    Call number: IASS 16.90047
    Type of Medium: Monograph available for loan
    Pages: 413 S. , Ill., graph. Darst.
    ISBN: 9783825236762 (print)
    Series Statement: UTB 3676
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    Call number: IASS 15.89494
    Type of Medium: Monograph available for loan
    Pages: Losebl.-Ausg.
    Edition: Stand: Oktober 2010
    ISBN: 9783768501828
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
    Monograph available for loan
    Monograph available for loan
    Haar bei München : Franzis-Verl.
    Call number: M 15.89303
    Type of Medium: Monograph available for loan
    Pages: 180 S. , Ill., graph. Darst.
    ISBN: 3645602615 (Pb.) , 9783645602617 (Pb.)
    Series Statement: Python
    Uniform Title: Programming the Raspberry Pi: getting started with Python 〈dt.〉
    Classification:
    Informatik
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 13
    Call number: M 15.89533
    Type of Medium: Monograph available for loan
    Pages: 1008 S.
    Edition: 4., aktualisierte und erw. Aufl.
    ISBN: 3836219174 , 9783836219174
    Series Statement: SAP PRESS
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 14
    Monograph available for loan
    Monograph available for loan
    Berlin [u.a.] : Wichmann, VDE-Verl.
    Call number: 7/M 16.89668
    Type of Medium: Monograph available for loan
    Pages: XVIII, 668 S. , Ill., graph. Darst. , 25 cm
    Edition: 3., völlig neu bearb. und erw. Aufl.
    ISBN: 9783879074792 (GB)
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Call number: PIK F 252-16-89789
    Type of Medium: Monograph available for loan
    Pages: X, 752 Seiten
    Edition: 2. [völlig neu bearb.] Auflage
    ISBN: 9783811477247 (GB.)
    Series Statement: C.-F.-Müller-Wissenschaft
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    Call number: IASS 16.89937
    Type of Medium: Monograph available for loan
    ISBN: 978-3-95636-919-3
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
    Call number: PIK B 020-16-89503
    Type of Medium: Monograph available for loan
    Pages: XXII, 287 S. , graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9783834921314 (PB.)
    Series Statement: Gabler research
    Language: German
    Note: Univ., Diss., Hohenheim, 2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 18
    Call number: M 15.89083
    Type of Medium: Monograph available for loan
    Pages: 773 S , Ill., graph. Darst , 25 cm
    Edition: 2., aktualisierte und erw. Aufl
    ISBN: 3836218259 (Geb.) , 9783836218252 (Geb.)
    Series Statement: SAP Press
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 19
    Monograph available for loan
    Monograph available for loan
    München : Open Source Press
    Call number: 18/M 16.90221
    Type of Medium: Monograph available for loan
    Pages: 575 Seiten , Ill., graph. Darst , 24 cm
    Edition: 5. Aufl.
    ISBN: 9783955390402
    Series Statement: Root's reading
    Classification:
    Informatics
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 20
    Monograph available for loan
    Monograph available for loan
    München : Open Source Press
    Call number: (OCoLC)740934605
    Type of Medium: Monograph available for loan
    Pages: 343 S. , graph. Darst. , 240 mm x 176 mm
    ISBN: 9783941841369 (Pb.) , 9783941841604 (Set)
    Series Statement: Professional reference
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 21
    Monograph available for loan
    Monograph available for loan
    Köln : PapyRossa-Verlag
    Call number: PIK C 111-16-90033
    Type of Medium: Monograph available for loan
    Pages: 163 Seiten
    Edition: 2., unveränderte Aufl.
    ISBN: 9783894385279 (Pb.)
    Series Statement: Neue kleine Bibliothek 193
    Language: German
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    Monograph available for loan
    Monograph available for loan
    Berlin [u.a.] : Springer
    Call number: PIK N 456-16-89760
    Description / Table of Contents: Der "Klimabericht für die Metropolregion Hamburg" wurde im Rahmen des Exzellenzclusters CliSAP am KlimaCampus der Universität Hamburg und ihrer außeruniversitären Partner erarbeitet. Zweck ist eine Zusammenstellung des in wissenschaftlich legitimierter Weise veröffentlichten Wissens über Klima, Klimavariabilität und Klimawandel in dieser Region. Es werden sowohl das Wissen über die vergangenen 100 Jahre, soweit vorhanden, als auch die erwarteten bzw. möglichen Veränderungen in den kommenden 100 Jahren beschrieben. Neben grundlegenden Kapiteln urden Kapitel erarbeitet, in denen über Klimafolgen in bestimmten Bereichen berichtet wird. Dazu zählen zum Beispiel Landwirtschaft, Stadtklima und Küstenschutz. Der Bericht stellt dar, inwiefern Übereinstimmung über Wissen besteht, in welchen Fragen Uneinigkeit oder Unwissen herrscht und inwiefern weiterer Forschungsbedarf besteht.
    Type of Medium: Monograph available for loan
    Pages: XVI, 321 S. , graph. Darst., Kt. (z.T. farb.) , 27 cm
    ISBN: 3642160344 (GB.) , 9783642160349 (GB.) , 9783642160356
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
    Monograph available for loan
    Monograph available for loan
    Ostfildern : Baedeker
    Call number: IASS 16.89880/1 ; IASS 16.89880/2
    Type of Medium: Monograph available for loan
    Pages: 192 S. , Ill., graph. Darst., Kt. , 19 cm
    Edition: 1. Aufl.
    ISBN: 9783829712903 , 3829712901
    Series Statement: Baedeker-Reiseführer
    Language: German
    Branch Library: RIFS Library
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 24
    Call number: IASS 15.0023
    Type of Medium: Monograph available for loan
    Pages: 437 S.
    ISBN: 9783593391694
    Uniform Title: Commonwealth
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Call number: AWI NBM-15-0018
    Type of Medium: Non-book medium
    Pages: 1 Film (54 min) : Stereo, HDTV , 12 cm
    Language: German
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    Call number: IASS 16.89630/1
    Type of Medium: Monograph available for loan
    Pages: 107 S. , zahlr. Ill., graph. Darst. , 1 Bl. Bauanleitung - 1 Bl. Entwurf , 28 cm
    Language: German , English
    Note: Text dt. und engl. - Text in Faltbl. [1] dt.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Call number: 2015/8
    Type of Medium: 11
    ISBN: 9783060207602
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    Call number: MOP 19538/1d-6d
    Type of Medium: Monograph available for loan
    Pages: 111 S.
    ISSN: 0486-2287
    Language: Russian
    Note: In kyrill. Schr.
    Location: MOP - must be ordered
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: PIK E 719-15-89468
    Description / Table of Contents: Der Wandel der Energiewirtschaft hin zu mehr Stromerzeugung aus erneuerbaren Energien spielt sich in physisch-materieller Hinsicht in Landschaften ab. Er wird von Praktikern der Raum- und Landschaftsplanung teils mit Skepsis und teils mit positiven Erwartungen begleitet. In dem Band wird den Fragen nachgegangen, welche Folgen die Energiewende auf die ästhetische Bewertung von Landschaften hat, welche neuen Akteurskonstellationen entstanden sind und welche Konflikte um das Landschaftsbild, die Landnutzung oder die Verteilung von Macht zu verzeichnen sind. Es werden die Konsequenzen der Umbrüche hin zu "neuen Energielandschaften" für die Landschaftsforschung, aber auch für räumliche Planung und Governance thematisiert.
    Type of Medium: Monograph available for loan
    Pages: 219 S. , Ill., graph. Darst., Kt. , 240 mm x 168 mm
    ISBN: 3531197940 (Pb.) , 9783531197944 (Pb.)
    Series Statement: RaumFragen: Stadt - Region - Landschaft
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 30
    Call number: 9/M 16.89728
    Description / Table of Contents: Seit der ersten Auflage 1964 hat sich dieses Werk als Standardwerk etabliert und liegt nun in vollständig neu bearbeiteter und aktualisierter 5. Auflage vor. Diese berücksichtigt die umfangreichen Forschungsergebnisse seit Erscheinen der 4. Aufl. (1991) und fasst den aktuellen geologischen Kenntnisstand in einem einzigen Band zusammen. Auf die einleitende Darstellung der mehr als zwei Jahrhunderte umfassenden Erforschungsgeschichte folgt eine Übersicht der Naturräume, des allgemeinen geologischen Aufbaus und der erdgeschichtlichen Entwicklung Baden-Württembergs. Den Hauptteil des Buches bildet — wie in den vorherigen Auflagen — die detaillierte Darstellung der Gesteinsfolge des Landes und ihrer regionalen Faziesentwicklungen. Dem Grundgebirge, dem nicht-metamorphen Paläozoikum sowie dem Tertiär und der landschaftsgeschichtlichen Entwicklung wird breiterer Raum gegeben als in früheren Auflagen. Erstmals wird dabei die aktuell gültige, in den vergangenen Jahren länderübergreifend abgestimmte stratigraphische Nomenklatur verwendet. Sedimentations- und Klimageschichte sowie die tektonische Entwicklung des Landesgebietes werden ebenfalls ausführlicher erläutert. Dabei werden die Zusammenhänge zwischen der Geologie Baden-Württembergs und benachbarter Regionen berücksichtigt. Abschließend sind den Wechselbeziehungen zwischen menschlicher Tätigkeit und ihren geologischen Voraussetzungen eigene Kapitel gewidmet.
    Type of Medium: Monograph available for loan
    Pages: X, 627 S. , Ill., graph. Darst., Kt.
    Edition: 5., völlig neu bearb. Aufl.
    ISBN: 9783510652679
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 31
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : VS, Verl. für Sozialwiss.
    Call number: IASS 15.89929
    Type of Medium: Monograph available for loan
    Edition: 3., aktualisierte Aufl.
    ISBN: 9783531166612
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Call number: IASS 16.89630/2
    Type of Medium: Monograph available for loan
    Pages: S. 118 - 235 , Ill. , 28 cm
    Language: German , English
    Note: Text dt. und engl.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Type of Medium: Monograph available for loan
    ISBN: 9783775727723
    Language: German , English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Monograph available for loan
    Monograph available for loan
    München[u.a.] : Piper
    Call number: M 18.21948
    Type of Medium: Monograph available for loan
    Pages: 330 S. : Ill.
    Edition: 2. Aufl., Ungekürzte Taschenbuchausg.
    ISBN: 9783492253727
    Series Statement: Piper 5372
    Uniform Title: A different universe
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Monograph available for loan
    Monograph available for loan
    Köln : Institut der deutschen Wirtschaft Köln Medien GmbH
    Call number: PIK B 190-17-90891
    Type of Medium: Monograph available for loan
    Pages: 185 Seiten , Diagramme
    ISBN: 9783602149049
    Series Statement: IW-Analysen 83
    Language: German
    Note: Contents: 1 Einleitung ; 2 Globaler und regionaler Klimawandel ; 3 Regionen im Klimawandel ; 4 Klimaanpassung als mehrdimensionales Entscheidungsproblem ; 5 Untersuchungsdesign ; 6 Unternehmen und Gemeinden im Klimawandel ; 7 Verletzlichkeitsanalyse ; 8 Klimaanpassung: Status quo und Bedarf ; 9 Schlussfolgerungen und Ausblick ; Literatur ; Kurzdarstellung ; Abstract
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Call number: AWI G3-17-90703-1
    In: Materialy četvertoj konferencii geokriologov Rossii, Tom 1, Časti 1-4
    Type of Medium: Monograph available for loan
    Pages: 375 S. , Ill., graph. Darst., Kt.
    ISBN: 978-5-91304-182-1
    Language: Russian
    Note: Table of Contents - Čast' 1.: Research by the pulsing method of a NRM of the metastable water formed at dissociation freonhydrate-12 in the field of negative temperatures / V. A. Vlasov, A. G. Zavodovsky, M. S. Madygulov, A. N. Nesterov, A. M. Reshetnikov. - Kinetics crystallization subcooling of the water contacting to surface gas hydrate / V. A. Vlasov, A. G. Zavodovsky, M. S. Madygulov, A. N. Nesterov, A. M. Reshetnikov. - Transformation of cryogenic structure of frozen clay soils at plain stamp test / S. S. Volokhov. - About influence of contact zone structure of frozen soils with materials on adfreezing strength / S. S. Volokhov, N. V. Solovyeva. - Possibilities of calculating the effective diffusion coefficient of water vapour in snow due to field observations data / R. I. Gavriliev. - Features of water's crystallization in dispersed rocks / V. N. Golubev, G. A. Rzhanitsyn. - Mass exchange in the system of atmosphere-snow cover-ground / V. N. Golubev, D. M. Frolov. - Physical and mechanical aspects of phase transition processes in frozen and freezing ground / J. B. Gorelik. - The experimental stadies of cryogenic preassure into water-saturated saline soils / S. E. Grechishchev, A. V. Brousehkov, Ark. V. Pavlov, O. V. Grechisheheva. - Phase composition of frozen saline ground with petroleum pollution / E. S. Grechishcheva, R. G. Motenko. - About plastic deformation of frozen rocks / M. M. Iudin. - Studies of Soil Moisture Transfer and ice extraction in clay loam Patterns Under External Pressure / O. A. Kazansky. - Isotopic content of interfacial water and ice frozen ground / V. N. Konischev, V. V. Rogov, V. N. Golubev, S. A. Sokratov. - On longevity and structured physical system organizations (on example of frozen soils and ice) / A. A. Konovalov. - On toughness and deforming the frozen ground / A. A. Konovalov. - The study of deformation characteristics of thawing soils / P. I. Kotov. - Thermal properties of volcanic ashes (Kamchatka) / E. P. Kuznetsova, R. G. Motenko. - About temperature extension coeffision of frozen soils / V. P. Merzlyakov. - Classification indicators of frost-susceptible soils / A. L. Nevzorov. - Separation of the pore solution compounds during mass transfer in disperse ice / V. Ye. Ostroumov, N. V. Ostroumova. - Achievements and problems of frozen soils mechanics / L. T. Roman. - Classification of frozen soils / L. T. Roman, V. I. Aksenov, A. V. Iospa. - Modification of frozen soils and ice by adding polyvinyl alcohol in order to facilitate construction / E. V. Safronov, V. V. Vialdin, V. G. Cheverev, V. E. Gagarin, D. V. Hvostikov. - Method of mass crystallization calculation for multiphased rheological mediums / N. I. Sidnyaev, D. A. Krylov. - The deflected mode of the freezing soils layer taking into account the creep and compliance of the boundary conditions / Z. G. Ter-Martirosyan, P. A. Gorbachev. - Study of deformation characteristics of thawing soils of Vankor oilfield / M. N. Tsarapov. - Influence of outer loading on frost heaving of freezing soils, according to theoretical and experimental researches / V. G. Cheverev, M. A. Minkin, E. V. Safronov, V. E. Gagarin, R. S. Bumaev. , Table of Contents - Čast' 2.: Investigation of glaciers and fumarolic activity of Mt Elbrus / V. A. Alekseev, N. G. Alekseeva, M. G. Daniyalov, P. A. Morozov, C. M. Pershin, P. V. Hlebopashev. - The study of impact craters near the Tunguska meteorite epicenter / V. A. Alekseev, V. V. Kopeykin, N. G. Alekseeva, V. V. Krivulin, L. G. Pelehan', V. A. Rukavishnikov, V. A. Chechin. - Engineering geophysical investigations to substantiate the investments for Nizhne-Timptonsk HPP construction / O. K. Voronkov, N. N. Sigatcheva, O. A. Semenov, Yu. Yu. Punin. - Essentials of technique for seismic hazard zoning of extended linear structures in cryolithic zone / V. I. Dzhurik, S. P. Serebrennikov, L. A. Usynin, E. V. Bryzhak. - Temperature dependence of seasonal changes of electrical resistance of frozen ground / V. N. Efremov. - Role and place geophysical methods at studying criolitozone / Y. D. Zykov, A. V. Koshurnikov, N. V. Paramonov, A. A. Pogorelov, R. D. Ostrovsky, A. Y. Gunar. - EM sounding technology's capability in long-term engineering-geological studies in transition zones (case study: transition of a pipeline Bovanenkovo-Ukhta through Baidaratskaya Bay) / Y. D. Zykov, Y. V. Kuleshov, S. V. Kulakov, A. V. Koshurnikov, E. I. Gorshkov, A. A. Pogorelov, E. M. Sizykh. - Experience using of aerospace infrared thermal data for characteristics of the permafrost / S. G. Kornienko. - Wave characteristics of permafrost in Western Yakutia / L. G. Neradovsky. - Geological-geophysical analysis of seismic events in the cryolithic zone of Mongolia / S. P. Serebrennikov, Ts. Batsaikhan, V. I. Dzhurik, A. Yu. Eskin, A. F. Drennov. - Seismic geocryological study of shallow waters in permafrost / A. G. Skvortsov, M. R. Sadurtdinov, A. M. Tsarev. - Features of seismic methods in engineering geocryological studies / A. G. Skvortsov, A. M. Tsarev, M. R. Sadurtdinov. - Descriptiveness of geophysical methods in the assessment of oil pollution / A. D. Skobelev, Y. D. Zykov, A. V. Koshurnikov, A. A. Pogorelov, P. D. Ostrovsky, A. Y. Gunnar. - Radiolocation of the upper frozen ground in Anadyr city: structure, interpretation, forecast / O. D. Tregubov. - Estimating of rock state and properties in long-tem physical weathering by an ultrasonic method / L. F. Ushakova, O. K. Voronkov. - The efficiency of geophysical methods in studies of cryolithic zone in the process of placer accumulation by dredge acquisition / I. M. Khasanov, N. L. Alevskaya, A. V. Koshumikov. - Impact assessment of cryolithic zone in geophysical explorations of gold minefields on a prospecting step, that arc disposed in background medium, consisted of finest sedimentary rock / I. M. Khasanov, V. M. Sharaphytdinov, A. V. Koshurnikov. - Engineering-geocryological research in offshore area of Kruzenshternsky field in Kara sea / V. A. Kholodilov, M. L. Tsemkalo, M. F. Savitskiy, N. V. Paramonov, A. V. Koshumikov, A. A. Pogorelov. - Using electrical resistivity tomography to investigate near-shore permafrost dynamics / P. Overduin, M. Grigoriev, T. Haberlau, S. Wetterich, S. Westermann, K. Yoshikawa. , Table of Contents - Čast' 3.: Cryogenic and seismogenic deormations in the Late Cenozoic deposits of Tunkinskaya depression in Baikal rift zone / S. V. Alexeev, L. P. Alexeeva, A. C. Gladkov, O. V. Lunina, A. M. Kononov, A. V. Andreev. - Coastal Permafrost evolution of Western Yamal in context of climate change / A. A. Vasiliev, I. D. Streletskaya, R. S. Shirokov, G. E. Oblogov. - Classification of massive ice /Yu. K. Vasil'chuk. - δ18O variation of Late Holocene ice-wedge of Aventdalen, Svalbard / Yu. K. Vasil'chuk, N. A. Budantseva, A. M. Zemskova. - Pollen spectra of massive ice of Yerkutayakha River valley, Southern Yamal Peninsula / A. C. Vasil'chuk, Yu. K. Vasi l'chuk, N. A. Budantscva. - Complex assessment of crioecolological and bioresource state of northern geosystems / L. I. Zotova, S. J. Dedjusova. - Study of Quaternary sediments and ground ice with detailed grane-size composition analysis at Yenisey North / M. S. Pavlov, I. D. Streletskaya, A. G. Matyukhin, G. E. Oblogov, A. V. Surkov. - On rock weathering in Cryolithozone / D. M. Shesternev. - Fossil organic matter in permafrost deposits of northern East Siberia - contents and characteristics / L. Schirrmeister, S. Wetterich, G. Grosse, J. Strauss, C. Siegert, P. P. Overduin, H.-W. Hubberten. , Table of Contents - Čast' 4.: The influence of reservoir parameters on hydrate formation in gas wells in permafrost / E. A. Bondarev, K. K. Argunova, I. I. Rozhin. - Research features of deposits wells with abnormal low field temperature / Z. A. Vasil'eva, D. S. Djafarov. - Technogenic indicators of natural gas hydrates presence in deposits of the western part of the Siberian Platform and Yenisei-Khatanga Depression / Z. A. Vasil'eva, D. S. Dzhafarov. - The commercially viable unconventional gas sources (gas hydrates, coalbed methane and shale gas) - experience of development and prospects in Russia / E. V. Perlova. - Gas hydrate of Yamal region (Yamal Peninsular, Kara Sea's shelf) - occurance, types, resources, technogenic challenges / E. V. Perlova, S. A. Leonov, E. S. Miklyaeva, S. D. Perlov. - Variation of thermal conductivity in gas-saturated sediments during hydrate accumulation and freezing / E. M. Chuvilin, B. A. Buhanov. - Sources of natural gas in cryolithozone of Yamal Pemnsula / V. S. Yakushev. , In kyrill. Schr.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    Call number: AWI G3-17-90703-2
    In: Materialy četvertoj konferencii geokriologov Rossii, Tom 2, Časti 5-6
    Type of Medium: Monograph available for loan
    Pages: 376 S. , Ill., graph. Darst., Kt.
    ISBN: 978-5-91304-183-8
    Language: Russian
    Note: Table of Contents - Čast' 5: Geocryological monitoring network in the area of Russian Antarctic stations / A. A. Abramov, D. A. Gilichinsky. - Cryogenic sections of gas-bearing structures of West Siberia Sub-Arctic / Yu. B. Badu. - Reconstruction (3 mln years) and forecast (0,3 mln years) of global ecological parameters and methods of saving the last interglacial climate / B. L. Berry. - Geocryological conditions of the plain part of the Lama-Pyasino region / A. B. Bortsov, O. M. Lisitsyna. - Regularities of modern relief organization Yakutia coastal lowlands-remote sensing and GIS-studies / A. A. Veremeeva. - Last interglacial environments in NE Siberia / S. Wetterich, A. Andreev, F. Kienast, L. Schirrmeister, V. Kunitsky. - Prognoz of change of geocryological conditions of the basis of detailed landscape geocryological maping of the Seida key site within the limits of the project "Carbo-north" / J. Vlasova, P. Kuhry, G. G. Mazhitova, S. Marchenko, I. S. Parmuzin, F. M. Rivrin. - Geocryological classification of Arctic shelfs according to the frozen strate formation / A. V. Gavrilov. - The recent climatic changes on the evidence of ice wedges isotopic analysis / A. Yu. Dereviagin, A. B. Chizhov, H. Meyer. - Preliminary results of geocryological investigation on Hayes Island (Franz Josef Land) / D. S. Drozdov, E. A. Slagoda,A. A. Abramov, A. A. Ermak, P. T. Orekhov. - Permafrost and geothermal conditions in the Vilyui Synelcise / M. N. Zheleznyak, V. P. Semenov, V. T. Balobaev, V. G. Rusakov. - Development of a permafrost monitoring network in north eastern Asia / M. N. Zheleznyak, S. I. Serikov. - The state of permafrost in the Yakutsk Combined Heat and Power Plant area / S. I. Zabolotnik, P. S. Zabolotnik. - Geocryological conditions Swedish Lapland / N. V. lvanova, I. L. Kuznetsova, I. S. Parmuzin, F. M. Rivkin, V. A. Sorokovikov. - Closed submarine taliks in the eastern part of the Laptev Sea shelf / M. V. Kasymskaya. - Permafrost conditions of the north eastern part of the Yamal Peninsula / V. V. Kondakov, O. F. Kusova, M. V. Kondakov. - Comparison of the frontier geological, climatic and frozen Pleistocene events on the coastal lowlands of the north Yakutia / L. N. Maksimova. - Some specialties of freezing process of rocks on first stage of permafrost layer formation / L. N. Maksimova, S. Yu. Parmuzin. - Monitoring of the Mean-annual ground temperature and thawing depth on the steady-state-station Bolvansky in the Pechora delta / G. V. Malkova. - Saline the Quaternary sediment of shore of Enisey Bay / A. G. Matukhin, I. D. Streletskaya, L. E. Polaykova, M. S. Pavlov, G. E. Oblogov. - Characteristics and evolution of thermokarst lakes and alasses in Ice complex deposits of the Lena River delta / A. Morgenstern, G. Grosse, F. Günther, L. Schirrmeister. - Recent formation of Permafrost in coastal zone of Kara Sea / G. E. Oblogov, R. S. Shirokov, A. G. Matukhin, M. S. Pavlov. - Deformations of Quaternary deposits and their relationship with cryogenic processes in the Kara Sea region / O. L. Opokina, E. A. Slagoda, A. A. Vasil'ev, I. D. Streletskaya, A. A. Bagenov. - The long term dynamics of Lyakhovsky Island coastlines (on evidence of remote sensing data) / E. I. Pizhankova. - Cenozoic sequence correlation for north Yamal / E. E. Podbornyy, Yu. O. Badu. - Cryogenic sediments' structure and formation at the south border cryolithozone, the Kola Peninsula / F. A. Romanenko, E. V. Garankina. - Geothermal monitoring of cryolithozone of the north Tien Shan / E. V. Severskiy. - The ground ice of Yenisey north, International Polar Year rezults / I. D. Streletskaya, A. A. Vasiliev, E. A. Slagoda, E. A. Gusev, O. L. Opokina. - Permafrost-landscape's interactions in cryolithozone of Russia / N. V. Tumel', N. A. Koroleva. - Conditions of perennial frost mounds formation in Yakutia / A. A. Urban. - Conditions of formation of cryolithozone of western Russian Antarctic shelf and the adjacent /N. A. Shpolyanskaya. , Table of Contents - Čast' 6: Numerical modelling of non-stationary teperature fields in three-dimensional domain by programm complex Merzlota / I. B. Bakholdin. - Cryopegs formation features at Bayaratskaya Bay coast / S. N. Buldovich. - Monitoring of the ground thermal state along the railroad corridor underlain by ice-rich permafrost (Olen to Kerdem) / S. P. Varlamov, N. I. Shender, P. N. Skryabin. - Dinamics of frazil processes in Zabaykalie region / A. G. Verhoturov, E. S. Vasilovsraya. - Criogenic processes and events in high-mountain area of central Caucasus (based on winter research during 2000- 2010) / N. A. Volodicheva, M. N. lvanov, V. A. Isakov. - Development of suffosional processes in permafrost areas, Central Yakutia / L. A. Gagarin, A. A. Semernya. - Analysis of role of landscape factors in variability of the seasonal thawing (examples from the CALM program) / V. Grebenets, D. Streletskiy, D. Shmelev, N. Shiklomanov. - Cryogenic processes in valleys of the smoll rivers of the central Yamal / A. A. Gubarkov, M. V. Andreeva. - Assessment of permafrost temperature regime dynamics in the area of Marre-Sale according to the monitoring observation data / V. A. Dubrovin, L. N. Kritsuk. - Anthropogenic modification of the active-layer hydrothermal regime type in permafrost landscapes, northern Verkhoyansk / R. N. lvanova. - Regularities of the dynamics of negative air temperatures in the formation of the thermal state of ground in layer of annual heat turnover in the european north-east Russia / N. B. Kakunov, E. I. Sulimova. - The analysis of displays of climate change on processes of degradation of the long-term frozen ground / S. E. Korkin. - Investigation of termokarst lakes dynamics in central Yakutia by mutitemporal satellite images / V. I. Kravtsova, T. V. Tarasenko. - Simulation of processes heat-moisture trasfer using the method of thermal and hydraulic resistance in soils / N. B. Kutvitskaya, L. A. Duginov, M. Kh. Rozovsky, A. V. Ryazanov, M. A. Magomedgadzhieva. - Climate changes and permafrost in the Bureya River basin / P. V. Novorotsky. - The geocryological consequences of the contemporary global climate changes / A. V. Pavlov, G. V. Malkova, Yu. V. Korostelev, Yu. B. Skachkov. - Quantitative prognosis methods of permafrost responce to contemporary climate changes / A. V. Pavlov, G. Z. Perlshtein, G. S. Tipenko. - Large scale satellite image interpretation of tundra permafrost and landscape conditions and assessment of its authenticity (by the example of central part of the Yamal Peninsula) / E. Panchenko. - Assessment of landscape resistance in areas along the auto road "cp Vorkutinskaya - cp Yarynskaya" (rep. Komi, YNAO) with calculation of permafrost stability index / E. Panchenko. - New tendencies of frost heave in relation to climate change (on the example of the Nadym station) / O. E. Ponomareva, A. G. Gravis, N. M. Berdnikov. - Effect of alternating temperature on the process of frost weathering / V. Popov. - Climatic variability in Yakutia at the turn of the 20th and 21st centuries / Yu. B. Skachkov. - Post-fire dynamics of the thermal state of soils in Central Yakutia / P. N. Skryabin. - Thermal regime of seasonally frozen soils and permafrost in the Baikal-type depressions / I. E. Trofimova, A. I. Shekhovtsov. - Dynamics of cryogenic relief / A. I. Tyurin. - Monitoring of permafrost, active layer and geosystem state in the forest-tundra and southern tundra of Western Siberia / N. G. Ukraintseva, D. S. Drozdov, K. A. Popov, G. V. Matyshak, A. M. Tsarev. - The method of the forecast of variation of temperature conditions of ground, the bases of buildings and constructions in permafrost / A. A. Fedotov, P. V. Hrapov, N. I. Sidnyaev, A. V. Glasko. - Landsliding hazard assesment in typical tundra (central Yamal) / A. V. Khomutov, M. O. Leibman. - Glaciation of siberian mountains as the specific component of cryolithozone - a view from the position of Earth cryiology / V. S. Sheinkman. - Dynamics of temperature states of permafrost on north of West Siberia and Alaska under different climate forecasts / D. G. Shmelev. - Climatic change in western North America during the last 15,000 years: the role of changes in the relative strengths of air masses in producing the changing climates / S. A. Harris. , In kyrill. Schr.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
    Call number: AWI G3-17-90703-3
    In: Materialy četvertoj konferencii geokriologov Rossii, Tom 3, Časti 7-12
    Type of Medium: Monograph available for loan
    Pages: 380 S. , Ill., graph. Darst., Kt.
    ISBN: 978-5-91304-184-5
    Language: Russian
    Note: Table of Contents - Čast' 7.: Oil and gas basins distribution in cryolithozone / L. S. Garagulya, G. I. Gordeeva, V. N. Zaitsev. - Exogenous geological processes on the main gas pipeline "Zapolamoe-New-Urengoy" / A. A. Gubarkov. - Feftures of engineering geological conditions of building of an elevated site of the oil pipeline "the Vankorsky deposit - "Purpe" / A. A. Goubarkov, S. N. Okunev, M. S. Maramigina, K. V. Zalesskiy. - Influence of anthropogenous activity on development of cryogenic processes and dynamics of the seasonal thawed layer on the gas pipeline "Nadym-Punga" / E. V. Elanzev, M. V. Andreeva, A. A. Gubarkov. - Experience using of the aerospace infrared thermal data for characteristics of the permafrost / S. G. Komienko. - Large-scale engineering-geocriological mapping of natural-technical systems of Jamburg OGCF / I. L. Kuznecova, E. A. Eremeeva, A. A. Erasov, M. V. Kasymskaya, T. V. Nikitina, A. I. Konichshev, M. A. Moiseeva. - Definition of enginering-geocryological parameters in complex ground conditions by statical probing (on example New Urengojsky gaz-chemical complex) / A. S. Kurbatov. - Taxonomic system of geotechnical monitoring gasfield and gas-transport objects / V. V. Lashin, A. V. Kryukov. - The technogeoekological analysis of gas-transport systems at the gas deposit Medvezhje / V. P. Marahtanov, M. A. Velikotskij, V. P. Chigir, S. A. Egurtsov, S. N. Menshikov, V. N. Polozov. - Field study of influence of oil pollution on the seasonal ground freezing oil deposit Samotlor / E. S. Miklyaeva, V. A. Soldatov. - Restriction to nature management in the southern cryolithozone of the Bolsheztmclskaya tundra / G. G. Osadchaya. - About long-term permafrost temperatures dynamics under the influence of climate changing at the north of West Siberia / A. B. Osokin. - The building technology for oil and gas fields of Yamal Peninsula / A. B. Osokin, E. Yu. Galaktionov, G. K. Smolov, A. P. Popov. - The influence of non-isothermal effects on gas production and determination of the area of possible hydrate formation in the bottom-hole zone of the gas-bearing reservoirs / I. I. Rozhin, E. A. Bondarev, K. K. Argunova. - Short-term forecasting of terrain evolution for Bovanenkovo gas condensate field territory (Yamal Peninsula) / V. I. Solomatin, M. A. Konjahin. - Destruction and recovery of permafrost along the gas pipeline Zapadno-Ozernoe gas field - Anadyr city in 2000 - 2008 / O. D. Tregubov, V. Yu. Razzhivin. , Table of Contents - Čast' 8.: The control of temperature conditions of permafrost ground and building foundations during the development of hydrocarbons in new regions / I. B. Baholdin, N. I. Sydnyaev, Y. S. Melnikova. - Thermal stabilization of permafrost soils at bases of structures with floors on the ground / R. M. Bayasan, A. R. Bayasan, G. P. Pustovoit, A. N. Tseeva. - Forecast of changing of bearing capacity and frost heaving of trapped foundation in west sektor of cryolithozone of Russia to 2050 / V. I. Grebenets, D. G. Shmelev. - Methodology of complex load tests of pile foundations in permafrost / I. E. Guryanov. - An analysis of land suitability for urban construction in permafrost regions / I. E. Guryanov. - Analysis of the effect of heat torch open on permafrost conditions of the site UPSV-South / G. M. Dolgih, S. N. Okunev, G. V. Anikin, V. N. Zaharova, M. S. Maramygina. - Natural researches deep heat pipe in experimental-industrial range / G. M. Dolgikh, S. N. Okunev, D. S. Pazderin, V. N. Feklistov. - Geocryological problems associated with railroads and highways on permafrost / V. G. Kondratiev. - Study stabilizations railway embankment on permafrost soil under thawing / S. A. Kudryavtsev, A. G. Polevichenko, A. V. Kazharskiy, Yu. B. Berestyanyy. - About anthropogenic influence on the stability of the buildigs and installations of the town construction in the north polar region / E. S. Maksimenko. - Permafrost conditions along proposed railway route in the northern Baffin Island and associated design considerations / V. E. Roujanski, K. W. Jones. - Experience of creation of the centralized system of gathering, processing and data storage of geotechnical monitoring / A. V. Ryazanov, V. D. Kaurkin, D. V. Manchukov, K. V. Zalessky. - The reliability of north infrastructure under changing climate conditions / L. N. Hrustalev, S. Yu. Parmuzin, L. V. Emelyanova. - Prognosis temperature conditions of soil beneath the foundations of football arena / A. N. Ceeva, Yu. A. Khokholov, M. V. Kaymonov, A. S. Kurilko. , Table of Contents - Čast' 9.: About the liability of geocryological factor account in the estimating of land condition within the confines of problem solution of Russian ecological safety / R. B. Bigeeva. - Reconversion of ecosystems under the influence of geocryological processes / L. S. Garagulja, G. I. Gordeeva, E. N. Ospennikov, V. Z. Hilimonjuk. - Hydrological and geo-ecological research in the Pechora river's delta / E. A. Dombrovskaya, N. G. Ukraintseva. - Estimation of possible influence of building of hydroelectric power station on the river Timpton (Southern Yakutia) on geological conditions and processes / A. A. Ermolov. - Cryoecological monitoring investigations of agricultural landscapes in central Yakutia / P. V. Efremov, I. S. Ugarov, A. N. Fedorov. - Theoretical and applied aspects of expert geoecological risk economic development within the new educational program / L. I. Zotova. - Permafrost - ecological mapping of cryolithozone of Russia / N. A. Koroleva, N. V. Tumel. - Impact of fire on vegetation and permafrost of northern taiga palsa pcatland in West Siberia / N. G. Moskalenko. - Long-term monitoring of cryogenic processes in the Russian North-West during global warming / N. G. Oberman. - The impact of man-made barrages on the surface and subpermafrost drainage in Yakutsk / N. A. Pavlova, S. I. Serikov. - Estimation of change of the condition of cryogenic landscapes of the northeast of Bolshezemelskaya tundra as a result of technogenic influence / E. S. Popova, J. V. Vlasova, N. V. Tumel. - Assessment of the dynamics of environmental permafrost conditions geocriological under varying conditions of heat-exchange on the earth surface / V. Z. Khilimonyuk, M. V. Filatova. , Table of Contents - Čast' 10.: The innovation technique and technology using for thermal stabilization of saline soils at Bovanenkovo oil and gas field on Yamal Peninsula / R. M. Bayasan, T. V. Bayasan, S. I. Golubin, A. V. Lyalin, G. P. Pustovoit. - Experience of planning, editing and exploitation of systems temperature stabilizing of ground base objects Vankor field / G. M. Dolgikh, S. N. Okunev, S. A. Stoyanov, K. V. Zalesskiy. - Method for carring permafrost area capacity assessment of ground and conditions of the building of development / A. V. lospa, A. A. Popova. - Statistic on accidents and safety of natural - technical systems on permafrost / Ja. A. Kronik. - Safety and standartization problems for designing and construction on permafrost / Ja. A. Kronik, M. A. Minkin. - Multipurpose mapping as informational support engineering survey, design and monitoring / F. Rivkin, I. Kuznetsova, N. lvanova, A. Popova, I. Parmuzin. - Engineering and geocryological monitoring of Obskaya-Bovanenkovo railway (Yamal Peninsula) / V. P. Chemyadyev, I. I. Shamanova, A. V. Maksimov, S. N. Titkov. , Table of Contents - Čast' 11.: Comparative analysis of radiative-heat parameters in Antarctic and Mars polar regions / O. N. Abramenko, I. A. Komarov, V. S. lsaev. - Cryophilic communities of lakes located in the Baikal rift zone / N. A. Bondarenko, O. I. Belykh, I. V. Tomberg, S. I. Genkal, I. V. Tikhonova, N. F. Logacheva, V. N. Alexandrov, O. A. Timoshkin. - Biogeochemistry of frozen soils of the Central Yakutia / A. V. Brouchkov, V. P. Melnikov, G. I. Griva, V. E. Repin, E. V. Brenner, M. Tanaka, M. V. Shchelchkova. - Exogenic cryogenic processes on Mars / V. S. lsaev, I. A. Komarov, O. N. Abramenko. - Underground ice as environment of microorganism / A. N. Kurchatova, V. V. Rogov. - Plant species indicating the depth of active layer on the Bely Island / O. V. Khitun, K. A. Ennokhina, M. O. Leibman, A. V. Khomutov. , Table of Contents - Čast' 12.: Actual problems of geocryology (permafrost science) / A. V. Brouchkov. - International Permafrost Field Courses TEPO-Yamburg (2007 - 2009) in the network International Polar Year / V. Grebenets, A. Boitsov, A. Kurchatova, D. Kaverin, E. M. Pfeiffer, N. Rueggen, A. Zschocke, N. Shiklomanov, D. Streletskiy, A. Klene. - Teaching academic discipline "geocryology" for students of building specialities / A. L. Nevzorov, V. V. Koptyaev. - Permafrost and periglacial geomorphology of Western Taymyr. The field courses on permafrost for graduate and phd student / I. D. Streletskaya, A. A. Vasiliev, G. A. Cherkashev, V. N. Konishchev. , In kyrill. Schr.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 39
    Call number: AWI G3-17-90703-4
    In: Materialy četvertoj konferencii geokriologov Rossii
    Type of Medium: Monograph available for loan
    Pages: 119 S. , Ill.
    ISBN: 978-5-91304-186-9
    Language: Russian
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 00.0652(2013-2015
    In: Erdbebenbeobachtung im Freistaat Sachsen
    Type of Medium: Series available for loan
    Pages: 54 Seiten , farbige Illustrationen und graphische Darstellungen
    Series Statement: Erdbebenbeobachtung in Mitteldeutschland
    Classification:
    Seismology
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 41
    Monograph available for loan
    Monograph available for loan
    Eichenzell : Neuland
    Call number: IASS 16.90730
    Type of Medium: Monograph available for loan
    Pages: 83 Bl. , überw. Ill.
    Edition: 4. Aufl.
    ISBN: 9783940315168
    Language: German , English
    Note: Text dt. und engl.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    Call number: 2013/17
    Pages: 400 S.
    ISBN: 9783492302784
    Series Statement: Piper 30278
    Uniform Title: Powering the future
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
    Monograph available for loan
    Monograph available for loan
    Hamburg : Carlsen
    Call number: 4/M 10.0195
    Description / Table of Contents: Wie bringt man 14 Milliarden Jahre Weltgeschichte in ein Buch? Diese Frage hat sich der Berliner Zeichner Jens Harder gestellt und beantwortet: Indem man auf 350 Seiten den Beginn unseres Universums mit dem Urknall, die Entstehung des Planeten Erde und die Evolution der Pflanzen- und Tierwelt in Bildern umsetzt. Mit Texten geht er sparsam um, nur an wenigen Stellen finden sich kurze Passagen. Dafür fädelt er auf diesen historischen Faden Darstellungen aus allerlei Schöpfungsmythen und verquickt so Naturwissenschaft und menschliche Vorstellungswelt. Am Ende des Buches steht der Mensch. Der Band "Alpha - directions" erschien zuerst beim französischen Verlag Actes Sud und ist der Auftakt zu einer mehrere Bände umfassenden Reihe über Entstehung, Geschichte und Zukunft des Menschen.
    Type of Medium: Monograph available for loan
    Pages: 352 S. : überw. Ill.
    ISBN: 9783551789808
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 44
    Call number: PIK E 713-17-90095
    Description / Table of Contents: Die Herausgeberinnen: Prof. Dr.-Ing. Sabine Hofmeister, Dr. rer. nat. Christine Katz, Dr. rer. soc. Tanja Mölders, alle: Lehr- und Forschungsgebiet Umweltplanung, Fakultät Nachhaltigkeit, Leuphana Universität Lüneburg
    Description / Table of Contents: Zwischen Geschlechter- und Nachhaltigkeitsforschung sind zahlreiche Synergien möglich. Die AutorInnen zeigen, warum die Umweltwissenschaften nicht auf die Kategorie Geschlecht verzichten dürfen. Den LeserInnen wird ein Überblick über das komplexe und vielfältig verwobene Forschungsfeld gegeben.
    Type of Medium: Monograph available for loan
    Pages: 403 Seiten
    ISBN: 9783847400103
    Language: German
    Note: Contents: I Grundlegungen und Orientierungen ; 1. Grundlegungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; 2. Orientierungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; II Forschungs- und Handlungsfelder der Nachhaltigkeitswissenschaften und -politik ; 1. Einführung ; 2. Wissenschaft und Forschung ; 3. Wirtschaften und Arbeiten ; 4. Raumentwicklung ; 5. Mobilität ; 6. Klimawandel und -politik ; 7. Ressourcenpolitik und Infrastruktur ; 8. Natur und Landschaft ; 9. Konsum- und Lebensstile ; 10. Zeit(en) ; 11. Governance, Partizipation, Empowerment ; III Fazit - Die Kategorie Geschlecht: Neue Perspektiven für die Nachhaltigkeitswissenschaften
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
    Call number: IASS 16.90101
    Description / Table of Contents: In Theoriediskussion und Forschungspraxis hat das Erkenntnisinteresse an der sprachvermittelten Konstitution gesellschaftlicher Wirklichkeit in den Sozial- und benachbarten Wissenschaften zugenommen. Die Diskursanalyse spielt dabei heute eine zentrale Rolle, nachdem in unterschiedlichen Akzentuierungen bspw. die Gesprächsforschung, die Foucaultsche Diskurstheorie sowie die Habermassche Diskursethik den Diskursbegriff bekannt gemacht haben. Vor diesem Hintergrund hat sich in den letzten Jahren ein vielfältiges, aber auch unübersichtliches transdisziplinäres Feld von diskurstheoretischen und diskursanalytischen Ansätzen entwickelt. Das Handbuch bietet mit Beiträgen aus Soziologie, Psychologie, Politik-, Sprach- und Geschichtswissenschaften einen Überblick zu zentralen diskurstheoretischen Ansätzen und methodischen Fundamenten. Es richtet sich an das Fachpublikum, das den Diskussionsstand innerhalb der eigenen und der verwandten Disziplinen rezipieren möchte, sowie an Studierende und Forschende, die für eigene empirische Arbeiten Orientierung suchen.
    Type of Medium: Monograph available for loan
    Pages: 535 S. , Ill., graph. Darst.
    Edition: 3., erw. Aufl.
    ISBN: 9783531173511 (kart.)
    Series Statement: Interdisziplinäre Diskursforschung
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 46
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : VS, Verl. für Sozialwiss.
    Associated volumes
    Call number: IASS 16.90102
    Description / Table of Contents: Das Handbuch Sozialwissenschaftliche Diskursanalyse stellt in Einzelbeiträgen aus unterschiedlichen Disziplinen theoretische und methodologische Grundlagen sowie exemplarische Vorgehensweisen der Diskursforschung vor. Es wendet sich an Studierende und WissenschaftlerInnen, die sich mit der Diskursanalyse vertraut machen wollen. Der erste Teilband präsentiert theoretische Grundlagen und allgemeine methodische Zugänge unterschiedlicher Ansätze der Diskursforschung. Der vorliegende Teilband 2 versammelt in 16 Einzelbeiträgen exemplarische diskursanalytische Studien aus Soziologie, Geschichts- und Politikwissenschaft, Diskursiver Psychologie, Kritischer Diskursanalyse, linguistischer Diskursgeschichte und Korpuslinguistik. Im Vordergrund stehen nicht die jeweiligen Fragestellungen der Einzeluntersuchungen, sondern der Zusammenhang von Fragestellung, empirischem Design, Detailanalyse und Formulierung des Gesamtergebnisses. Die Erläuterung des methodischen Vorgehens an Beispielen eignet sich für den Einsatz in der Lehre wie für die Orientierung in Bezug auf Planung und Durchführung eigener Forschungsprojekte.
    Type of Medium: Monograph available for loan
    Pages: 533 S. , Ill., graph. Darst.
    Edition: 4. Aufl.
    ISBN: 9783531166513 (kart.)
    Series Statement: Interdisziplinäre Diskursforschung
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 47
    Monograph available for loan
    Monograph available for loan
    Zürich : Diogenes-Verl.
    Call number: PIK R 011-16-90162
    Type of Medium: Monograph available for loan
    Pages: 342 S. , 19 cm
    ISBN: 9783257200195
    Series Statement: detebe-Klassiker 20019
    Uniform Title: Walden or, life in the woods 〈dt.〉
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    Monograph available for loan
    Monograph available for loan
    Moskva [u.a.] : Paulsen
    Call number: AWI P7-16-90171
    Type of Medium: Monograph available for loan
    Pages: 349 S.
    ISBN: 9785987970676
    Series Statement: Vklad Rossii v Meždunarodnyj poljarnyj god 2007/08 = Contribution of Russia to International polar year 2007/08
    Language: Russian
    Note: In kyrill. Schr.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    Call number: AWI G3-17-91084-2
    In: Kvarter vo vsem ego mnogoobrazii, Tom 2
    Type of Medium: Monograph available for loan
    Pages: 350 S. , Ill., graph. Darst., Kt.
    ISBN: 978-5-91918-124-8
    Language: Russian , English
    Note: TABLE OF CONTENTS: Contemporary hydrographic network of the North-East of the Russian Plain: chronology of development / A. S. Lavrov, L. M. Potapenko. - Some distinctions of big and smoll interglacials (by way of example of Western Siberia during Late Pleistocene) / S. A. Laukhin, A. M. Firsov. - Pollen spectra in the lithological facies of lake bottom sediment on the White Sea Coast / N. B. Lavrova, V. V. Kolka, O. P. Korsakova. - Barsova Gora is the unical object of glacial geology and Taiga vegetation in the middle Priobie / N. B. Levina, V. A. Tkachenko, V. N. Turin, N. N. Lavrovich, E. V. Shepetova. - Geological role of ice in formation of the Arctic Ocean recent and quaternary sediments composition / M. A. Levitan, K. V. Syromyatnikov. - Granite protrusions as a relief-forming factor of the activated sections of platforms and mobile belts / M. G. Leonov, E. S. Przhiyalgovsky. - Glacial tectonics and the granulated substance mechanics / M. G. Leonov, O. G. Epshtein. - Late Pliocene-Early Pleistocene lake sediments in hollow D'Issyk-kul / O. N. Leflat, T. N. Voskresenskaya. - Complexity and diversity of genetic indication of loose formations and new things in the methods of their identification (according to the results of research of small rivers' valleys of the North of Amur-Zeya Plain, Lower Amur Region and Western Priokhotye / E. Yu. Likutov. - Landscape-geological characteristic of travertine cascade of the ancient thermal source of tract pymvashor / A. A. Ljubas, J. N. Bolotov, M. Y. Gofarov, S. A. lglovskiy. - Lake's lithogenesis: new formations are on the bottom of the drying up Udinsky Streach / L. A. Magaeva, M. T. Ustinov. - Genetic classification of peat deposits based on trophicity degree / G. L. Makarenko. - On the issue of classification of mires based on trophicity degree / G. L. Makarenko. - Some burning issues of a structural interpretation of the plain areas relief / V. I. Makarov, N. V. Makarova, T. V. Sukhanova. - The first experience of the 230Th/U dating of buried wood remains / R. E. Maksimov, V. Yu. Kuznetsov, S. A. Laukhin, I. E. Zherebtsov, S. B. Levchenko, N. G. Baranova. - Variations of the relative intensity of geomagnetic field in bottom sediments of the Bering Sea and North-Western Pacific during the last 380 kyr / M. I. Malakhov, S. A. Gorbarenko, D. Nurnberg, R. Tiedemann, G. Yu. Malakhova, J. Riethdorf. - Using high-resolution records petromagnetic and lithophysic characteristics of the sediments Bering Sea and high-latitude Western Pacific for reconstruction of climate and environment in the Late Pleistocene-Holocene / M. I. Malakhov, S. A. Gorbarenko, D. Nurnberg, R. Tiedemann, G. Yu. Malakhova, J. Riethdorf. - Some information about genetic classification of lakes of the Vepsovsky Hill East of the Leningrad Region / O. V. Malozemova, L. A. Nesterova, D. A. Subetto. - Middle Pleistocene small mammal faunas of Eastern and Central Europe: Chronology, correlation / A. K. Markova, T. van Kolfschoten. - Astronomical and meteorological criteria of defining human activity traces in ancient megalith rock complexes in the North-West Russia / L. S. Marsadolov, G. N. Paranina. - Palynological characteristics of the middle Pleistocene deposits in the Vychegda River Basin, the Komi Republic (preliminary data) / T. I. Marchenko-Vagapova. - Isotope specialization (δ18O, δ13C) of quaternary carbonates from Belarus and potential of palaeoenvironments indication / N. A. Makhnach. - The complex survey of quaternary deposits / A. V. Mashukov, A. E. Mashukova. - Quaternary deposits and construction materials' deposits in the Kaluga Region / S. G. Medvedeva. - Vegetation and climate of Sakhalin in the early Holocene / Yu. A. Mikishin, L. G. Gvozdeva. - Inorganic geochemistry record of stages 6-11 from Elgygytgyn lake sediments (deep drilling data) / P. S. Minyuk, V. Ya. Borkhodoev and Elgygytgyn Scientific Party. - Palaeoshorelines on the Murmansk coast / M. V. Mityaev. - Vertical matter flow in Gulfs on Murmansk and Karelian coasts / M. V. Mityaev, M. V. Gerasimova. - Channel and basin components of sediment yield in the formation of quaternary alluvial suites of rivers of the middle Volga Region / V. V. Mozzherin. - Late Pleistocene interglacial-glacial climatic transition (MIS 5/MIS 4) as derived from palynological analysis and IR-OSL dating of deposits from the Voka Reference Section, Southeastern coast of the Gulf of Finland / A. N. Molodkov, N. S. Bolikhovskaya. - Quaternary sediments in the Central Part of Northern West Siberia / D. V. Nazarov. - Palynological evidences of the postglacial warm event of the Laptev Sea Region / O. D. Naidina. - Some problems of using luminescent methods for absolute dating of glacial deposits (by the example of Chagan Section, SE Altai) / R. K. Nepop, A. R. Agatova, H. Rodnight. - Freshwater travertine-like carbonates of the Izhora Plateau as the natural markers of the structural dislocations / M. U. Nikitin, A. A. Medvedeva. - Fold deformations in late Pleistocene deposits of the Central Part Kola Region and their genesis / S. B. Nikolaeva. - Mammoths and man of stone age in Northern Europe - insight of a question on migrations to European Subarctic by Western paths / A. A. Nikonov. - Formation of present-day deposits in the conditions of technogenic litogenesis / E. N. Ogorodnikova, S. K. Nikolaeva. - Traces cryogenesis of Neopleistocene sediments the lower Irtysh / O. L. Opokina, E. A. Slagoda. - Stratigraphical subdivision of the Eopleistocene deposits of the Simbugino Site and new mollusc finds (Southern Foreurals) / E. M. Osipova, G. A. Danukalova. - Late Pleistocene to Holocene environment and climate in the Upper Ponoy Depression (Kola Peninsula) reconstracted from pollen record of Churozero lake bottom deposits / E. Yu. Pavlova, M. V. Dorozhkina, E. I. Devyatova. - Absolute chronology and climatic conditions of Valdai (Vistulian) terraces formation in the middle Seim River Valley / A. Panin, J.-P. Buylaert, E. Matlakhova, A. Murray, O. Pakholova. - Possibility of reconstruction of climate change in the Mongolian Altai based on analysis of annual records in glaciers and lacustrine sediment / T. S. Papma, E. Yu. Mitrofanova, N. S. Malygina. - Northern labyrinth - thee Gnomon: compass, clock, calendar / G. N. Paranina. - Late Pleistocene and Holocene paleogeography of the coastal lowlands of Is. Paramushir (Kuril Islands) / A. Ju. Pakhomov. - Upper-Kama (Verhnekama) Upland - the newest lifting of the middle Last Pleistocene / M. M. Pakhomov, I. L. Borodatyi. - Dating mass accumulations of Mammoth across Arctic Eurasia / V. V. Pitulko, P. A. Nikolskiy, A. E. Basilyan, E. Y. Pavlova. - Features of vertical distribution of the materials within the marginal zones of permafrost polygonal structures and its importance for dating of quaternary deposits in cryolitozone / V. V. Pitulko, E. Y. Pavlova, A. E. Basilyan, S. G. Kritsuk. - Morfogenesis of the tectonics active area of the Mongolian Altay / S. G. Platonova. - Reference section of the Lichvin interglacial in the North-Western Part of European Russia's Region / E. S. Pleshivtseva, V. L. Garkusha, M. A. Travina. - New radiocarbon dates of Late Quaternary Mammals in the Arkhangelsk Region in connection with reconstructions of the last glaciation in the Eastern Europe / D. V. Ponomarev, T. van Kolfschoten, A. K. Markova, J. van der Plicht. - Geological illustrations of Aral-Caspian Region's latest seismodynamic high activity / V. I. Popkov. - About Karagiinsk closed depression (Mangishlak)'s genesis / V. I. Popkov. - On the issue of formation of the Caucasian mineral waters' modern structural geomorphologic aspect / V. I. Popkov, I. G. Sazonov, D. A. Kolleganova. - Natural climate changes on the border of Late Pleistocene and Holocene / A. N. Popova, D. A. Subetto. - Some problems paleogeomorfologi Volga Region / I. V. Proletkin. - New perspectives on modern geomorphological studies / I. V. Proletkin. - Dynamics of small mammals local assem , In kyrill. Schr. , In engl. und rus. Sprache
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    Call number: PIK N 453-18-91821
    Description / Table of Contents: Die Ozeane sind nicht nur der gröt︢e Lebensraum der Erde, sondern auch der am wenigsten erforschte. Die unermessliche Vielfalt dieses Ökosystems beginnen wir erst jetzt bis in die letzten Winkel zu begreifen auch wie wichtig das Meer für unser Leben ist. Im letzten Jahrhundert hat jedoch die Herrschaft des Menschen über die Natur auch die Ozeane erreicht: Wir fischen die Meere leer und füllen sie stattdessen mit Umweltgiften. Tiefseebergbau droht den Lebensraum unzähliger Pflanzen und Tiere bis zur Unkenntlichkeit zu verändern. Die Klimaerwärmung liess bereits ein Viertel aller Korallen zugrunde gehen. In seinem aufrüttelnden Buch beschreibt der Meeresbiologe und schützer Callum Roberts den grossen Reichtum der Ozeane und ihren Wandel, und er ruft dazu auf, der Zerstörung der Meere endlich Einhalt zu gebieten, denn noch ist es nicht zu spät
    Description / Table of Contents: Wir lieben das Meer und fürchten seine Gewalt. Wir nutzen es für die Seefahrt, und seit Jahrtausenden ernährt es uns. Aber erst jetzt beginnen wir diesen gigantischen Lebensraum in seinem Reichtum und in seiner Bedeutung für das Ökosystem Erde zu begreifen. Doch das Meer verändert sich unter dem Einfluss des Menschen, und der Wandel vollzieht sich immer schneller. Der scheinbar unerschöpfliche Ozean ist von Zerstörung bedroht. (Quelle: Text Verlagseinband / Verlag)
    Type of Medium: Monograph available for loan
    Pages: 588 Seiten, Tafeln , Illustrationen, Diagramme, Karten , 22 cm
    Edition: 1. Auflage
    ISBN: 3421044961 , 9783421044969
    Uniform Title: Ocean of life. How our seas are changing
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
    Call number: M 15.89085
    Type of Medium: Monograph available for loan
    Pages: 492 S , zahlr. Ill., graph Darst
    Edition: 2. aktualisierte u. erw. Aufl.
    ISBN: 3836219867 , 9783836219860
    Series Statement: SAP PRESS
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 52
    Call number: IASS 15.89488
    Keywords: Deutschland ; Forschung und Entwicklung ; Vertragsrecht
    Type of Medium: Monograph available for loan
    Pages: 183 S. , Ill., graph. Darst. , 22 cm
    ISBN: 9783415046658 (Pp.)
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 53
    Journal available for loan
    Journal available for loan
    München : Altop Verlag ; 2007 -
    Call number: Z 19.92410
    Type of Medium: Journal available for loan
    Pages: 30 cm
    ISSN: 1865-4266
    Former Title: Vorg. Nachhaltiges Wirtschaften in Deutschland
    Language: German
    Note: Ungezählte Beil. ab 2010: Special , Ersch. jährl. 4x
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
    Call number: AWI G3-19-92416
    Description / Table of Contents: The book contains proceedings of the Second International School on paleopedology for young scholars «Paleosoils as a source of information about past environments». Abstracts of main lectures, description of region where the School was carried out and papers of young scientists are published in the book. Proceedings of the School are of interest for researchers of soil science, paleogeography, Quaternary geology and ecology.
    Type of Medium: Monograph available for loan
    Pages: 145 Seiten , Illustrationen
    ISBN: 978-5-8406-0430-4
    Language: Russian , English
    Note: CONTENT Preface / M. Dergacheva, A. Makeev Description of study area and paleosol / M. Dergacheva, N. Mironycheva-Tokareva, S. Ponomarev, D. Gavrilov LECTURES Essentials of the paleopedology and a review of Quaternary paleosols of the Northern Hemisphere: main items, presented in the lectures / A. Makeev Paleosols in geologic history of the Earth / A. Makeev Possibilites and limits of pedohumus method used at investigations types and environment of ancient pedogenesis / M. Dergacheva Classification system of paleosols / I. Fedeneva Indicating function of pedogenic carbonates in paleoclimatic reconstruction of Holocene and Pleistocene / O. Khokhlova Miromorphological capacities for reseaching of palaeosoils / M. Lebedeva (Verba) Three-dimensional morphology of soil / A. V. Zakharchenko Paleomagnetic method for studing Pliocene and Quaternary deposits of Siberia (current status, problems, prospects) / Z. N. Gnibidenko Specific chemical state anthropogenic transformed soil of the ancient settlements / O. Yakimenko Geochemical peculiarities of soils as an indicator of specific of their formation and anthropogenic transformation / L. Rikhvanov REPORTS Problem of paleosols weed / A. Blagodatnova Spatial distribution of mobile phosphates in Kamennyi Ambar settlement (Chelyabinsk region) / K. Bojtsova Review of literature data for the study of humus horizon chernozem rate formation / E. Burnatova Pedogenic features in paleosols of Samara Volga region archaeological sites / D. Vassilieva Paleosols of Early Iron Age double kurgan of burial ground Kuigenzhar (Northern Kazakhstan) / D. Gavrilov, R. Ishmuratov, A. Toguzbaev Salt soils of Central-Tuva depression / Ch. Danchai-ool Humus composition of Zaural' e forest-steppe and steppe zones on example of archaeological sites / T. Zhdanova Properties variation of the upper part of the modern soils and surface paleosols of key site Volodarka (Barnaul Priobye) / H. Zhaharova Chernozems morphological properties of key area «Volodarka» / O. Kazachenok Comparative characteristics of the modern turf-podzolic soil and the soil buried under centenary dump (Sysert' District, Middle Urals) / L. Kirilyuk Paleopedology: objects and article of researches (review of publications in a «Soil Science» magazine for 2008-2010) / M. Komarova Soils with a buried humus horizon / B. Mongush Paleogeography formation conditions of Tuva sandy landscapes / Ch. Mongush, S. Kurbatskaya The comparative characteristic of 700-year-old and background soil near Sovetskiy city (middle taiga) / O. Nekrasova Humus soil memory: the conditions and time limits for the conservation of steppe / A. Nikiforov Study Holocene evolution of Central Tuva soil and soil formation / K. Ochur Estimation of restoration rate of damaged soils (on materials of studying archaeological objects of the foreststeppe zone) / E. Politova, V. Valdayskih Some polygenetic chernozem characteristics of the Ob Plateau Eastern edge (for example, the key area "Volodarka") / S. Ponomarev Vertical zonality soils in the Sayan mountains in Tuva / V. Sanchaiban Soil physical properties as a soil memory flash / E. Surkova Peculiarities of soddy-alluvial soil of the river Sysert' water-meadow (The Middle Urals) / A. Uchaev Aqueous extract composition of anthropogenically disturbed soils of Kamennyi Am bar settlement / D. Filimonova Environmental conditions of steppe soils for example near the village of Volodarka / H. Cherepanova New investigations at Tokaj-Csorgukut II. Loess section, Northeast Hungary / D. G. Páll, G. Persaits, P. Sümegi P Preliminary results on the phytoliths of the dutch neolithic site Swifterbant as seen from samples retrieved from soils, pig droppings and molars / G. Persaits, D. C. M. Raemaekers , In kyrillischer Schrift , Beiträge teilweise in englischer, teilweise in russischer Sprache
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 55
    Monograph available for loan
    Monograph available for loan
    Darmstadt : WBG (Wiss. Buchges.)
    Call number: 9/M 17.90844 ; 9/M 17.90844(2. Ex.)
    Type of Medium: Monograph available for loan
    Pages: 264 S. , zahlr. Ill., graph. Darst., Kt.
    Edition: 4., unveränd. Aufl.
    ISBN: 9783534262458
    Parallel Title: Erscheint auch als Vulkanismus
    Language: German
    Location: Reading room
    Location: Reading room
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 56
    Call number: (DE-599)GBV03709842X
    Type of Medium: Monograph available for loan
    Language: German
    Location: MOP - must be ordered
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
    Monograph available for loan
    Monograph available for loan
    München : Vahlen
    Call number: PIK B 160-19-92593
    Description / Table of Contents: Verlagsinfo: Die rasanten Entwicklungen in der Umweltpolitik in den vergangenen Jahren führten zu umfangreichen Anpassungen in diesem beliebten Lehrbuch, die insbesondere die anwendungsorientierten Abschnitte betreffen. Hier wurden vor allem die Kapitel über die Umweltinstrumente (Auflagen, Steuern, Zertifikate), die Kosten-Nutzen-Analyse sowie die internationalen Umweltaspekte (bspw. Klimakonferenzen) grundlegend aktualisiert. Darüber hinaus enthält das Kapitel zur Ressourcenökonomie nun ebenfalls eine anwendungsbezogene Diskussion.
    Type of Medium: Monograph available for loan
    Pages: XIV, 375 Seiten , Diagramme
    Edition: 4., vollständig überarbeitete Auflage
    ISBN: 3800646684 (kart.) , 9783800646685 (kart.) , 9783800643653 (electronic)
    Language: German
    Note: Contents: 1 Einführung ; 2 Einige spieltheoretische Grundlagen der Analyse ; 3 Theorie externer Effekte ; 4 Auflagen ; 5 Steuern und Abgaben (Preislösungen) ; 6 Zertifikate ; 7 Verhandlungslösungen ; 8 Umwelthaftung ; 9 Umwelttechnischer Fortschritt (dynamische Anreizwirkungen) ; 10 Internationale Aspekte des Umweltproblems ; 11 Umweltpolitik bei asymmetrischer Informationsverteilung ; 12 Kosten-Nutzen-Analyse ; 13 Ressourcenökonomie
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 58
    Monograph available for loan
    Monograph available for loan
    Marburg : Metropolis-Verl.
    Call number: IASS 17.91088
    Type of Medium: Monograph available for loan
    Pages: 295 S.
    ISBN: 9783731610342
    Series Statement: Beiträge zur Theorie und Praxis starker Nachhaltigkeit 5
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 59
    Call number: 8/M 23.95345
    Description / Table of Contents: In dem Text-Bild-Band werden Ergebnisse, Erlebnisse und Forschungsalltag eines langjährigen interdisziplinären Forschungsprojekts an der mittel- und südamerikanischen Pazifikküste, sowohl an Land als auch in der Tiefsee, einer breiten Öffentlichkeit vorgestellt. Dabei wechseln sich eindrucksvolle grossformatige Fotos, anschauliche Grafiken und spannende Interviews mit den Wissenschaftlern ab und ergeben so einen interessanten Einblick in die Vorgänge an Plattengrenzen und ihre Auswirkungen. Untersucht wurden z.B. die Zusammenhänge zwischen Subduktion, Gesteinskreislauf, Wasserkreislauf, Vulkanismus, Erdbeben, Hangrutschungen, Tsunamis, vulkanischen Klimagasen, Klimawandel, Leben in der Tiefsee, Gashydraten, Ozonschicht und möglichen Eingriffen in das Klima. Dabei interessierten vor allem Entstehung, Abläufe und Auswirkungen der Naturkatastrophen auch im Hinblick auf entsprechende Frühwarnsysteme. Spannende, eindrucksvolle und anschauliche Ergänzung zu "Naturgewalten" (ID-A 46/12), "Der unruhige Planet" (BA 2/06) und "Naturkatastrophen" (BA 11/09). Gern empfohlen. (2 S)
    Type of Medium: Monograph available for loan
    Pages: 197 Seiten , Illustrationen
    ISBN: 9783529054372
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
    Monograph available for loan
    Monograph available for loan
    Köln : KOMET
    Call number: M 23.95503
    Type of Medium: Monograph available for loan
    Pages: 352 Seiten , Illustrationen , 31 cm
    ISBN: 9783898369923
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 61
    Monograph available for loan
    Monograph available for loan
    Nürnberg : Tessloff Verlag Ragnar Tessloff GmbH & Co. KG
    Call number: 22/M 18.91648
    Description / Table of Contents: Es gibt mehr als 1.500 Vulkane auf der Erde, die in den letzten 10.000 Jahren aktiv waren. Etwa 500 davon sind in historischer Zeit, also seit die Menschen von Ereignissen berichten, mindestens einmal ausgebrochen. Wie entsteht Vulkanismus? Ist er nur gefährlich oder auch nützlich? Wo befinden sich die berüchtigsten Vulkane? Wie arbeiten Vulkanologen?
    Type of Medium: Monograph available for loan
    Pages: 48 Seiten , Mit vielen Fotos, Illustrationen und Infografiken , 28 cm
    ISBN: 978-3-7886-2044-8
    Series Statement: Was ist Was Band 57
    Language: German
    Location: Reading room/gallery
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 62
    Call number: IASS 16.90504
    Type of Medium: Monograph available for loan
    Pages: XI, 386 S. , Ill., graph. Darst.
    ISBN: 3658025808 (Pbk.) , 9783658025809 (Pbk.) , 9783658025816 (eBook)
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Monograph available for loan
    Monograph available for loan
    Berlin [u.a.] : de Gruyter
    Call number: IASS 16.90521
    Type of Medium: Monograph available for loan
    Pages: VIII, 703 S. , graph. Darst.
    ISBN: 9783110312881 , 9783110312959 (electronic)
    Series Statement: Narratologia 35
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
    Monograph available for loan
    Monograph available for loan
    München : Knesebeck
    Call number: PIK N 531-19-92434
    Type of Medium: Monograph available for loan
    Pages: 185 Seiten , Illustrationen, Karten , 27 x 31 cm
    Edition: Deutsche Originalausgabe
    ISBN: 3868733604 , 9783868733600
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 65
    Call number: PIK A 190-19-92162
    Description / Table of Contents: Allein auf technologische Innovationen und lineares Wachstum zu setzen, reicht nicht länger, um die fundamentalen Umbrüche dieser Zeit zu bewältigen. Ein neues Fortschrittsverständnis gewinnt an Kontur, in dem soziale, institutionelle und systemische Innovationen von zentraler Bedeutung sind. Damit stellen sich auch neue Anforderungen an die Wissenschaft.
    Type of Medium: Monograph available for loan
    Pages: 419 Seiten , Diagramme
    ISBN: 3731610035 , 9783731610038
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Call number: M 19.92550
    Type of Medium: Monograph available for loan
    Pages: 282 Seiten , Illustrationen, Diagramme , 19 x 24 cm
    ISBN: 9783593394749
    Uniform Title: Business model generation
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    Monograph available for loan
    Monograph available for loan
    Frankfurt am Main : Suhrkamp
    Associated volumes
    Call number: M 19.92569
    In: Sphären
    Type of Medium: Monograph available for loan
    Pages: 916 Seiten , Illustrationen
    Edition: 7. Auflage
    ISBN: 978-3-518-41466-8
    Series Statement: Sphären 3
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Call number: AWI A4-19-20532
    Type of Medium: Monograph available for loan
    Pages: 36 Seiten , Illustrationen
    Language: German
    Note: Inhalt Vorwort Einleitung: Unser Klima aus der Polarperspektive Verbessertes Verständnis arktischer Klimaänderungen durch Messungen und Modellierung Physikalische Prozesse in der polaren Atmosphäre Langzeit-Messreihen zeigen: Ozonschicht über der Antarktis konnte sich noch nicht erholen Arktischer Meereisrückgang verursacht Anomalien in Ozean und Atmosphäre HAFOS erfasst längerfristige Veränderungen im Ozean Meereisspiegel im Nordatlantik in nur 15 Jahren um 6 cm gestiegen Eis im Klimawandel Erderwärmung gefährdet die Permafrost-regionen und damit das globale Klimasystem Marine Klimaarchive – Aus der Vergangenheit lernen, um den Blick in die Zukunft zu schärfen Paläoklimamodelle: Zurück in die Zukunft Marines Plankton beeinflusst das globale Klima Die regionalen Auswirkungen des Klimawandels rücken in den Blickpunkt Das World Radiation Monitoring Center am AWI: weltweite Datenzentrale der Erdsystemforschung Klimaberatung: regionalspezifisch, verständlich, solide – das Helmholtz-Klimabüro am AWI Die stationären und mobilen Infrastrukturen des Alfred-Wegener-Instituts in Arktis und Antarktis Ansprechpartner im AWI, Impressum
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    Call number: AWI G3-17-91084-1
    In: Kvarter vo vsem ego mnogoobrazii, Tom 1
    Type of Medium: Monograph available for loan
    Pages: 319 S. , Ill., graph. Darst., Kt.
    ISBN: 978-5-91918-123-1
    Language: Russian , English
    Note: TABLE OF CONTENTS: Predislovie. - Problems of absolute chronology and correlation of the Pleistocene glaciations in Gorny Altai / A. R. Agatova, R. K. Nepop. - Ecological and geomorphological consequences of mineral deposits development in conditions of the arid zone of Kazakhstan / K. M. Akpambetova. - Forming conditions of bottom sediments of Prokopievskoe Lake (Northern Karelia) according to the diatoms data / A. N. Alekseeva, O. P. Korsakova. - Lithostratigraphy of the quaternary deep sea sediments / T. N. Alekseeva, V. N. Sval'nov. - Climatic records from sediments of Elgygytgyn Lake (Polar Chukotka) / P. M. Anderson, A. V. Lozhkin. - First records of environmental change from lake sediments of the Kuril Archipelago / P. M. Anderson, A. V. Lozhkin, P. S. Minuyk, A. Yu. Pakhomov, T. B. Solomatkina, M. V. Cherepanova. - Late Pliocene / early Pliocene environments of the North-Eastern Siberian Arctic inferred from Lake El'gygytgyn pollen record / A. A. Andreev, M. Melles, V. Wennrich, J. Brigham-Grette. - The middle Neopleistocene of the Timan-Pechora-Vychegda Region / L. N. Andreicheva. - Kargian megainterstadial of the Prebaikalia: geochronology and paleogeography / Kh. A. Arslanov, N. E. Berdnikova, S. B. Chernov, G. A. Vorobioba, I. V. Enuschenko, D. V. Kobylkin, R. E. Maksimov, Yu. V. Ryzhov, A. A. Starikova. - The human and environment of Southeast Baltic on the boundary of the Pleistocene and the Holocene / Kh. A. Arslanov, O. A. Druzhinina, M. A. Kulkova, T. V. Sapelko, D. A. Subetto, I. N. Skhodnov. - Age of soil-pyroclastic sequences and chronology of volcanic activity on Matua Island (Central Kurils) during the Holocene / Kh. A. Arslanov, I. V. Melekestsev, N. G. Razjigaeva, A. V. Degterev, A. V. Rybin. - Summary of the Upper Pleistocene correlations in the Russian North / V. I. Astakhov. - Holocene climatic events in Amur River Basin and their correlation / V. B. Bazarova, L. M. Mokhova, T. A. Grebennikova. - About a western boundary of Dnieper glaciation on the southern east-european platform / M. Bargl. - On the causes of two most significant events of the Holocene / A. A. Barenbaum. - On the issue of the construction of the quaternary stratigraphy scale and frequency of the meteoric impacts / A. A. Barenbaum. - Stratigraphy of the sediments from the Mendeleev Rise, (Central Arctic Ocean), based on benthic foraminifera and ostracoda / V. A. Basov, N. V. Kupriyanova, E. S. Novikhina. - Paleosecular geomagnetic variations and late Weichselian Holocene magnetochronology in N-W Russia / V. G. Bakhmutov. - Biostratigraphy of sediments middle and late Holocene in the basin downstream Ussuri / P. S. Belyanin. - The palynology characteristic of loess loam sediments of Ussuri-Khankarazdolnaya depression in the middle and late Neopleistocene / P. S. Belyanin, N. I. Belyanina. - Glacio-marine deposits on the Northern Prinze Charls Mountains (East Antarctica) / A. S. Birjukov, M. S. Egorov. - Features of environmental and climatic changes in the Northern Caspian Sea Region and Caspian Sea Level fluctuations controlled by climate during the Holocene / N. S. Bolikhovskaya. - "Milankovitch Theory" - What does it mean? / V. A. Bolshakov. - MIS 11 problem and supposed 400-kyr Pleistocene climate cycle / V. A. Bolshakov, I. A. Karevskaya. - Sedimentation in the Kamennoe Lake (Kanin Peninsula) and climate changes during the Holocene according to the lake sediments / D. Yu. Bolshiyanov, P. S. Vakhrameeva, G. B. Fedorov, N. A. Bakunov, T. V. Sapelko, A. V. Ludikova, A. S. Makarov, M. V. Pavlov. - Relief and quaternary deposits of the South-Eastern Part of Taimyr Peninsula / D. Yu. Bolshiyanov, G. B. Fedorov, A. V. Krylov, Kh. A. Arslanov, J. Tide. - Last glaciation of the Russian Arctic / B. A. Borisov, E. A. Minina. - Short-term landscape and climatic oscillations in the late glacial: the main steps, results and future prospects of research / O. K. Borisova. - Late Quaternary Plankton biostratigraphy in the Knipovich Ridge Area (North Atlantic) / M. E. Bylinskaya, L. A. Golovina, E. P. Radionova. - Palaeolimnological investigations in the Laptev Sea Region / P. S. Vakhrameeva, D. A. Subetto, B. Diekmann, B. Biskaborn, L. Heinecke, G. Muller. - Strucute and genesis of Gorodok elevation in North-East Belarus / A. Vashkov. - Present problems in the Quaternary (Postapsheronskii) stratigraphy and geochronology of the Caspian Sea Sediments / S. S. Veliev, E. N. Tagieva. - Problem of paleogeography of East Europe in late Pliocene and early Pleistocene / A. A. Velichko, V. V. Pisareva, M. A. Faustova. - Regularities of modern relief organization of Kolyma lowland tundra landscapes (Northeast Siberia) - Remote sensing and GIS Studies / A. A. Veremeeva. - The joint German-Russian Polygon Project - Environmental studies in East Siberian Tundra wetlands / S. Wetterich, A. Bobrov, U. Herzschuh, H. Joosten, L. Pestryakova, E.-M. Pfeijfer, L. Kutzbach, L. Schirrmeister, D. Subetto, V. Tumskoy. - Interglacial environments of Oyogos Yar (Dmitry Laptev Strait) / S. Wetterich, R. Kienast, S. Kuzmina, A. A. Andreev, L. Nazarova, L. Schirrmeister, V. V. Kunitsky. - Geological significance of section "Ogurtsovo" in district of Novosibirsk / I. A. Volkov, S. P. Kazmin. - Present problems of the Quaternary period stratigraphy of the West and Middle Siberia / V. S. Volkova. - New data on the evolution and age of sediments, enclosing the cultural horizon of middle Paleolithic Site Khotylevo-1 (River Desna Basin) / E. V. Voskresenskaya, L. B. Vishniytskiy, I. S. Zuganova, E. U. Novenko, A. K. Ocherednoy. - The Lake Sedimentogenez and features of the Paleogeography Prihankayskoy depression in Late Cenozoic / T. N. Voskresenskaya. - Relief and loose desposits of the Russian Plain main watershed protected areas in the South-East Onega / A. I. Voskresenskiy, I. S. Voskresenskiy, A. N. Kichigin. - Distribution of cryogenic micro relief in low mountainous massifs of the Kola Peninsula / E. V. Garankina. - Change of landscapes in early Pleistocene histories of East European Plane / N. I. Glushankova. - Some structural and mapping features of water-glacial deposits of the Don horizon / B. V. Glushkov, G. V. Kholmovoy. - Using dem for tasks of Quaternary geology and geomorphology of Siberia / N. V. Glushkova, V. A. Lyamina, I. D. Zolnikov, N. N. Dobretsov, V. P. Afanas'ev, D. A. Samdanov, I. I. Boldirev, S. A. Semenova. - Reference horizons of volcanic ash in Quaternary deposits of the Northern Coast of Okhotsk Sea / O. Yu. Glushkova, V. N. Smirnov. - Problems of the Eopleistocene volumes in the South-Eastern West Siberian Plate in the context of the Quaternary bottom lowering / A. G. Golovina, V. S. Volkova. - An influence of coastal processes on sedimentogenesis in the Tsymlyanskoye reservoir / N. V. Golubova. - Environments during the time of initial human settlement of the Kola Peninsula / I. M. Grekov, E. A. Kosheleva. - Mesostratigraphy of middle- and late valdai loess-like loams as the marker of low-range ecosystematic rearrangements / L. A. Gugalinskaya, V. M. Alifanov. - Relief and quaternary sediments from outer part of East Siberian Sea: new data / E. A. Gusev, A. G. Zinchenko, N. Yu. Anikina, L. G. Derevyanko, V. V. Popov. - The Middle Holocene parastratotype old Kieshki Site and its palaeobotanic characteristic (Southern Foreurals) / G. A. Danukalova, E. G. Lapteva, O. M. Korona. - Results of the Mollusc study of the late Pliocene early Quaternary Novosultanbekovo Site (Southern Foreurals) / G. A. Danukalova, E. M. Osipova. - Natural and anthropogenic factors of formation of chemical composition of sediments of lakes of North Fennoscandia / V. A. Dauvalter, N. A. Kashulin, S. S. Sandimirov. - Difficulties of long-term air temperature time series finding for climatological problems / V. I. Demin. - Diatom complexes changes in academicheskoe lake sediments (Khibiny Massif, Kola Peninsula) / D. B. Denisov. - Natural features of sedimentogenesis in the lake of the Eastern slope o , In kyrill. Schr. , In engl. und rus. Sprache
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Call number: PIK B 160-20-93485
    Type of Medium: Monograph available for loan
    Pages: 156 Seiten , Illustrationen, Diagramme , 210 mm x 148 mm
    ISBN: 9783865812599 (Gb.)
    Language: German
    Note: Contents: 1 Hinweise zu Markt und Ökonomie ; 2 Soziale Marktwirtschaft – Die Wurzel des ökosozialen Marktparadigmas ; 3 Das ökosoziale Paradigma – 1975 bis 2000 ; 4 Das ökosoziale Paradigma – die Zeit ab 2000 ; 5 Marktfundamentalismus – Viele Fragezeichen ; 6 Das Konzept der Planetengrenze – Ein ökosozialer Ansatz ; 7 Weltfinanzsystem und Klimafrage – »Freie Märkte« führen ins Desaster ; 8 Wohlstand und Nachhaltigkeit – Die ökosoziale Fundamentalidentität ; 9 Soziale Balance schafft Akzeptanz und den höchsten Wohlstand ; 10 Was droht, wenn die ökosoziale Wende nicht gelingt? ; 11 Global Marshall Plan – Schritte in die richtige Richtung ; 12 Ökosoziales Paradigma, Wachstumserfordernisse, doppelter Faktor 10 ; 13 Ökosoziale Marktwirtschaft als Zukunftsmodell – Die Antwort auf die Krise ; 14 Ökosoziale Marktwirtschaft – Wichtige Merkmale ; 15 Gibt es Hoffnung?
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Monograph available for loan
    Monograph available for loan
    München : Verlag Franz Vahlen
    Call number: PIK B 541-20-93973
    Type of Medium: Monograph available for loan
    Pages: XIV, 217 Seiten , Diagramme
    Edition: 3., vollständig überarbeitete Auflage
    ISBN: 3800634120 (Pb.) , 9783800634125 (Pb.) , 9783800644759 (electronic)
    Series Statement: Vahlens-Kurzlehrbücher
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    Call number: M 19.93233
    Description / Table of Contents: Wahrnehmung, Nutzung und Management von Umwelt und Naturressourcen werden maßgeblich durch politische Herrschaftsformen beeinflusst – so die These der Politischen Ökologie. Folglich führen systemische Umbrüche und Transformationen von Politik, Ökonomie und Gesellschaft zu Restrukturierungen von Institutionen und zu Modifikationen des Umgangs mit der Umwelt. Inwieweit die politischen Systeme in dem durch markante historische Zäsuren geprägten Mittelasien die Wechselwirkungen von Mensch und Umwelt beeinflussen, steht im Zentrum der vorliegenden Studie. Unter Anwendung des Analyserahmens der Politischen Ökologie leistet die Studie einen Beitrag zur Postsozialismus- und Entwicklungsforschung. Die Konzentration auf Akteure, Institutionen und Ressourcenmanagement am empirischen Fallbeispiel in Kirgistan trägt zum besseren Verständnis postsozialistischer Transformations- und Dekolonisationsprozesse bei und verdeutlicht deren konkrete Auswirkungen auf die lokale Ebene. Damit wird deutlich, wie weltpolitische Ereignisse einerseits auf periphere Räume und marginalisierte Gesellschaften ausstrahlen, wie andererseits aber auch deren Situation und Handlungen Teil globaler Entwicklungen sind.
    Type of Medium: Monograph available for loan
    Pages: 400 Seiten , Illustrationen
    ISBN: 978-3-515-10478-4
    Series Statement: Erdkundliches Wissen 153
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
    Monograph available for loan
    Monograph available for loan
    Darmstadt : WBG, Wiss. Buchges.
    Call number: M 20.93926
    Description / Table of Contents: Das Abschmelzen der Polkappen und der Anstieg des Meeresspiegels sowie die daraus resultierenden Veränderungen des Planeten gehören zu den Hauptängsten der Menschheit im 21. Jahrhundert. Umso erstaunlicher ist es, dass sich Philosophie und Ethik bislang noch nicht intensiver mit der Problematik beschäftigt haben. James Garvey liefert mit seinem nun auch auf Deutsch vorliegenden Werk eine grundlegende philosophische Auseinandersetzung mit dem Thema Klimawandel. Eindringlich beschreibt er zunächst die ökologischen Probleme, die uns in den nächsten Jahrzehnten beschäftigen werden, sowie die daraus resultierenden philosophisch-ethischen Fragen. Dann entwickelt er mit zahlreichen Beispielen eine Ethik, die den neuen Herausforderungen gerecht werden kann. Auf lebendige und stilistisch ansprechende Weise zeigt er, dass ein Wandel im gesellschaftlichen Denken und Handeln auch und gerade von der Philosophie ausgehen muss, um nachhaltige Wirkung zeigen zu können.
    Type of Medium: Monograph available for loan
    Pages: 176 Seiten , Illustrationen
    ISBN: 978-3-534-23540-7
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 74
    Call number: M 20.94087
    Type of Medium: Monograph available for loan
    Pages: 656 Seiten , Illustrationen
    Edition: 3., aktualisierte und erweiterte Auflage
    ISBN: 3836219522 (Pp.) , 9783836219525 (Pp.)
    Series Statement: SAP Press
    Former Title: Vorangegangen ist mySAP HR - technische Grundlagen und Programmierung
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Call number: AWI S6-22-94784
    Type of Medium: Monograph available for loan
    Pages: 43 Seiten , Illustrationen (farbig)
    Language: German
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    Monograph available for loan
    Monograph available for loan
    Berlin [u.a.] : Springer
    Call number: IASS 20.94047
    Type of Medium: Monograph available for loan
    Pages: XVII, 244 S. , Ill., graph. Darst.
    ISBN: 9783642082412
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Call number: AWI G6-22-94848
    Description / Table of Contents: Появившиеся в последние десятилетия новые данные (множественные радиометрические определения возраста памятников, в том числе их ряды, для памятников голоценового каменного века Северо-Восточной Азии), а также новые геоархеологические объекты (например, палеолитическая Янская стоянка - самый северный памятник раннего верхнего палеолита мира), позволяют обратиться к рассмотрению проблем хронометрии последовательностей культурноисторического развития Северо-Востока Азии в позднем неоплейстоцене и голоцене, в эпохи, предшествовавшие формированию современной этнической карты этих территорий. Наибольшее внимание в предлагаемой работе уделено проблемам радиоуглеродной хронологии и хроностратиграфии памятников верхнего палеолита, документирующих на настоящий момент древнейшие достоверные этапы расселения человека на Северо-Востоке Азии. Для археологов, специалистов в области четвертичной геологии, геоморфологов, палеогеографов.
    Type of Medium: Monograph available for loan
    Pages: 263 Seiten , Illustrationen , 25 cm
    ISBN: 9785020255203
    Language: Russian
    Note: CONTENTS Preface lnroduction Chapter I. Radiocarbon chronology and chronostratigraphy of the Paleolith of NE Asia: Statement of a Question Chapter II. Paleolithic sites of the Aidan River Valley Features of geology and geomorphology of Aldan valley Age and validity of archaeological sites in Aldan valley "Tectonic hypothesis" Chronostratigraphy of the Late Pleistocene and Holocene sites in Aldan valley Chapter III. Archaeological sites of the Yana-Indighirka Lowland The Yana site It's discovery and history of research General description of the site area Deposits of the second terrace of Yana River and position of the cultural layer of the Yana site Radiocarbon age of the cultura layer Archaeological finds Fauna remains The Berelekh site History of research Geological profile and radiocarbon chronology of Berelekh geocomplex Archaeological component of Berelekh geocomplex Fauna remains Chapter IV. Radiocarbon dated Paleolithic site of NE Asia beyond the Aidan valley and Coastal (Yana-Kolyma) lowland Geoarchaeological objects of Upper and Middle Lena River Archaeological sites of Kolyma River basin and Sea of Okhotsk and Kolyma River watershed Ushki sites in Kamchatka Peninsula Concluding remarks for the Fourth Chapter Chapter V. Basic elements of radiocarbon chronology of the Holocene Stone Age of NE Asia Chapter VI. Radiocarbon chronology, archaeological periodization and peculiarities of cultural development of the Late Pleistocene and Holocene of NE Asia Conclusions Summary References List of abbreviations Radiocarbon laboratory's codes List of illustrations List of tables Appendices Table 1. Radiocarbon dates of archaeological site of NE Asia Table 8. A synopsis for geomorphology of 14C dated Late Pleistocene and Early Holocene archaeological sites of NE Asia , СОДЕРЖАНИЕ Предисловие Введение Глава I. Радиоуглеродная хронология и хроностратиrрафия палеолита Северо- Востока Азии: постановка проблемы Глава II. Памятники палеолита в долине р. Алдан Особенности строения долины р. Алдан Возраст и валидность археологических памятников Алдана «Тектоническая гипотеза» Хроностратиграфия памятников позднего неоплейстоцена и голоцена Алдана Глава III. Памятники Яно-Индиrирской низменности Янская стоянка История открытия и изучения Общая характеристика района стоянки Отложения разреза второй надпойменной террасы р. Яны и положение культурного слоя Янской стоянки Радиоуглеродный возраст культурного слоя Археологическая составляющая Фаунистическая характеристика Стоянка Берелёх История изучения Характеристика разреза и хронология Берелёхского комплекса Археологическая составляющая Берелёхского комплекса Комплекс фаунистических находок Глава IV. Датированные памятники палеолита Северо-Восточной Азии вне пределов долины Алдана и Приморской (Я но-Колымской) низменности Геоархеологические объекты Верхней и Средней Лены Памятники Колымской системы и Охотска-Колымского водораздела Комплекс Ушковских стоянок (Камчатский полуостров) Заключительные замечания к разделу Глава V. Основные черты радиоуглеродной хронологии rолоценовых памятников каменноrо века Северо-Восточной Азии Глава VI. Радиоуглеродная хронология, археологическая периодизация и особенности культурно-исторических процессов позднего неоплейстоцена и rолоцена Северо-Восточной Азии Заключение Summary Литература Список сокращений Список иллюстраций Список табличного материала Список индексов лабораторий, проводящих радиоуглеродное датирование Приложения Таблица 1. Список радиоуглеродных дат археологических объектов Северо-Востока Азии Таблица 8. Краткий конспект геоморфологического положения датированных поздненеоплейстоценовых и раннеrолоценовых археологических памятников Северо-Востока Азии , Zusammenfassung in englischer Sprache , In kyrillischer Schrift
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    Monograph available for loan
    Monograph available for loan
    Moskva : Iževsk
    Call number: AWI G3-22-94851
    Description / Table of Contents: В книге рассматриваются два природных объекта, определяющие многие особенности природы России - климат и вечная мерзлота. Представлена сложная многоплановая связь вечной мерзлоты ( ее температуры, распространения, криогенных процессов) с климатом, динамика мерзлоты под влиянием неоднократных изменений климата на протяжении последних этапов геологической истории Земли и в наше время. Изложены современные представления об изменениях климата и его причинах (естественного и антропогенного характера), периодичности колебаний. Исследуется реакция вечной мерзлоты на изменения климата - естественные (колебательные, с разными периодами колебаний) и антропогенные, включая техногенное воздействие (направленного характера). Книга написана для широкого круга специалистов - географов, геологов, инженеров, преподавателей, студентов, чья профессиональная деятельность связана с районами распространения вечной мерзлоты, а также для всех тех, кто интересуется науками о Земле.
    Description / Table of Contents: Translation of the abstract: The book deals with two natural objects that determine many of the features of Russia's nature - climate and permafrost. The complex multifaceted relationship of permafrost (its temperature, distribution, cryogenic processes) with climate is presented, the dynamics of permafrost under the influence of repeated climate changes during the last stages of the geological history of the Earth and in our time. Present-day ideas about climate change and its causes (natural and anthropogenic) and periodicity of fluctuations are presented. The reaction of permafrost to climate change - natural (oscillatory, with different periods of fluctuations) and anthropogenic, including technogenic impact (directional nature) is being studied. The book is written for a wide range of specialists - geographers, geologists, engineers, teachers, students whose professional activities are related to permafrost areas, as well as for all those who are interested in the Earth sciences.
    Type of Medium: Monograph available for loan
    Pages: 198 Seiten , Illustrationen
    ISBN: 978-5-93972-864-5
    Series Statement: Serija "Nauki o zemle"
    Language: Russian
    Note: ОГЛАВЛЕНИЕ Предисловие Глава 1. СОВРЕМЕННЫЕ ЗАКОНОМЕРНОСТИ РАСПРОСТРАНЕНИЯ ВЕЧНОЙ МЕРЗЛОТЫ (КРИОЛИТОЗОНЫ) КАК СЛЕДСТВИЕ СОВРЕМЕННОГО КЛИМАТА 1.1. Общие закономерности распространения мерзлоты 1.2. Внутрирегиональные закономерности распространения мерзлоты 1.2.1. Теплообмен между горными породами и атмосферой. Годовой тепловой баланс 1.2.2. Тепловой баланс земной поверхности и криолитозона Забайкалья 1.2.3. Тепловой баланс земной поверхности и криолитозона Западной Сибири Глава 2. СОВРЕМЕННЫЕ ПРЕДСТАВЛЕНИЯ О ГЛОБАЛЬНЫХ ИЗМЕНЕНИЯХ КЛИМАТА И ИХ ПРИЧИНАХ 2.1. Изменения климата под влиянием естественных факторов 2.2. Изменения климата под влиянием антропогенных факторов Глава 3. ДИНАМИКА КРИОЛИТОЗОНЫ КАК СЛЕДСТВИЕ ГЛОБАЛЬНЫХ ИЗМЕНЕНИЙ КЛИМАТА 3.1. Реакция вечной мерзлоты на изменения климата. Проникновение колебаний температуры воздуха в горные породы 3.2. Реакция мерзлоты на изменения климата в плейстоцене 3.3. Реакция мерзлоты на современные изменения климата 3.4. Влияние климата и его изменений на криогенные процессы 3.5. Влияние климата и его изменений на устойчивость ландшафтов криолитозоны к техногенным нагрузкам 3.6. Влияние колебаний климата на субгляциальную криолитозону Заключение Литература ПРИЛОЖЕНИЕ 1. Таблица. Средние многолетние данные метеорологических наблюдений в Забайкалье ПРИЛОЖЕНИЕ 2. Графики. Средняя месячная и средняя годовая температура грунта на склонах Центрального Забайкалья. Режимные измерения в скважинах ПРИЛОЖЕНИЕ 3. Графики. Средняя месячная и средняя годовая температура грунта в долинах рек Центрального Забайкалья. Режимные измерения в скважинах ПРИЛОЖЕНИЕ 4. Графики. Средняя месячная и средняя годовая температура грунта в Восточном Забайкалье. Режимные измерения в скважинах ПРИЛОЖЕНИЕ 5. Графики. Средняя месячная и средняя годовая температура грунта в Юго-Восточном Забайкалье. Наблюдения в скважинах ПРИЛОЖЕНИЕ 6. Таблица. Тепловой баланс поверхности и его составляющие для Западной Сибири ПРИЛОЖЕНИЕ 7. Таблица. Радиационный баланс на склонах Западной Сибири ПРИЛОЖЕНИЕ 8. Словарь терминов ПРИЛОЖЕНИЕ 9. Предметный указатель
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
    Monograph available for loan
    Monograph available for loan
    München : Vahlen
    Call number: IASS 22.95052
    Type of Medium: Monograph available for loan
    Pages: XIV, 257 S. , Ill., graph. Darst.
    Edition: 3., überarb. und erw. Aufl.
    ISBN: 3800638010 , 9783800638017
    Series Statement: Controlling Competence
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 80
    Call number: AWI G3-22-94740
    Description / Table of Contents: В книге представлены результаты 15-летних (1998-2012 гг.) российско-германских комплексных исследований дельты р. Лены. На материалах геоморфологических, геологических, геокриологических исследований выявлены основные этапы развития дельты в голоцене, а также в позднем неоплейстоцене. Ведущим фактором формирования дельты были колебания уровня моря Лаптевых. Книга может быть полезна тем, кто интересуется палеогеографией, палеоклиматологией, колебаниями уровня моря.
    Description / Table of Contents: The book presents the results of 15-year (1998-2012) Russian-German comprehensive studies of the river delta. Lena. Based on the materials of geomorphological, geological, geocryological studies, the main stages in the development of the delta in the Holocene, as well as in the late Pleistocene, were revealed. The leading factor in the formation of the delta was fluctuations in the level of the Laptev Sea. The book may be useful to those who are interested in paleogeography, paleoclimatology, sea level fluctuations.
    Type of Medium: Monograph available for loan
    Pages: 268 Seiten , Illustrationen
    ISBN: 978-5-98364-056-6
    Language: Russian
    Note: Содержание Введение 1. Физико-географический очерк дельты реки Лены 2. История изучения дельты реки Лены 3. Геолого-геоморфологическое строение дельты реки Лены 3.1. Геологическое строение 3.1.1. Дочетвертичные отложения 3.1.2. Четвертичные отложения 3.1.2.1. Строение четвертичных отложений в дельте и на побережье моря Лаптевых 3.1.2.2. Скважины бурового профиля «Мамонтов Клык» 3.1.2.3. Строение, состав и возраст осадков, слагающих остров Арга-Муора-Сисё в северо-западной части дельты реки Лены 3.1.2.4. Разрезы голоценовых отложений в дельте 3.1.2.5. Торфяные залежи или аллохтонный растительный материал? 3.2. Геоморфологическое строение дельты и прилегающих территорий, современные геоморфологические процессы 3.2.1. Геоморфологическое строение отдельных участков 3.2.1.1. Устье Оленёкской протоки 3.2.1.2. Центральная часть дельты 3.2.1.3. Район острова Сардах-Хая 3.2.1.4. Долина реки Урасалах 3.2.1.5. Долина реки Кэлимээр, приустьевой участок и дельта реки Оленёк 3.2.1.6. Морские террасы в дельте реки Лены и в районе Дельты 3.2.2. Геоморфологическое строение дельты реки Лены 3.2.3. Русловые деформации и перераспределение стока по рукавам 3.2.3.1. Главное русло 3.2.3.2. Сардахско-Трофимовский узел разветвления 3.2.3.3. Оленёкско-Булкурский узел разветвления 3.2.3.4. Туматская протока 3.2.3.5. Причины перераспределения стока в дельте 3.2.4. Динамика акватории на отдельных участках 4. Происхождение и развитие дельты реки Лены 4.1. Происхождение ледового комплекса пород 4.2. Происхождение острова Арга-Муора-Сисё 4.3. Происхождение дельты реки Лены 4.3.1. Модель развития дельты в голоцене 4.3.2. Колебания уровня моря в голоцене 4.3.3. Современные колебания уровня 4.3.4. Развитие дельты в голоцене 5. Колебания климата 5.1. Колебания климата в голоцене 5.1.1. Материалы и методы 5.1.2. Донные отложения озера Николай-Кюеле 5.1.3. Донные отложения озера Севастьян-Кюеле 5.1.4. Донные отложения других озер района дельты реки Лены 5.1.5. Палеоклиматические события голоцена по данным изучения четвертичных отложений 5.1.6. Общие результаты 5.2. Колебания климата последнего тысячелетия 5.3. Современные климатические изменения и режим многолетнемерзлых пород 6. Пассивные ледники в дельте реки Лены и в окружающих горах 7. Колебания уровня моря - первопричина возникновения ледового комплекса пород и дельты реки Лены Заключение Список литературы , Translated table of contents Introduction 1. Physical and geographical outline of the Lena River Delta 2. The history of the study of the delta of the Lena River 3. Geological and geomorphological structure of the delta of the Lena River 3.1. Geological structure 3.1.1. Pre-Quaternary deposits 3.1.2. Quaternary deposits 3.1.2.1. The structure of Quaternary deposits in the delta and on the coast of the Laptev Sea 3.1.2.2. Wells of the drilling profile "Mammoth Klyk" 3.1.2.3. The structure, composition and age of the sediments composing the island of Arga-Muora-Sisho in the northwestern part of the Lena River Delta 3.1.2.4. Sections of Holocene deposits in the delta 3.1.2.5. Peat deposits or allochthonous plant material? 3.2. Geomorphological Structure of the Delta and Adjacent Territories, Modern Geomorphological Processes 3.2.1. Geomorphological structure of individual sections 3.2.1.1. The mouth of the Olenyok channel 3.2.1.2. The central part of the delta 3.2.1.3. The area of ​​the island of Sardakh-Khaya 3.2.1.4. Valley of the river Urasalakh 3.2.1.5. The valley of the Kalimeer river, the estuarine section and the delta of the Olenyok river 3.2.1.6. Sea terraces in the delta of the Lena River and in the Delta region 3.2.2. Geomorphological structure of the delta of the Lena River 3.2.3. Channel deformations and redistribution of runoff along the branches 3.2.3.1. The main channel 3.2.3.2. Sardakh-Trofimov branching point 3.2.3.3. Olenyok-Bulkur branching point 3.2.3.4. Tumatskaya duct 3.2.3.5. Causes of Runoff Redistribution in the Delta 3.2.4. Dynamics of the water area in separate areas 4. Origin and development of the Lena river delta 4.1. The origin of the ice complex of rocks 4.2. The origin of the island of Arga-Muora-Sisho 4.3. Origin of the Lena River Delta 4.3.1. Model of delta development in the Holocene 4.3.2. Sea level fluctuations in the Holocene 4.3.3. Modern Level Fluctuations 4.3.4. Development of the delta in the Holocene 5. Climate fluctuations 5.1. Climate fluctuations in the Holocene 5.1.1. Materials and methods 5.1.2. Bottom sediments of Lake Nikolai-Kyuele 5.1.3. Bottom sediments of Lake Sevastyan-Kyuele 5.1.4. Bottom sediments of other lakes in the Lena River delta region 5.1.5. Paleoclimatic events of the Holocene according to the study of Quaternary deposits 5.1.6. General results 5.2. Climate fluctuations of the last millennium 5.3. Modern Climatic Changes and the Regime of Permafrost 6. Passive glaciers in the delta of the Lena River and in the surrounding mountains 7. Fluctuations in sea level - the root cause of the formation of the ice complex of rocks and the delta of the Lena River Conclusion References , In kyrillischer Schrift
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Call number: IASS 22.95033
    Type of Medium: Monograph available for loan
    Pages: 378 S , 225 mm x 135 mm
    ISBN: 3899421876 , 978-3-89942-187-3
    Series Statement: Edition panta rei
    Language: German
    Note: Zugl.: Marburg (Lahn), Univ., Habil.-Schr., 2004 u.d.T.: Gutmann, Mathias: Die Medialität des Erfahrens
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Monograph available for loan
    Monograph available for loan
    Berlin : Suhrkamp
    Call number: IASS 18.91432
    Type of Medium: Monograph available for loan
    Pages: 498 S.
    Edition: 1. Aufl.
    ISBN: 9783518585412 (GB.)
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Monograph available for loan
    Monograph available for loan
    Hannover : Schlütersche Verlagsgesellschaft
    Call number: M 18.91718
    Type of Medium: Monograph available for loan
    Pages: 447 Seiten , Diagramme , 25 cm
    ISBN: 9783000346392
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Call number: M 17.90450
    Type of Medium: Monograph available for loan
    Pages: 326 S. , Ill., graph. Darst., Kt , 25 cm
    ISBN: 9783816784111 (Pp.)
    Classification:
    E.4.
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : VS, Verlag für Sozialwissenschaften
    Call number: PIK D 029-19-92804
    Type of Medium: Monograph available for loan
    Pages: 561 Seiten , Diagramme
    Edition: 2., überarbeitete und erweiterte Auflage
    ISBN: 9783531172019 (geb.) , 9783531145594 (pbk.)
    Series Statement: Lehrbuch
    Language: German
    Note: Contents: Einleitung ; I Theorie ; 1 Typologie politischer Systeme ; 2 Die Stabilität politischer Systeme ; 3 Transformationsbegriffe ; 4 Transformationstheorien ; 5 Massen und Eliten in der Transformation ; 6 Transformationsphasen ; II Die Demokratisierungswellen des 20. Jahrhunderts ; 1 Die erste Demokratisierungswelle: Die Entstehung von Demokratien ; 2 Die erste autokratische Gegenwelle: Der Zusammenbruch von Demokratien ; 3 Die zweite Demokratisierungswelle: Die Nachkriegsdemokratien in Deutschland, Italien und Japan ; III Die Dritte Demokratisierungswelle: Südeuropa ; 1 Die Demokratisierung in Südeuropa ; IV Die dritte Demokratisierungswelle: Lateinamerika ; 1 Typen autoritärer Regime ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung ; 5 Fazit und Ausblick ; V Die dritte Demokratisierungswelle: Ost- und Südostasien ; 1 Typen autoritärer Regime ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung ; 5 Fazit: Die Konsolidierung im Vergleich ; 6 Gibt es eine "asiatische Form" der Demokratie? ; VI Die dritte Demokratisierungswelle: Osteuropa ; 1 Die besondere Transformationsproblematik in Osteuropa ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung: Ungarn, Polen, Russland und Belarus im Vergleich ; VII Externe Demokratisierung ; 1 Demokratieförderung ; 2 Demokratisierung "durch" Krieg? ; Ausblick: Kehren die Diktaturen zurück? ; 1 Theoretische Paradigmen und empirische Artefakte ; Gegenwartsdiagnose ; Zukunftsprognose
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    Monograph available for loan
    Monograph available for loan
    Göttingen : BusinessVillage
    Call number: 2/M 17.91065
    Type of Medium: Monograph available for loan
    Pages: 117 S. , Ill., graph. Darst.
    Edition: 3. Aufl., unveränd. Nachdr.
    ISBN: 9783938358627
    Series Statement: Edition Praxis.Wissen
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Call number: N 17.91148
    Description / Table of Contents: Viele sozialwissenschaftliche Untersuchungen beruhen auf Rekonstruktionen von Situationen oder Prozessen. Das Lehrbuch vermittelt anhand zweier Beispieluntersuchungen anwendungsbereites Wissen über alle Phasen solcher rekonstruierender Untersuchungen und stellt je eine Erhebungs- und eine Auswertungsmethode ausführlich vor. Die Interviewpartner werden als Experten aufgefasst, die über spezifisches Wissen über die zu rekonstruierenden Sachverhalte verfügen. Die qualitative Inhaltsanalyse ermöglicht eine systematische Extraktion relevanter Informationen aus den Interviews und ist zugleich offen für nicht erwartete Befunde. Mit Lernfragen nach jedem Kapitel und einer übersichtlichen Gliederung eignet sich das Buch als praxisorientierte Einführung.
    Type of Medium: Monograph available for loan
    Pages: 347 Seiten , Illustrationen, Diagramme , 21 cm
    Edition: 4. Auflage
    ISBN: 3531172387 (Pb.) , 9783531172385 (Pb.)
    Series Statement: Lehrbuch
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Non-book medium
    Non-book medium
    Heidelberg : Spektrum der Wissenschaft Verlagsgesellschaft
    Call number: (OCoLC)838497963
    Type of Medium: Non-book medium
    Pages: Online-Ressource (114 Seiten) , Illustrationen
    Series Statement: Sterne und Weltraum 50.2011,5
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Call number: AWI A3-20-93434
    In: Meteorologische Abhandlungen / Institut für Meteorologie und Geophysik der Freien Universität Berlin, Band XXXII, Heft 1
    Type of Medium: Series available for loan
    Pages: 121 Seiten , Illustrationen
    Series Statement: Meteorologische Abhandlungen / Institut für Meteorologie und Geophysik der Freien Universität Berlin 32,1
    Language: German
    Note: Zugleich: Dissertation, Freie Unversität Berlin, [ca. 1963] , INHALTSVERZEICHNIS PROBLEMSTELLUNG UND ZIELSETZUNG 1. BEMERKUNGEN ZUM BEOBACHTUNGSGELÄNDE UND ZUM BEOBACHTUNGSMATERIAL 1.1 Das Beobachtungsgelände 1.2 Das Beobachtungsmaterial 2. HOMOGENITÄTSBETRACHTUNGEN 2.1 Temperatur 2.2 Niederschlag 2.3 Wind 2.4 Sonnenschein und Bewölkung 3. TEMPERATURVERHÄLTNISSE 3.1 Monats- und Jahreswerte 3.2 Tageswerte 3.3 Pentadenwerte 3.4 Häufigkeitsbetrachtungen 3.5 Interdiurne Veränderlichkeit 3.6 Der tägliche Gang 3.7 Vorkommen bestimmter Schwellenwerte 3.71 Frost- und Eistage 3.72 Sommer- und Tropentage 4. DER WASSERGEHALT DER LUFT 4.1 Monats- und Jahreswerte 4.2 Tageswerte 4.3 Häufigkeitsbetrachtungen 4.4 Interdiurne Veränderlichkeit 4.5 Der tägliche Gang 5. BEWÖLKUNGSVERHÄLTNISSE 5.1 Monats- und Jahreswerte 5.2 Tageswerte 5.3 Häufigkeitsbetrachtungen 5.4 Der tägliche Gang 5.5 Heitere und trübe Tage 5.6 Nebel 6. SONNENSCHEIN 6.1 Monats- und Jahreswerte 6.2 Tageswerte 6.3 Der tägliche Gang 7. NIEDERSCHLAGSVERHÄLTNISSE 7.1 Monats- und Jahreswerte 7.2 Niederschlagsbereitschaft 7.3 Tageswerte 7.4 Der tägliche Gang 7.5 Häufigkeitsbetrachtungen 7.6 Niederschlags- und Trockenperioden 7.7 Niederschlag und Wind· 7.8 Schneeverhältnisse 7.81 Schneefall und Schneedecke 7.82 Schneehöhe 7.9 Gewitter 8. WINDVERHÄLTNISSE 8.1 Windrichtung 8.2 Windgeschwindigkeit 8.21 Der jährliche Gang 8.22 Häufigkeitsbetrachtungen 8.23 Sturmtage und Windstillen 8.24 Der tägliche Gang 9.ZUSAMMENFASSUNG VERZEICHNIS DER TEXTTABELLEN VERZEICHNIS DER ABBILDUNGEN LITERATURVERZEICHNIS TABELLENANHANG
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Call number: AWI A3-20-93434-2
    In: Meteorologische Abhandlungen / Institut für Meteorologie und Geophysik der Freien Universität Berlin, Band XXXII, Heft 2
    Type of Medium: Series available for loan
    Pages: 218 Seiten , Illustrationen
    Series Statement: Meteorologische Abhandlungen / Institut für Meteorologie und Geophysik der Freien Universität Berlin 32,2
    Language: German
    Note: Zugleich: Dissertation, Freie Unversität Berlin, [ca. 1963] , INHALTSVERZEICHNIS PROBLEMSTELLUNG UND ZIELSETZUNG 1. BEMERKUNGEN ZUM BEOBACHTUNGSGELÄNDE UND ZUM BEOBACHTUNGSMATERIAL 1.1 Das Beobachtungsgelände 1.2 Das Beobachtungsmaterial 2. HOMOGENITÄTSBETRACHTUNGEN 2.1 Temperatur 2.2 Niederschlag 2.3 Wind 2.4 Sonnenschein und Bewölkung 3. TEMPERATURVERHÄLTNISSE 3.1 Monats- und Jahreswerte 3.2 Tageswerte 3.3 Pentadenwerte 3.4 Häufigkeitsbetrachtungen 3.5 Interdiurne Veränderlichkeit 3.6 Der tägliche Gang 3.7 Vorkommen bestimmter Schwellenwerte 3.71 Frost- und Eistage 3.72 Sommer- und Tropentage 4. DER WASSERGEHALT DER LUFT 4.1 Monats- und Jahreswerte 4.2 Tageswerte 4.3 Häufigkeitsbetrachtungen 4.4 Interdiurne Veränderlichkeit 4.5 Der tägliche Gang 5. BEWÖLKUNGSVERHÄLTNISSE 5.1 Monats- und Jahreswerte 5.2 Tageswerte 5.3 Häufigkeitsbetrachtungen 5.4 Der tägliche Gang 5.5 Heitere und trübe Tage 5.6 Nebel 6. SONNENSCHEIN 6.1 Monats- und Jahreswerte 6.2 Tageswerte 6.3 Der tägliche Gang 7. NIEDERSCHLAGSVERHÄLTNISSE 7.1 Monats- und Jahreswerte 7.2 Niederschlagsbereitschaft 7.3 Tageswerte 7.4 Der tägliche Gang 7.5 Häufigkeitsbetrachtungen 7.6 Niederschlags- und Trockenperioden 7.7 Niederschlag und Wind· 7.8 Schneeverhältnisse 7.81 Schneefall und Schneedecke 7.82 Schneehöhe 7.9 Gewitter 8. WINDVERHÄLTNISSE 8.1 Windrichtung 8.2 Windgeschwindigkeit 8.21 Der jährliche Gang 8.22 Häufigkeitsbetrachtungen 8.23 Sturmtage und Windstillen 8.24 Der tägliche Gang 9.ZUSAMMENFASSUNG VERZEICHNIS DER TEXTTABELLEN VERZEICHNIS DER ABBILDUNGEN LITERATURVERZEICHNIS TABELLENANHANG
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Monograph available for loan
    Monograph available for loan
    Novosibirsk : Akademičeskoe Izdatel'stvo "GEO"
    Call number: AWI G7-22-94838
    Description / Table of Contents: The most crucial materials and ideas of the physical and spatiotemporal laws of underground ice formation and underground glaciation development, including the author's results of long-term field and laboratory investigations, are collected, analyzed, and generalized. Theoretical and experimental studies of the physical processes of ice formation in the permafrost zone are used as a basis for structural reconstructions of the thermal, facies, and other conditions and of the factors responsible for different genetic types of underground ice. The most important result of the author's investigations is the theory of buried glacial ice in the permafrost zone, which fundamentally changes the understanding of the structure and paleogeography of underground glaciation, as well as its place in the Earth's cryosphere. A consequent analysis of the natural and experimental data on all scales and for all structural levels of underground ice formation (from the microworld of water phase transitions to the macroworld of the spatial and temporal evolution of geologic and geographic modifications of underground glaciation) permits the development of a genetic classification of underground ice and a general pattern of the zonal-climatic structure of underground glaciation. The book is addressed to students, postgraduate students, and research workers in area of Earth Science.
    Description / Table of Contents: Проанализированы и систематизированы наиболее существенные материалы и представления о физических и пространственно-временных законах развития подземного оледенения. Важнейшим результатом исследования является теория погребенного глетчерного происхождения пластовых льдов, которая кардинально меняет взгляды на структуру и палеогеографию подземного оледенения, на его место в криосфере Земли. Последовательный анализ всех структурных уровней и процессов подземного льдообразования (от микромира фазовых превращений воды до макромира пространственно-временного развития геологических и географических модификаций подземного оледенения) создает основу для разработки генетической классификации подземных льдов и принципиальной схемы зонально-климатической структуры подземного оледенения. Понимание связи физических законов формирования и географии подземного оледенения позволяет сформулировать теоретические основы геоэкологии криолитозоны, определяемые прежде всего динамическим равновесием в природной системе "лед-вода". Для студентов, аспирантов и научных работников, специализирующихся в области наук о Земле.
    Type of Medium: Monograph available for loan
    Pages: 340 Seiten , Illustrationen
    ISBN: 978-5-906284-35-8
    Language: Russian
    Note: Contents Introduction PART I. PHYSICS OF UNDERGROUND ICE FORMATION Chapter 1. PHYSICAL PROPERTIES OF WATER AND ICE 1.1. Water 1.2. Crystalline structure of ice 1.3. Thermodynamics of water state and phase transitions 1.4. Latent heat of water phase transitions 1.5. Evaporation and sublimation of ice 1.6. Thermal characteristics of ice 1.7. Mechanical properties and temperature of ice Chapter 2. FORMATION OF THE CRYSTALLINE STRUCTURE OF CONGELATION ICE 2.1. Nucleation and growth of ice crystals 2.2. Petrogenesis of underground ice 2.3. Influence of crystal habit and volume on the ice structure 2.4. Influence of solid surface on the ice structure 2.5. Influence of impurities in crystallizing water on the ice structure 2.6. Influence of the thermal conditions of water crystallization on the ice structure Chapter 3. DYNAMOMETAMORPHISM OF ICE 3.1. General principles of ice dynamometamorphism 3.2. Structural changes caused by ice deformation 3.3. Influence of impurities on structural changes caused by ice deformation 3.4. Structural peculiarities of glacial ice Chapter 4. METHODS OF STRUCTURE-GENETIC ANALYSIS OF UNDERGROUND ICE 4.1. Description of ice structure 4.2. Processing of petrographical data 4.3. Analysis and interpretation of structural data PART II. GENETIC TYPES OF UNDERGROUND ICE Chapter 5. ICE WEDGES 5.1. The theory of ice wedge genesis 5.2. Elementary ice veinlets and forms of ice wedge growth 5.3. Elementary ice veinlets and method of reconstruction of thermal ice formation conditions 5.4. Epigenetic ice wedges 5.5. Syngenetic ice wedges Chapter 6. SEGREGATED ICE Chapter 7. INJECTED ICE Chapter 8. BURIAL GLACIAL (MASSIVE) ICE 8.1. The theory of massive-ice genesis 8.2. Massive-ice bedding and structure 8.3. Basic-moraine ice (Ust'-PortVillage region) 8.4. Buried ice of terminal moraines (Ermakovo Village region) 8.5. Buried ice offluvioglacial sediments (Gydan Peninsula) 8.6. Buried ice of submarine sediments (Yamal Peninsula) 8.7. Typomorphic structural features of massive ice 8.8. General regularities of surface ice conservation in permafrost zone 8.9. Conclusions PART III. OXYGEN ISOTOPE COMPOSITION OF UNDERGROUND ICE Chapter 9. OXYGEN ISOTOPE COMPOSITION OF NATURAL WATERS 9.1. Oxygen isotopes in natural waters 9.2. Fractionation of oxygen isotopes in water 9.3. Oxygen isotope composition of atmospheric water 9.4. Seasonal variations in the oxygen isotope composition of atmospheric precipitation 9.5. Oxygen isotope composition of snow 9.6. Oxygen isotope composition of surface waters 9.7. Oxygen isotope composition of groundwaters Chapter 10. OXYGEN ISOTOPE COMPOSITION OF ICE WEDGES 10.1. Oxygen isotope composition ofrecent alluvial ice wedges 10.2. Oxygen isotope composition of recent bog-lacustrine ice wedges 10.3. Oxygen isotope composition of recent offshore ice wedges 10.4. Fractionation of oxygen isotopes during water freezing in frozen cracks 10.5. Changes in the oxygen isotope composition of ice wedges caused by diffusion, sublimation, and condensation 10.6. Dependence of the oxygen isotope composition of recent ice wedges on winter temperature 10.7. Conservation of oxygen isotopes in ancient ice wedges 10.8. Representative oxygen isotope data obtained by analysis of ice samples from natural permafrost exposures 10.9. Oxygen isotope dating of ancient syngenetic ice wedges 10.10. Reconstruction of winter paleotemperatures from the oxygen isotope composition ofancient ice wedges of the Kolyma River lowland 10.11. Reconstruction ofpaleotemperatures from the oxygen isotope composition of key-section ice wedges of the Kolyma River lowland Chapter 11. OXYGEN ISOTOPE COMPOSITION OF MASSIVE ICE 11.1. State of the art and problems of study of the oxygen isotope composition of massive ice 11.2. Results of study of the oxygen isotope composition of massive ice and their interpretation 11.3. Reconstruction of the paleogeography of massive-ice formation 11.4. Regional changes in the oxygen isotope composition of massive ice Chapter 12. OXYGEN ISOTOPE COMPOSITION OF TEXTURE-FORMING ICE 12.1. Regularities of formation of the oxygen isotope composition oftextureforming ice in a seasonally thawed layer 12.2. Zonal and climatic factors of variations in the oxygen isotope composition of ice in a seasonally thawed layer 12.3. Geomorphologic and cryolithologic factors 12.4. Oxygen isotope composition of syngenetic segregated ice 12.5. Oxygen isotope composition of epigenetic segregated ice. PART IV. SPATIOTEMPORAL STRUCTURE OF UNDERGROUND ICE Chapter 13. SYSTEMATICS OF UNDERGROUND GLACIAL ROCKS 13.1. Underground ice and cryosphere 13.2. Underground ice and cryogenesis 13.3. Underground ice as a rock Chapter 14. PALEOGEOGRAPHY OF UNDERGROUND GLACIATION Chapter 15. ZONAL AND CLIMATIC STRUCTURE OF UNDERGROUND ICE 15.1. Principles of the spatiotemporal distribution ofunderground ice 15.2. Section structure of underground ice 15.3. Zonation of underground ice 15.4. Zone-regional scheme of underground ice PART V. GEOECOLOGY OF UNDERGROUND GLACIATION TERRITORY Chapter 16. GEOECOLOGICAL PROBLEMS OF PERMAFROST ZONE 16.1. Geoecologic pecularities of underground glaciation 16.2. Geoecology and underground ice of the Arctic Region Chapter 17. PRINCIPLES OF STABILIZATION OF CRYOSYSTEMS AND THEIR EVOLUTION PROGNOSIS 17.1. Factors of cryosystem destruction 17.2. Experience of short-term geoecological prognosis of the Bovanenkovo gas field development (Yamal Peninsula) Conclusions References , Содержание Введение ЧАСТЬ 1. ФИЗИКА ПОДЗЕМНОГО ЛЬДООБРАЗОВАНИЯ Глава 1. ФИЗИЧЕСКИЕ СВОЙСТВА ВОДЫ И ЛЬДА 1.1. Вода 1.2. Кристаллическая структура льда 1.3. Термодинамика состояния и фазовых переходов воды 1.4. Скрытая теплота фазовых превращений воды 1.5. Испарение и сублимация льда 1.6. Теплофизические характеристики льда 1.7. Механические свойства и температура льда Глава 2. ФОРМИРОВАНИЕ КРИСТАЛЛИЧЕСКОЙ СТРУКТУРЫ КОНЖЕЛЯЦИОННЫХ ЛЬДОВ 2.1. Зарождение и рост кристаллов льда 2.2. Петрогенез подземных льдов 2.3. Структурообразующая роль формы и объема кристаллизации 2.4. Структурообразующая роль твердой поверхности 2.5. Структурообразующая роль примесей в кристаллизующейся воде 2.6. Структурообразующая роль термических условий кристаллизации Глава 3. ДИНАМОМЕТАМОРФИЗМ ЛЬДА 3.1. Общие принципы динамометаморфизма льда 3.2. Структурные изменения в ходе деформации льда 3.3. Влияние примесей на структурные изменения в ходе деформации льда 3.4. Структурные особенности глетчерных льдов Глава 4. МЕТОДЫ СТРУКТУРНО-ГЕНЕТИЧЕСКОГО АНАЛИЗА ПОДЗЕМНЫХ ЛЬДОВ 4.1. Описание структуры льда 4.2. Обработка петрографических данных 4.3. Анализ и интерпретация структурных данных ЧАСТЬ 11. ГЕНЕТИЧЕСКИЕ ТИПЫ ПОДЗЕМНОГО ЛЬДА Глава 5. ЖИЛЬНЫЕ ЛЬДЫ 5.1. Состояние проблемы генезиса жильных льдов 5.2. Элементарные жилки и изначальные формы роста ледяных жил 5.3. Элементарные жилки и метод реконструкции температурных условий льдообразования 5.4. Эпигенетические жильные льды 5.5. Сингенетические жильные льды Глава 6. СЕГРЕГАЦИОННЫЕ ЛЬДЫ Глава 7. ИНЪЕКЦИОННЫЕ ЛЬДЫ Глава 8. ПОГРЕБЕННЫЕ ГЛЕТЧЕРНЫЕ (ПЛАСТОВЫЕ) ЛЬДЫ 8.1. Состояние проблемы генезиса пластовых льдов 8.2. Условия залегания и строение пластовых льдов 8.3. Льды основных морен (район пос. Усть-Порт) 8.4. Погребенные льды конечных морен (район пос. Ермакова) 8.5. Погребенные льды флювиогляциальных отложений (Гыданский полуостров) 8.6. Погребенные льды субаквальных отложений (полуостров Ямал) 8.7. Типоморфные особенности строения пластовых льдов 8.8. Общие закономерности консервации поверхностных льдов в криолитозоне 8.9. Выводы ЧАСТЬ III. ИЗОТОПНО-КИСЛОРОДНЫЙ СОСТАВ ПОДЗЕМНЫХ ЛЬДОВ Глава 9. ИЗОТОПНО-КИСЛОРОДНЫЙ СОСТАВ ПРИРОДНЫХ ВОД 9.1. Изотопные компоненты природных вод 9.2. Фракционирование изотопного состава воды 9.3. Изотопный состав атмосферной влаги 9.4. Сезонные вариации изотопного состава атмосферных осадков 9.5. Изотопный состав снежного покрова 9.6. Изотопный состав поверхностных вод 9.7. Изотопный состав грунтовых вод Глава 10. ИЗОТОПНО-КИСЛОРОДНЫЙ СОСТАВ ЖИЛЬНЫХ ЛЬДОВ 10.1. Изотопно-кислородный состав современных жильных льдов аллювиальных отложений 10.2. Изотопно-кислородный состав современных жильных льдов озерно-болотных отложений 10.3. Изотопно-кислородный состав современных полигонально-жильных льдов прибрежно-морских отложений 10.4. Фракционирование изотопов кислорода при замерзании воды в морозобойной трещине 10.5. Изменение первичного изотопного состава жильных льдов под влиянием процессов диффузии, сублимации и конденсации льда 10.6. Зависимость изотопно-кислородного состава современных рост-ков жильного льда от зимней температуры воздуха 10.7. Сохранность изотопно-кислородной информации в древних жильных льдах 10.8. Представительность изотопно-кислородной информации, полученной при анализе образцов льда из естественных обнажений мерзлых пород 10.9. Датирование изотопно-кислородной информации древних синге-нетических жил льда 10.10. Реконструкция зимних палеотемператур воздуха по изотопии древних ледяных жил Колымской низменности 10.11. Реконструкция палеотемператур воздуха по изотопии жильных льдов опорных разрезов Колымской низменности Глава 11. ИЗОТОПНО-КИСЛОРОДНЫЙ СОСТАВ ПЛАСТОВЫХ ЛЬДОВ 11.1. Состояние и задачи исследований изотопно-кислородного состава пластовых льдов 11.2. Результаты опробования изотопно-кислородного состава пласто-вых льдов и их интерпретация 11.3. Реконструкция палеогеографических условий формирования изотопно-кислородного состава пластовых льдов 11.4. Региональные изменения изотопно-кислородного состава пласто-вых льдов Глава 12. ИЗОТОПНО-КИСЛОРОДНЫЙ СОСТАВ ТЕКСТУРООБРАЗУЮЩИХ ЛЬДОВ 12.1. Закономерности формирования изотопно-кислородного состава текстурообразующих льдов сезонноталого слоя 12.2. Зонально-климатические факторы вариаций изотопно-кислородного состава льда сезоннооттаивающего слоя 12.3. Геоморфологические и криолитогенные факторы 12.4. Изотопно-кислородный состав текстурообразующих льдов синкриогенных отложений 12.5. Изотопно-кислородный состав текстурообразующих льдов эпикриогенных отложений ЧАСТЬ IV. ПРОСТРАНСТВЕННО-ВРЕМЕННАЯ СТРУКТУРА ПОДЗЕМНОГО ОЛЕДЕНЕНИЯ Глава 13. СИСТЕМАТИКА ПОДЗЕМНЫХ ЛЕДЯНЫХ ГОРНЫХ ПОРОД 13.1. Подземные льды и криосфера 13.2. Подземные льды и криолитогенез 13.3. Подземные льды как горная порода Глава 14. ПАЛЕОГЕОГРАФИЯ ПОДЗЕМНОГО ОЛЕДЕНЕНИЯ Глава 15. ЗОНАЛЬНО-КЛИМАТИЧЕСКАЯ СТРУКТУРА ПОДЗЕМНОГО ОЛЕДЕНЕНИЯ 15.1. Принципы формирования пространственно-временной структуры подземного оледенения 15.2. Ярусность подземного льдообразования в разрезе мерзлой толщи 15.3. Зональность подземного оледенения 15.4. Зонально-региональная схема подземного оледенения ЧАСТЬ V. ГЕОЭКОЛОГИЯ ТЕРРИТОРИИ ПОДЗЕМНОГО ОЛЕДЕНЕНИЯ Глава 16. ГЕОЭКОЛОГИЧЕСКИЕ ПРОБЛЕМЫ КРИОЛИТОЗОНЫ 16.1. Геоэкологическая специфика криолитозоны 16.2. Геоэкология Арктики и подземный лед Глава 17. ПРИНЦИПЫ СТАБИЛИЗАЦИИ И ГЕОЭКОЛОГИЧЕСКИЙ ПРОГНОЗ ЭВОЛЮЦИИ ГЕОСИСТЕМ КРИОЛИТОЗОНЫ 17.1. Факторы дестабилизации геосистем криолитозоны 17.2. Опыт краткосрочного геоэкологического прогнозирования развития территории Бованенковского газоконденсатного месторождения (полуостров Ямал) Заключение Литература , In kyrillischer Schrift
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    Journal available for loan
    Journal available for loan
    Tübingen : Mohr Siebeck ; 1.1884 - 48.1931; N.F. 1.1932/33 - 10.1943/44(1945),3; 11.1948/49(1949) -
    Call number: ZS 22.95039
    Type of Medium: Journal available for loan
    Pages: Online-Ressource
    ISSN: 1614-0974 , 0015-2218 , 0015-2218
    Language: German , English
    Note: N.F. entfällt ab 57.2000. - Volltext auch als Teil einer Datenbank verfügbar , Ersch. ab 2000 in engl. Sprache mit dt. Hauptsacht.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 00.0652(2016-2018)
    In: Erdbebenbeobachtung im Freistaat Sachsen
    Type of Medium: Series available for loan
    Pages: 66 Seiten , Illustrationen, Karten
    Series Statement: Erdbebenbeobachtung in Mitteldeutschland
    Classification:
    Seismology
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Call number: IASS 17.91026
    Type of Medium: Monograph available for loan
    Pages: 503 Seiten , Diagramme
    Edition: 2., vollständig überarbeitete und erweiterte Auflage
    ISBN: 9783531175676 , 9783531931579 (eBook)
    Uniform Title: Handbuch zur universitären Gleichstellungspolitik
    Parallel Title: Erscheint auch als Handbuch zur Gleichstellungspolitik an Hochschulen
    Former Title: Vorangegangen ist Blome, Eva Handbuch zur universitären Gleichstellungspolitik
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    Monograph available for loan
    Monograph available for loan
    München : Oekom-Verl.
    Call number: IASS 17.91031
    Type of Medium: Monograph available for loan
    Pages: 263 S. , graph. Darst. , 24 cm
    ISBN: 9783865812650 (Pbk)
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Monograph available for loan
    Monograph available for loan
    München : Oekom-Verl.
    Call number: IASS 16.91043
    Type of Medium: Monograph available for loan
    Pages: 239 S. , graph. Darst. , 238 mm x 145 mm
    Edition: Dt. Erstausg., 1. Aufl.
    ISBN: 9783865812452
    Uniform Title: Prosperity without growth 〈dt.〉
    Parallel Title: Engl. Ausg. Jackson, Tim: Prosperity without growth
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    Monograph available for loan
    Monograph available for loan
    Leningrad : Gidrometeorolog. Izd.
    Call number: MOP 33767
    Type of Medium: Monograph available for loan
    Pages: 663 S.
    Language: Russian
    Note: In kyrill. Schr., russ.
    Location: MOP - must be ordered
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Keywords: Visio 2010
    Description / Table of Contents: Bei Visio handelt es sich um eine Visualisierungs-Software von Microsoft für Windows. Seit Office 2003 gibt es eine Standard- und eine Professional-Version, die mit Visio 2010 um eine Premium-Version ergänzt wurde. Visio ermöglicht mittels verschiedener Vorlagen, Werkzeugen und Symbolen das Erstellen von komplexen grafischen Darstellungen, die sich sehr einfach in andere Dokumente einbetten lassen. Besonders geeignet ist die Software für Ablaufdiagramme und Geschäftsprozesse. Hervorzuheben ist, dass die erstellten Diagramme mit Daten aus beliebigen Datenbanken verknüpft werden können. Wenig und nur recht teure Titel auf dem Buchmarkt. Vorliegender Band bietet eine fundierte Vorlage für das Selbststudium und das auf neuestem Stand. (Antje Funk)
    Pages: 493 S. , Ill., graph. Darst , 24 cm
    Edition: 1. Aufl.
    ISBN: 9783866450776 (kart.)
    Uniform Title: Microsoft Visio 2010 - step by step 〈dt.〉
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Call number: M 15.89080
    Type of Medium: Monograph available for loan
    Pages: 415 S , Ill., graph. Darst. , 240 mm x 168 mm
    Edition: 1. Aufl
    ISBN: 3836219697 (kart.) , 9783836219693 (kart.)
    Series Statement: SAP Press
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Call number: IASS 16.89860
    Type of Medium: Monograph available for loan
    Pages: 238 S. , graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9783896917683
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...