ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

X
feed icon rss

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • Books  (240)
  • 2010-2014  (239)
  • 1995-1999  (1)
  • 1960-1964  (1)
  • 1925-1929
  • 2010  (239)
  • 1982
  • 1928  (1)
  • A 18 - must be ordered  (240)
Collection
  • Books  (240)
Source
Publisher
Language
Years
Year
Classification
Branch Library
Reading Room Location
  • 1
    Monograph available for loan
    Monograph available for loan
    Out of water : from abundance to scarcity and how to solve the world's water problems (2010)
    Upper Saddle River, NJ : FT Press
    Details Availability
    Call number: PIK N 454-16-89315
    Type of Medium: Monograph available for loan
    Pages: XXIII, 230 S. , Ill., graph. Darst.
    Language: English
    Note: Chapter 1 Not Another Crisis! -- Chapter 2 From Abundance to Scarcity in 25 Years -- Chapter 3 Causes of Water Scarcity -- Chapter 4 Climate Change and Water -- Chapter 5 Agriculture and Water -- Chapter 6 Water, Food, and Poverty -- Chapter 7 Integrating Water Planning and Management -- Chapter 8 Water Governance for People and the Environment -- Chapter 9 Water Rights and Water Costs -- Chapter 10 Solving the World’s Water Problems
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 2
    Monograph available for loan
    Monograph available for loan
    Introduction to graph theory (2010)
    Harlow [u.a.] : Pearson/Prentice Hall
    Details Availability
    Call number: PIK M 390-16-89504
    Type of Medium: Monograph available for loan
    Pages: VIII, 184 S. , graph. Darst.
    Edition: 5. ed.
    ISBN: 9780273728894 (pbk.)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 3
    Monograph available for loan
    Monograph available for loan
    The performance economy (2010)
    Basingstoke, England : Palgrave Macmillan
    Details
    Call number: PIK B 160-16-90200
    Description / Table of Contents: This updated and revised edition outlines strategies and models for how to use technology and knowledge to improve performance, create jobs and increase income. It shows what skills will be required to produce, sell and manage performance over time, and how manual jobs can contribute to reduce the consumption of non-renewable resources
    Type of Medium: Monograph available for loan
    Pages: XXIII, 349 Seiten , graph. Darst.
    Edition: 2nd edition
    ISBN: 0230584667 (hbk.) , 9781349369195 (pbk.) , 9780230584662 (hbk.)
    URL: Inhaltsverzeichnis
    Language: English
    Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 4
    Monograph available for loan
    Monograph available for loan
    Science in the age of computer simulation (2010)
    Chicago [u.a.] : Univ. of Chicago Press
    Details Availability
    Call number: PIK A 190-15-89224
    Type of Medium: Monograph available for loan
    Pages: XI, 152 S. , Ill., graph. Darst
    ISBN: 0226902021 (cloth) , 9780226902029 (cloth) , 0226902048 (pbk.) , 9780226902043 (pbk.)
    URL: http://www.gbv.de/dms/bowker/toc/9780226902043.pdf
    Language: English
    Note: Introduction -- Sanctioning models : theories and their scope -- Methodology for a virtual world -- A tale of two methods -- When theories shake hands -- Models of climate : values and uncertainties -- Reliability without truth -- Conclusion..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 5
    Monograph available for loan
    Monograph available for loan
    Grundlagen der GWK 2017 (2010)
    Bonn : Gemeinsame Wissenschaftskonferenz (GWK)
    Details Availability
    Call number: PIK A 130-17-90903
    Type of Medium: Monograph available for loan
    Pages: 223 Seiten
    ISBN: 9783942342414
    URL: www.gwk-bonn.de/fileadmin/Papers/GWK-Grundlagen-2017.pdf
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 6
    Monograph available for loan
    Monograph available for loan
    Water sustainability : a global perspective (2010)
    London : Routledge
    Details Availability
    Call number: PIK N 454-17-90902
    Type of Medium: Monograph available for loan
    Pages: XI, 452 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9781444104882 , 1444104888
    Language: English
    Note: Contents: 1. A looming crisis Part I Status and challenges 2. Rising demand and dwindling per capita resources 3. Water and poverty 4. Governance and finance 5. Pollution and water-related disease 6. Water, land and wildlife 7. Dams and diversions 8. Trading water - real and virtual 9. Water, war and terrorism 10. The threat of global warming Part II Nature's resources 11. The restless water cycle 12. Shrinking freshwater stores Part III Towards sustainability 13. Cutting demand 14. Increasing supplies 15. Cleaning up and protecting the aquatic environment 16. Using seawater 17. Controlling the weather 18. Improved monitoring and data management 19. Improving prediction and risk assessment 20. Improving management and justice 21. Aid for the developing world Conclusions 22. Is sustainability achievable?
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 7
    Monograph available for loan
    Monograph available for loan
    Quantum computation and quantum information (2010)
    Cambridge : Cambridge University Press
    Details Availability
    Call number: PIK N 185-18-91538
    Type of Medium: Monograph available for loan
    Pages: xxxi, 676 Seiten , Diagramme
    Edition: 10th anniversary edition
    ISBN: 9781107002173
    URL: http://www.gbv.de/dms/weimar/toc/637190246_toc.pdf
    Language: English
    Note: Fundamental Concepts -- Introduction and overview -- Introduction to quantum mechanics -- Introduction to computer science -- Quantum Computation -- Quantum circuits -- The quantum Fourier transform and its applications -- Quantum search algorithms -- Quantum computers: physical realisation -- Quantum Information -- Quantum noise, open quantum systems, and quantum operations -- Distance measurement for quantum information -- Quantum error-correction -- Entropy and information -- Quantum information theory -- Notes on basic probability theory -- Group theory -- Approximating quantum gates: the Solovay-Kitaev theorem -- Number theory -- Public-key cryptography and the RSA cryptosystem -- Proof of Lieb's theorem.
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 8
    Monograph available for loan
    Monograph available for loan
    Klimageschichte der Neuzeit : 1500 - 1900 (2010)
    Darmstadt : WBG (Wissenschaftliche Buchgesellschaft)
    Details Availability
    Call number: PIK N 456-19-93064
    Type of Medium: Monograph available for loan
    Pages: VII, 144 S. , Illustrationen, Diagramme, Karten , 240 mm x 165 mm
    ISBN: 9783534210244 (kart.)
    Series Statement: Geschichte kompakt
    URL: Inhaltsverzeichnis
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 9
    Monograph available for loan
    Monograph available for loan
    Mathematical bioeconomics : the mathematics of conservation (2010)
    Hoboken, NJ : Wiley
    Details Availability
    Call number: PIK M 370-21-94524
    Type of Medium: Monograph available for loan
    Pages: XV, 368 Seiten , graph. Darst.
    Edition: 3. ed.
    ISBN: 978-0-470-37299-9
    Series Statement: Pure and applied mathematics
    URL: Inhaltsverzeichnis
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 10
    Monograph available for loan
    Monograph available for loan
    Econometric analysis of cross section and panel data (2010)
    Cambridge, Mass. [u.a.] : MIT Press
    Details
    Call number: PIK B 020-16-89772
    Type of Medium: Monograph available for loan
    Pages: XXVII, 1064 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 0262232588 (hbk.) , 9780262232586
    Language: English
    Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 11
    Monograph available for loan
    Monograph available for loan
    Graph theory (2010)
    Heidelberg [u.a.] : Springer
    Details Availability
    Call number: PIK M 390-16-89505
    Type of Medium: Monograph available for loan
    Pages: XVIII, 436 S. , graph. Darst. , 235 mm x 155 mm
    Edition: 4. ed., 2. corr. print.
    ISBN: 9783642142789 (PB.) , 9783642142796
    Series Statement: Graduate texts in mathematics 173
    URL: Inhaltsverzeichnis
    URL: Inhaltstext
    URL: http://www.gbv.de/dms/bowker/toc/9783642142789.pdf
    Language: English
    Note: The basics -- Matching, covering and packing -- Connectivity -- Planar graphs -- Colouring -- Flows -- Extremal graph theory -- Infinite graphs -- Ramsey theory for graphs -- Hamilton cycles -- Random graphs -- Minors, trees, and WQO..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 12
    Monograph available for loan
    Monograph available for loan
    Climatología aeronáutica de España (1948-)
    Madrid : Secc
    Details Availability
    Call number: PIK N 456-17-90913
    Type of Medium: Monograph available for loan
    Pages: 536 Seiten
    Series Statement: Ministerio de Transportes Turismo Y Comunicaciones : Publicación Serie A 114
    Parallel Title: 1,1=6; 2,1=13 von Publicaciones / D / Ministerio del Aire, Subsecretaria de Aviación Civil, Servicio Meteorológico Nacional
    Language: Spanish
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 13
    Monograph available for loan
    Monograph available for loan
    Systemtransformation : eine Einführung in die Theorie und Empirie der Transformationsforschung (2010)
    Wiesbaden : VS, Verlag für Sozialwissenschaften
    Details Availability
    Call number: PIK D 029-19-92804
    Type of Medium: Monograph available for loan
    Pages: 561 Seiten , Diagramme
    Edition: 2., überarbeitete und erweiterte Auflage
    ISBN: 9783531172019 (geb.) , 9783531145594 (pbk.)
    Series Statement: Lehrbuch
    URL: Inhaltsverzeichnis
    URL: Inhaltsverzeichnis
    Language: German
    Note: Contents: Einleitung ; I Theorie ; 1 Typologie politischer Systeme ; 2 Die Stabilität politischer Systeme ; 3 Transformationsbegriffe ; 4 Transformationstheorien ; 5 Massen und Eliten in der Transformation ; 6 Transformationsphasen ; II Die Demokratisierungswellen des 20. Jahrhunderts ; 1 Die erste Demokratisierungswelle: Die Entstehung von Demokratien ; 2 Die erste autokratische Gegenwelle: Der Zusammenbruch von Demokratien ; 3 Die zweite Demokratisierungswelle: Die Nachkriegsdemokratien in Deutschland, Italien und Japan ; III Die Dritte Demokratisierungswelle: Südeuropa ; 1 Die Demokratisierung in Südeuropa ; IV Die dritte Demokratisierungswelle: Lateinamerika ; 1 Typen autoritärer Regime ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung ; 5 Fazit und Ausblick ; V Die dritte Demokratisierungswelle: Ost- und Südostasien ; 1 Typen autoritärer Regime ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung ; 5 Fazit: Die Konsolidierung im Vergleich ; 6 Gibt es eine "asiatische Form" der Demokratie? ; VI Die dritte Demokratisierungswelle: Osteuropa ; 1 Die besondere Transformationsproblematik in Osteuropa ; 2 Regimeübergänge ; 3 Institutionalisierung ; 4 Konsolidierung: Ungarn, Polen, Russland und Belarus im Vergleich ; VII Externe Demokratisierung ; 1 Demokratieförderung ; 2 Demokratisierung "durch" Krieg? ; Ausblick: Kehren die Diktaturen zurück? ; 1 Theoretische Paradigmen und empirische Artefakte ; Gegenwartsdiagnose ; Zukunftsprognose
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 14
    Monograph available for loan
    Monograph available for loan
    Grundriss der Wirtschaftsethik : von der Stammesmoral zur Ethik der Globalisierung (2010)
    Stuttgart : Kohlhammer
    Details
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    URL: Inhaltsverzeichnis
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 15
    Monograph available for loan
    Monograph available for loan
    A kinetic view of statistical physics (2010)
    Cambridge [u.a.] : Cambridge Univ. Press
    Details Availability
    Call number: PIK N 106-16-89934
    Type of Medium: Monograph available for loan
    Pages: XV, 488 S. , Ill., graph. Darst.
    ISBN: 9780521851039 (hbk.)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 16
    Monograph available for loan
    Monograph available for loan
    Weather on the coasts of southern Africa. From River Congo to Cape Delgado : Local information (1900-1944)
    [S.l.] : Cape Times
    Details Availability
    Call number: PIK N 456-16-90137
    Type of Medium: Monograph available for loan
    Pages: getr. Zählung , ill. (some col.) , 24 cm
    Language: English
    Note: Enth.: Introduction -- Pt. 2. Union of South Africa from Olifants River to Mossel Bay. With an appendix on conditions at Saldanha Bay, Cape Town and Simonstown -- Pt. 3. Union of South Africa from Mossel Bay to East London.With an appendix on conditions oat Mossel Bay and Port Elizabeth -- Pt. 4. Union of South Africa from East London to Kosi Bay.With an appendix on conditions at East London and Durban -- Pt. 5. Portuguese East Africa (Mocambique) and Mocambique Channel -- Pt. 5a. Madagascar. With an appendix on conditions at Mayotte, Diégo Suarez, Nossi Bé and Tamatave
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 17
    Monograph available for loan
    Monograph available for loan
    Justice, political liberalism, and utilitarianism : themes from Harsanyi and Rawls (2010)
    Cambridge : Cambridge University Press
    Details Availability
    Call number: PIK D 029-20-93403
    Type of Medium: Monograph available for loan
    Pages: XII, 460 Seiten , Illustrationen, Diagramme
    Edition: 1. paperback ed.
    ISBN: 9780521184298
    Language: English
    Note: Contents: 1. An introduction to justice, political liberalism, and utilitarianism Marc Fleurbaey, Maurice Salles and John A. Weymark ; Part I. Themes from Rawls: 2. John Rawls's theory of justice: some critical comments John C. Harsanyi ; 3. Rawls, responsibility, and distributive justice Richard Arneson ; 4. Improving our ethical beliefs James Griffin ; Part II. Harsanyi's Impartial Observer and Social Aggregation Theorems: 5. Harsanyi's impartial observer is not a utilitarian John E. Roemer ; 6. Social aggregation and the expected utility hypothesis Charles Blackorby, David Donaldson and John A. Weymark ; 7. A welfarist version of Harsanyi's aggregation theorem Claude d'Aspremont and Philippe Mongin ; 8. Preference aggregation after Harsanyi Matthias Hild, Richard Jeffrey and Mathias Risse ; Part III. Goodness and Well-Being: 9. Can there be a preference-based utilitarianism? John Broome ; 10. Harsanyi, Rawls and the search for a common currency of advantage Robert Sugden ; 11. Utilitarianism versus fairness in welfare economics Marc Fleurbaey and François Maniquet ; 12. Rationality and want-satisfaction Brian Barry ; Part IV. Sharing the Gains from Social Cooperation ; 13. Naturalizing Harsanyi and Rawls Ken Binmore ; 14. The social contract naturalized Brian Skyrms ; 15. An alternative model of rational cooperation Edward F. McClennen ; Part V. Rights and Liberties: 16. Republican political theory Philip Pettit ; 17. Rule utilitarianism and liberal priorities Jonathan Riley.
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 18
    Monograph available for loan
    Monograph available for loan
    World ethics and climate change : from international to global justice (2010)
    Edinburgh : Edinburgh Univ. Press
    Details Availability
    Call number: PIK E 502-09-0289
    Description / Table of Contents: Contents: Introduction ; Part I - The Challenge ; 1 Global Climate Change ; 2 Justice in a Changing World ; Part II - International Justice ; 3 International Environmental Justice ; 4 International Justice and Climate Change ; Part III - Global Justice ; 5 Cosmopolitan Ethics and Justice ; 6 Affluence, Consumption and Atmospheric Pollution ; 7 Cosmopolitan Diplomacy and Climate Policy ; 8 The Unavoidability of Global Justice
    Type of Medium: Monograph available for loan
    Pages: X, 214 S.
    ISBN: 9780748639106
    Series Statement: Edinburgh studies in world ethics
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 19
    Monograph available for loan
    Monograph available for loan
    Dynamic systems, economic growth, and the environment (2010)
    Heidelberg [u.a.] : Springer
    Details Availability
    Call number: PIK B 160-10-0014
    Description / Table of Contents: Contents: Part I Dynamic Systems in Growth Models: On Adequate Transversality Conditions for Infinite Horizon Optimal Control Problems - A Famous Example of Halkin ; Sequential Precision of Predictions in Models of Economic Growth ; High Order Precision Estimates in Algorithms for Solving Problems of Econometric Growth ; Part II Growth and Environment: Groth and Climate Change - Threshold and Multiple Equilibria ; Optimal Economic Growth under Stochastic Environmental Impact - Sensitivity Analysis ; Optimal Economic Growth with a Random Environmental Shock ; Part III Growth and Environmental Policy: Prices Versus Quantities in a Vintage Capital Model ; International Emission Policy with Lobbying and Technological Change ; The Role of Product Differentiation in the Producer-target Promotion of Renewable Energy Technologies ; Dynamic Oligopoly with Capital Accumulation and Environmental Externality ; On a Decentralized Boundedly Rational Emission Reduction Strategy ; Part IV Applications: Environmental Mortality and Long-Run Growth ; Development of Transportation Infrastructure in the Context of Economic Growth
    Type of Medium: Monograph available for loan
    Pages: XVIII, 289 S.
    ISBN: 9783642021312
    Series Statement: Dynamic Modeling and Econometrics in Economics and Finance 12
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 20
    Monograph available for loan
    Monograph available for loan
    Pricing carbon : the European Union Emissions Trading Scheme (2010)
    Cambridge [u.a.] : Cambridge Univ. Press
    Details Availability
    Call number: PIK B 160-10-0056
    Description / Table of Contents: Contents: 1. Introduction ; 2. Origins and development of the EU ETS ; 3. Allowance allocation ; 4. Effects of free allocation ; 5. Market development ; 6. Emissions abatement ; 7. Industrial competitiveness ; 8. Costs ; 9. Linkage and global implications ; 10. Conclusions ; Annex: The interaction between the EU ETS and European electricity markets
    Type of Medium: Monograph available for loan
    Pages: XXI, 368 S. : graph. Darst.
    ISBN: 9780521196475
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 21
    Monograph available for loan
    Monograph available for loan
    Governing uncertainty : environmental regulation in the age of nanotechnology (2010)
    Washington, DC [u.a.] : RFF Press
    Details Availability
    Call number: PIK N 071-10-0057
    Description / Table of Contents: Contents: Foreword: Nanotechnology, risk, and governance ; 1. Policy consequences of the 'Next Industrial Revolution' ; 2. A world of its own? Nanotechnology's promise - and challenges ; 3. Institutional evolution or intelligent design? Constructing a regulatory regime for nanotechnology ; 4. Engaging business in the regulation of nanotechnology ; 5. EPA and nanotechnology: The need for a grand bargain? ; 6. Nanotechnology and the evolving role of state governance ; 7. Nanotechnology and twenty-first-century governance
    Type of Medium: Monograph available for loan
    Pages: XVIII, 155 S.
    ISBN: 9781933115795
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 22
    Monograph available for loan
    Monograph available for loan
    The collapse of complex societies (2010)
    Cambridge [u.a.] : Cambridge Univ. Press
    Details Availability
    Call number: PIK D 024-10-0162 ; PIK D 024-10-0224 ; IASS 12.0079
    Description / Table of Contents: Contents: Acknowledgements ; 1. Introduction to collapse ; 2. The nature of complex societies ; 3. The study of collapse ; 4. Understanding collapse: the marginal productivity of sociopolitical change ; 5. Evaluation: complexity and marginal returns in collapsing societies ; 6. Summary and implications
    Type of Medium: Monograph available for loan
    Pages: XIII, 250 S. : Ill., graph. Darst.
    Edition: 21. print.
    ISBN: 9780521386739
    Series Statement: New studies in archaeology
    Location: A 18 - must be ordered
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Branch Library: PIK Library
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 23
    Monograph available for loan
    Monograph available for loan
    Projected Costs of Generating Electricity (2010)
    Paris : OECD
    Details
    Call number: PIK P 113-10-0202
    Description / Table of Contents: This joint IEA/NEA report on electricity generating costs presents the latest data available for a wide variety of fuels and technologies, including coal and gas (with and without carbon capture), nuclear, hydro, onshore and offshore wind, biomass, solar, wave and tidal as well as combined heat and power (CHP).  It provides levelised costs of electricity (LCOE) per MWh for almost 200 plants, based on data covering 21 countries (including four major non-OECD countries), and several industrial companies and organisations.  For the first time, the report contains an extensive sensitivit
    Type of Medium: Monograph available for loan
    Pages: 215 S. : graph. Darst.
    ISBN: 9789264084308
    Language: English
    Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 24
    Monograph available for loan
    Monograph available for loan
    Wirtschaftsmacht Brasilien : der grüne Riese erwacht (2010)
    Bonn : Bundeszentrale für Politische Bildung
    Details Availability
    Call number: PIK B 322-10-0055
    Description / Table of Contents: Contents: 1. Warum wir uns auf die neue Großmacht aus dem Süden einstellen sollten ; 2. Und ewig lockt der Binnenmarkt: Ein Wirtschaftsboom verändert das Land ; 3. Die Weichen wurden vorher gestellt: Wie Brasilien auf die globale Arbeitsteilung in der Weltwirtschaft vorbereitet wurde ; 4. Der lange Weg an die Weltspitze: Wo Brasiliens unternehmen stark sind ; 5. Brasilien ernährt die Welt: Von verschlafenen Plantagen zur eigenen Genomforschung ; 6. Die Geheimnisse der Riesen aus Rio: Petrobras, Vale, BNDES & Co. ; 7. Demokratie als Standortvorteil - die Herausforderungen ; 8. Weltmacht Brasilien: Der Aufstieg auf die Weltbühne ; 9. Die grüne Weltmacht: Biotreibstoffe ; 10. Die grüne Weltmacht: Am Amazonas entscheidet sich Brasiliens Rolle in der weltweiten Klimadebatte; 11. Ausblick
    Type of Medium: Monograph available for loan
    Pages: X, 262 S. : graph. Darst.
    Edition: Lizenzausg.
    ISBN: 9783838900407
    Series Statement: Schriftenreihe 1040
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 25
    Monograph available for loan
    Monograph available for loan
    Wie aus heiterem Himmel? : Naturkatastrophen und Klimawandel ; was uns erwartet und wie wir uns darauf einstellen sollten (2010)
    München : Dt. Taschenbuch-Verl.
    Details Availability
    Call number: PIK N 076-10-0058
    Description / Table of Contents: Contents: Einleitung - Wie aus heiterem Himmel ; Erdbebenkatastrophen - Der sichere Boden unter den Füßen ist weg ; Tsunami-Katastrophen - Eine Wand aus Wasser ; Vulkankatastrophen - Brennende Luft, Glutregen vom Himmel ; Sturmkatastrophen - Die Zeichen stehen auf Sturm ; Unwetterkatastrophen - Wolken, Blitz und Hagelschlag ; Wasserkatastrophen - Land unter ; Hitze- und Kältekatastrophen - Dürre, Waldbrände und Lawinen ; Weltweite Zunahme der Naturkatastrophen - Ein Tanz auf dem Vulkan ; Globale Umweltveränderungen und Klimawandel - Steuern wir auf eine Katastrophe zu? ; Katastrophenvorsorge - Das Unvermeidbare kontrollieren, das Unkontrollierbare vermeiden ; Ausblick - Die Zukunft ist auch nicht mehr das, was sie einmal war
    Type of Medium: Monograph available for loan
    Pages: 231 S. : Ill., graph. Darst., Kt.
    Edition: Orig.-Ausg.
    ISBN: 9783423247665
    Series Statement: dtv 24766 : Premium
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 26
    Monograph available for loan
    Monograph available for loan
    Global aber gerecht : Klimawandel bekämpfen, Entwicklung ermöglichen (2010)
    München : Beck
    Details Availability
    Call number: PIK D 024-10-0197 ; PIK D 024-11-0281 ; PIK D 024-12-0142 ; PIK D 024-15-0015
    Description / Table of Contents: Contents: Vorwort der Auftraggeber ; 1. Global, aber gerecht: Klimaverträgliche Entwicklung für alle ; 2. Klimafolgen und Verwundbarkeit ; 3. Die ethische Dimension: Gerechtigkeit im Kontext von Klimawandel und Armut ; 4. Optionen und Herausforderungen für die Emissionsvermeidung ; 5. Optionen für die Anpassung an den Klimawandel ; 6. Global Deal für Klima- und Entwicklungspolitik ; 7. Klimawandel bekämpfen, Entwicklung ermöglichen: Zehn politische Botschaften
    Type of Medium: Monograph available for loan
    Pages: 240 S. : graph. Darst., Kt.
    ISBN: 9783406606564
    Location: A 18 - must be ordered
    Location: A 18 - must be ordered
    Location: A 18 - must be ordered
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Branch Library: PIK Library
    Branch Library: PIK Library
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 27
    Monograph available for loan
    Monograph available for loan
    Elements of programming (2010)
    Upper Saddle River, NJ [u.a.] : Addison-Wesley
    Details Availability
    Call number: PIK M 031-10-0228
    Description / Table of Contents: Contents: 1: Foundations ; 2: Transformations and Their Orbits ; 3: Associative Operations ; 4: Linear Orderings ; 5: Ordered Algebraic Structures ; 6: Iterators ; 7: Coordinate Structures ; 8: Coordinates with Mutable Successors ; 9: Copying ; 10: Rearrangements ; 11: Partition and Merging ; 12: Composite Objects ; Afterword ; Appendix A: Mathematical Notation ; Appendix B: Programming Language
    Type of Medium: Monograph available for loan
    Pages: XIII, 262 S. : graph. Darst.
    Edition: 3. print.
    ISBN: 9780321635372
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 28
    Monograph available for loan
    Monograph available for loan
    Climate time series analysis : classical statistical and bootstrap methods (2010)
    Dordrecht [u.a.] : Springer
    Associated volumes
    Details Availability
    Call number: PIK N 456-10-0230
    In: Atmospheric and oceanographic sciences library
    Description / Table of Contents: Contents: 1. Introduction ; 2. Persistence models ; 3. Bootstrap confidence intervals ; 4. Regression I ; 5. Spectral analysis ; 6. Extreme value time series ; 7. Correlation ; 8. Regression II ; 9. Future directions
    Type of Medium: Monograph available for loan
    Pages: XXXIV, 474 S. : Ill., graph. Darst.
    ISBN: 9789048194810
    Series Statement: Atmospheric and oceanographic sciences library 42
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 29
    Monograph available for loan
    Monograph available for loan
    Menschenzeit : Zerstören oder gestalten? Die entscheidende Epoche unseres Planeten (2010)
    München : Riemann
    Details Availability
    Call number: PIK N 076-10-0209
    Description / Table of Contents: Contents: Das Zeitalter des Menschen ; Planet auf Pump ; Gezüchtete Welt ; Schöpfermensch ; Heimkehr auf die Erde ; Globale Gleichheit ; Aktionspotenziale ; Der neue Jugendstil ; Das "Lange Jetzt"
    Type of Medium: Monograph available for loan
    Pages: 319 S.
    Edition: 1. Aufl.
    ISBN: 9783570501184
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 30
    Monograph available for loan
    Monograph available for loan
    Merchants of doubt : how a handful of scientists obscured the truth on issues from tobacco smoke to global warming (2010)
    New York [u.a.] : Bloomsbury Press
    Details Availability
    Call number: PIK N 076-10-0231
    Description / Table of Contents: Contents: Introduction ; 1. Doubt is our product ; 2. Strategic defense, phony facts, and the creation of the George C. Marshall Institute ; 3. Sowing the seeds of doubt: acid rain ; 4. Constructing a counternarrative: the fight over the Ozone hole ; 5. What's bad science? Who decides? The fight over secondhand smoke ; 6. The denial of global warming ; 7. Denial rides again: the revisionist attack on Rachel Carson ; Conclusion: Of free speech and free markets ; Epilogue: A new view of science
    Type of Medium: Monograph available for loan
    Pages: 355 S.
    Edition: 1. U.S. ed.
    ISBN: 9781596916104
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 31
    Monograph available for loan
    Monograph available for loan
    Continents under climate change : conference on the occasion of the 200th anniversary of the Humboldt-Universität zu Berlin ; April 21 to 23, 2010 ; with 17 tables (2010)
    Stuttgart : Wiss. Verl.-Ges.
    Associated volumes
    Details Availability
    Call number: PIK N 076-10-0127 ; S 00.0272(384)
    In: Nova acta Leopoldina
    Description / Table of Contents: Contents: KEYNOTE: A tipping-elements expedition in the footsteps of Alexander von Humboldt ; EUROPE: Changes of the climate system in Europe ; From Utopia to common sense: global climate policy that could work ; Global warming below 2 °C relative to pre-industrial level: how might climate look like in Europe ; Sea level rise and coastal protection - adaptation strategies for sandy coasts ; Simulating the future - responses of ecosystems, key species, and European provenances to expected climatic trends and events ; Climate change effects on Vector-Borne diseases in Europe ; Vattenfall's experience with CCS Technology ; Adaptive governance within Europe - the need for integrated adaptation strategies ; POLAR REGIONS: Changes of the climate system in the polar regions ; Climate variability and glacier response at Vestfonna - a case study of arctic climate and glacier dynamics at Nordaustlandet (Svalbard) in recent years ; AFRICA: Downscaling of Future Climate Change for theMediterranean Region ; Solar Signals in African Climate since 1901 ; Climate Change and Land Use Conflicts in Northern Africa ; How Will the Future Climate of the Southern African Region Might Look Like: Results of a High-Resolution Regional Climate Change Projection ; Impacts of Global Change on the Hydrological Cycle in West and Northwest Africa ; Climate Change Adaptation in Africa and Asia: Challenges Ahead and Action Needed ; ASIA: Sustainability: Engaging in Global Change through Harmonious Adaptation in Asia ; Climate Change in Indian Sub-Continent and its Impact on Agriculture ; Observed and Projected Sea Level Rise, Impact on the Pacific and Indian Tropical Islands ; AMERICA: Regional Climate Change Scenarios in South America in the Late XXI Century: Projections and Expected Impacts ; Urban Latin America under Climate Change: Do Adaptation Strategies of City-Regions Respond to the Challenges? ; Climate Change in Brazil: The Impacts of Different Actors on the Creation of the National Policy ; Mountain Permafrost - A Valid Archive to Study Climate Change? Examples from the Rocky Mountains Front Range of Colorado, USA ; AUSTRALIA: Impacts of Climate Change in Australia ; Satellite Observations for Identifying Continental-Scale Climate Change over Australia
    Type of Medium: Monograph available for loan
    Pages: 317 S. : Ill., graph. Darst., Kt.
    ISBN: 9783804727953
    Series Statement: Nova acta Leopoldina N.F., Nr. 384 = Bd. 112
    Classification:
    Meteorology and Climatology
    Location: A 18 - must be ordered
    Location: Lower compact magazine
    Branch Library: PIK Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 32
    Monograph available for loan
    Monograph available for loan
    Awakening giants, feet of clay : assessing the economic rise of China and India (2010)
    Princeton [u.a.] : Princeton Univ. Press
    Details Availability
    Call number: PIK B 160-10-0187
    Description / Table of Contents: Contents: Chapter 1 Introduction: The Myths Floating around the Giants ; Chapter 2 Economic Reform and Growth: Differing Patterns and Institutions ; Chapter 3 Agriculture: Still the Most Crowded Sector ; Chapter 4 Infrastructure: The Dazzling Difference ; Chapter 5 High Saving, Low Financial Intermediation ; Chapter 6 The Pattern of Burgeoning Capitalism ; Chapter 7 Poverty and Inequality: How Is the Growth Shared? ; Chapter 8 The Social Sector: The Relevance of the Socialist Legacy ; Chapter 9 Environment: The Alarming Signs ; Chapter 10 Looking to the Future: Through the Lens of Political Economy
    Type of Medium: Monograph available for loan
    Pages: VII, 172 S. : graph. Darst.
    ISBN: 9780691129945
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 33
    Monograph available for loan
    Monograph available for loan
    The return to Keynes (2010)
    Cambridge [u.a.] : Harvard Univ. Press
    Details Availability
    Call number: PIK B 160-10-0188
    Description / Table of Contents: Contents: Introduction: The Return to Keynes ; Part I: Keynesian Economic Policy: Past, Present and Future ; Keynes Returns to America ; Japan's Long-run Stagnation and Economic Policies ; European Macroeconomic Policy: A Return to Active Stabilization? ; Part II: Interpreting Keynesian Theory and Keynesianism ; From the "Old" to the "New" Keynesian-Neoclassical Synthesis: An Interpretation ; Tobin's Keynesianism ; The New Neoclassical Synthesis and the Wicksell-Keynes Connection ; Part III: Re-reading and Interpreting Keynes ; An Abstruse and Mathematical Argument: The Use of Mathematical Reasoning in the General Theory ; The General Theory: Toward the Concept of Stochastic Macro-equilibrium ; Keynes's Economics in the Making ; Keynes, Sraffa and the Latter's "Secret Skepticism" ; Keynes and the War of Words ; Part IV: Global Crisis: Lessons from Keynes ; Keynes and Modern International Finance Theory ; Keynes's Influence on Modern Economics: Some Overlooked Contributions of Keynes's Theory of Finance and Economic Policy ; Current Global Imbalances: Might Keynes Be of Help?
    Type of Medium: Monograph available for loan
    Pages: VI, 312 S. : graph. Darst.
    ISBN: 9780674035386
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 34
    Monograph available for loan
    Monograph available for loan
    Climate ethics : essential readings (2010)
    Oxford [u.a.] : Oxford Univ. Press
    Details Availability
    Call number: PIK N 073-10-0195 ; IASS 12.0087
    Description / Table of Contents: Contents: A. Overview ; 1: 'Ethics and Global Climate Change' ; B. The Nature of the Problem ; 2: 'The Economics of Climate Change' ; 3: 'Ethics, Public Policy and Global Warming' ; 4: 'A Perfect Moral Storm: Climate Change, Intergenerational Ethics and the Problem of Moral Corruption' ; C: Global Justice and Future Generations ; 5: 'Global Environment and International Inequality' ; 6: 'Energy Policy and the Further Future: The Identity Problem' ; 7: 'Cosmopolitan Justice, Responsibility and Global Climate Change' ; 8: 'Deadly Delays, Saving Opportunities: Creating a More Dangerous World?' ; 9: 'Climate Change, Human Rights and Moral Thresholds' ; D: Policy Responses to Climate Change ; 10: 'One Atmosphere' ; 11: 'Subsistence Emissions and Luxury Emissions' ; 12: 'Greenhouse Development Rights: A Framework for Climate Protection that is "More Fair" than Equal per Capita Emissions Rights' ; 13: 'Selling Environmental Indulgences' ; 14: 'Adaptation: Who Pays Whom?' ; 15: Adaptation, Mitigation, and Justice' ; 16: 'Is "Arming the Future" with Geoengineering Really the Lesser Evil? Some Doubts About the Ethics of Intentionally Manipulating the Climate System' ; E. Individual Responsibility ; 17: 'When Utilitarians Should be Virtue Theorists' ; 18: 'It's Not My Fault: Global Warming and Individual Moral Obligations'
    Type of Medium: Monograph available for loan
    Pages: XVI, 351 S. : graph. Darst.
    ISBN: 9780195399615
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 35
    Monograph available for loan
    Monograph available for loan
    Understanding sea-level rise and variability (2010)
    Chichester [u.a.] : Wiley-Blackwell
    Details Availability
    Call number: M 10.0317 ; PIK N 076-11-0044
    Description / Table of Contents: Content: 1. Introduction 2. Impacts of and Responses to Sea-Level Rise 3. A First-Order Assessment of the Impact of Long-Term Trends in Extreme Sea Levels on Offshore Structures and Coastal Refineries 4. Paleoenvironmental Records, Geophysical Modeling, and Reconstruction of Sea-Level Trends and Variability on Centennial and Longer Timescales 5. Modern Sea-Level-Change Estimates 6. Ocean Temperature and Salinity Contributions to Global and Regional Sea-Level Change 7. Cryospheric Contributions to Sea-level Rise and Variability 8 Terrestrial Water-Storage Contributions to Sea-Level Rise and Variability 9. Geodetic Observations and Global Reference Frame Contributions to Understanding Sea-Level Rise and Variability 10. Surface Mass Loading on a Dynamic Earth: Complexity and Contamination in the Geodetic Analysis of Global Sea-Level Trends 11. Past and Future Changes in Extreme Sea Levels and Waves 12. Observing Systems Needed to Address Sea-level Rise and Variability 13. Sea-level Rise and Variability: Synthesis and Outlook for the Future
    Type of Medium: Monograph available for loan
    Pages: XXVI, 428 S. : Ill., graph. Darst., Kt.
    ISBN: 9781444334524
    Classification:
    Geodetic Measurement Systems
    Location: Upper compact magazine
    Location: A 18 - must be ordered
    Branch Library: GFZ Library
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 36
    Monograph available for loan
    Monograph available for loan
    The plundered planet : why we must - and how we can - manage nature for global prosperity (2010)
    Oxford [u.a.] : Oxford Univ. Press
    Details Availability
    Call number: PIK B 010-11-0016
    Description / Table of Contents: Contents: Part I The Ethics of Nature ; Chapter 1: Poverty and Plunder ; Chapter 2: Is Nature Priceless? ; Part II Nature as Asset ; Chapter 3: Cursed by Nature? The Politics of Natural Assets ; Chapter 4: Discovering Natural Assets ; Chapter 5: Capturing Natural Assets ; Chapter 6: Selling the Family Silver ; Chapter 7: Investing in Investing ; Part III Nature as a Factory ; Chapter 8: Is a Fish a Natural Asset? ; Chapter 9: Natural Liabilities ; Part IV Nature Misunderstood ; Chapter 10: Nature and Hunger ; Part V Natural Order ; Chapter 11: Restoring Natural Order
    Type of Medium: Monograph available for loan
    Pages: XV, 271 S.
    ISBN: 9780195395259
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 37
    Monograph available for loan
    Monograph available for loan
    Es bleibe Licht : 100 % Ökostrom für Europa ohne Klimaabkommen ; ein Reiseführer (2010)
    Baden-Baden : Dt. Wiss.-Verl.
    Details Availability
    Call number: PIK P 129-11-0008
    Description / Table of Contents: Contents: TEIL I: Zwei Tausendstel Sahara ; Kapitel 1: Über das Klima und die Lebensader unserer Zivilisation - den elektrischen Strom ; Kapitel 2: Europa unter Strom 2040 ; Kapitel 3: Ein Treffen in Düsternbrook ; TEIL II: Ein Blumenstrauß von Alternativen ; Kapitel 4: Wo weht der Wind bei Flaute? ; Kapitel 5: Kann die Sonne nachts scheinen? ; Kapitel 6: Norwegen, der Wasserspeicher Europas ; Kapitel 7: Sonne vom Acker ; Kapitel 8: Erde, Mond und Ozean ; TEIL III: Odyssee in die Zukunft ; Kapitel 9: Unsere größte Energiequelle ; 1. Exkurs: Utopie oder Wahnsinn? ; Kapitel 10: Die Dialektik zwischen Steckdose und Heizung ; Kapitel 11: Wie kann man Strom aufbewahren? ; 2. Exkurs: Das E-Mobil ; Kapitel 12: Saubere Kohle oder dreckige Lüge? ; Kapitel 13: Lehren aus Tomsk-7 und Olkiluoto ; TEIL IV: Wer das Netz hat, hat die Macht ; Kapitel 14: Just in Time ; Kapitel 15: Das Smart Grid ; 3. Exkurs: Animositäten im Netz ; Kapitel 16: Das Supergrid ; 4. Exkurs: AC/DC und der späte Triumph von Thomas Edison ; TEIL V: Visionen und Märchen ; Kapitel 17: Viele Wege führen nach [St]Rom ; Kapitel 18: Wer soll das bezahlen? ; Kapitel 19: Das Märchen von der Stromlücke ; Kapitel 20: Im Land der Dinosaurier ; TEIL VI: Die große Transformation ; Kapitel 21 : Vom Verrat an den Idealen und der Sicherheit der Versorgung ; Kapitel 22: Sir Nicholas Stern und der Green New Deal ; Kapitel 23: Wie geht's weiter nach Kopenhagen? ; Kapitel 24: Die Herausforderung des 21. Jahrhunderts
    Type of Medium: Monograph available for loan
    Pages: 345 S. : Ill., graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9783868880236
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 38
    Monograph available for loan
    Monograph available for loan
    Oracle APEX 4.0 cookbook : Over 80 great recipes to develop and deploy fast, secure, and modern web applications with Oracle Application Express 4.0 (2010)
    Birmingham [u.a.] : Packt Publ.
    Details Availability
    Call number: PIK M 032-11-0014
    Description / Table of Contents: Contents: Preface ; Chapter 1: Creating a Basic APEX Application ; Chapter 2: Themes and Templates ; Chapter 3: Extending APEX ; Chapter 4: Creating Websheet Applications ; Chapter 5: APEX Plug-ins ; Chapter 6: Creating Multilingual APEX Applications ; Chapter 7: APEX APIs ; Chapter 8: Using Webservices ; Chapter 9: Publishing from APEX ; Chapter 10: APEX Environment ; Chapter 11: APEX Administration ; Chapter 12: Team Development
    Type of Medium: Monograph available for loan
    Pages: IV, 311 S. : Ill., graph. Darst
    ISBN: 9781849681346
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 39
    Monograph available for loan
    Monograph available for loan
    A vast machine : computer models, climate data, and the politics of global warming (2010)
    Cambridge, Mass. [u.a.] : MIT Press
    Details Availability
    Call number: PIK N 076-11-0079
    Description / Table of Contents: Contents: Introduction ; Thinking Globally ; Global Space, Universal Time: Seeing the Planetary Atmosphere ; Standards and Networks: International Meteorology and the Réseau Mondial ; Climatology and Climate Change before World War ; Friction ; Numerical Weather Prediction ; The Infinite Forecast ; Making Global Data ; The First WWW ; Making Data Global ; Data Wars ; Reanalysis: The Do-Over ; Parametrics and the Limits of Knowledge ; Simulation Models and Atmospheric Politics, 1960-1992 ; Signal and Noise: Consensus, Controversy, and Climate Change ; Conclusion
    Type of Medium: Monograph available for loan
    Pages: XXVII, 518 S. : Ill., graph. Darst.
    ISBN: 9780262013925
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 40
    Monograph available for loan
    Monograph available for loan
    Reset : wie wir anders leben, arbeiten und eine neue Ära des Wohlstands begründen werden (2010)
    Frankfurt am Main [u.a.] : Campus
    Details Availability
    Call number: PIK B 160-11-0067
    Description / Table of Contents: Contents: Teil I: Vergangenheit als Prolog ; 1. Der große Reset ; 2. Die großen Vorgänger ; 3. Stadtentwicklung als Innovation ; 4. Das Jahrzehnt der größten technischen Fortschritte ; 5. Die Stunde der Vorstadt ; 6. Raumlösungen ; 7. Die Fäden entwirren ; Teil II: Die Umgestaltung der Wirtschaftslandschaft ; 8. Die Hauptstadt des Kapitals ; 9. Ablösung an der Spitze? ; 10. Der FIRE-Sektor ; 11. Der Boom der Behördenstädte ; 12. Leben und Sterben alter Industriestädte ; 13. Nordlicht ; 14. Sonnenuntergang über dem Sunbelt ; Teil III: Eine neue Lebensweise ; 15. Die Reset-Ökonomie ; 16. Eine gute Jobmaschine ; 17. Die neue Normalität ; 18. Die große Umsiedlung ; 19. Groß, schnell und grün ; 20. Die eigene Geschwindigkeit ; 21. Wie ein geölter Blitz ; 22. Ein Traum zur Miete ; 23. Der Zeitpunkt für den Reset
    Type of Medium: Monograph available for loan
    Pages: 248 S.
    ISBN: 9783593391250
    Uniform Title: The great reset
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 41
    Monograph available for loan
    Monograph available for loan
    Economic thought and U.S. climate change policy (2010)
    Cambridge [u.a.] : MIT Press
    Details Availability
    Call number: PIK N 071-11-0053
    Description / Table of Contents: Contents: Introduction ; I The Neoliberal Model's Contribution to U.S. Failure to Address Climate Change ; 1 The United States' Failure to Act ; 2 Dirty Energy Policy ; 3 Cost-Benefit Analysis of Climate Change ; 4 Anatomy of Industry Resistance to Climate Change ; 5 The Abandonment of Justice ; 6 Neoliberal Instrument Choice ; II Moving Forward ; 7 Collective and Individual Duties to Address Global Warming ; 8 Embracing a Precautionary Approach to Climate Change ; 9 Climate Change, Human Health, and the Post-Cautionary Principle ; 10 The Cost of Greenhouse Gas Reductions ; 11 Toward Distributional Justice ; 12 Toward Sustainable Technology ; 13 Adaptation, Economics, and Justice ; Conclusion: Toward a Fresh Start
    Type of Medium: Monograph available for loan
    Pages: XIV, 356 S. : graph. Darst.
    ISBN: 026254198X , 978-0-262-54198-5
    Series Statement: American and comparative environmental policy
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 42
    Monograph available for loan
    Monograph available for loan
    Models of change : Einführung und Verbreitung sozialer Innovationen und gesellschaftlicher Veränderungen in transdisziplinärer Perspektive (2010)
    Zürich : vdf Hochschulvlg.
    Details Availability
    Call number: PIK E 711-11-0010
    Description / Table of Contents: Contents: 1 Fragestellung, Forschungsbedarf und Forschungsdesign ; 2 Theoriengeschichte der Wandlungsprozesse ; 3 Überprüfung des Modells aus dem Blickwinkel der wissenschaftlichen Theorienbildung ; 4 Übergreifende Auswertung der (inter-)disziplinären Theorien zu Veränderungsprozessen ; 5 Überprüfung des Modells durch die impliziten Theorien der Praxis - die Einzelinterviews ; 6 Übergreifende Auswertung der Interviews ; 7 Zusammenfassende Ergebnisdarstellung und Schlussfolgerungen - das neue Veränderungsmodell
    Type of Medium: Monograph available for loan
    Pages: XXI, 562 S. : Ill., graph. Darst.
    ISBN: 9783728133151
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 43
    Monograph available for loan
    Monograph available for loan
    The social and behavioural aspects of climate change : linking vulnerability, adaptation and mitigation (2010)
    Sheffield : Greenleaf
    Details Availability
    Call number: PIK D 024-11-0012
    Description / Table of Contents: Contents: 1. The social and behavioural aspects of climate change: linking vulnerability, adaptation and mitigation ; I. Industries ; 2. Climate change and inland navigation between the Netherlands and Germany: an economic analysis ; 3. Climate change impacts: the vulnerability of tourism in coastal Europe ; 4. Corporate responses to climate change: the role of partnerships ; 5. Energy conservation in Dutch housing renovation projects ; II. Local communities ; 6. Natural hazards, poverty traps and adaptive livelihoods in Nicaragua ; 7. Climate change adaptation in Mozambique ; 8. Adaptation to climate change induced flooding in Dutch municipalities ; 9. Human responses to climate change: flooding experiences in the Netherlands ; III. Institutions ; 10. Interactions between white certificates for energy efficiency and other energy and climate policy instruments ; 11. Distributional choices in EU climate change policy seen through the lens of legal principles ; 12. Climate change liability and the application of the precautionary principle ; 13. Incentives for international cooperation on adaptation and mitigation ; 14. Imagining the unimaginable: Synthesis of essays on abrupt and extreme climate change ; 15. Conclusion
    Type of Medium: Monograph available for loan
    Pages: VIII, 312 S. : graph. Darst.
    ISBN: 9781906093426
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 44
    Monograph available for loan
    Monograph available for loan
    The microtheory of innovative entrepreneurship (2010)
    Princeton, NJ [u.a.] : Princeton Univ. Press
    Details Availability
    Call number: PIK B 160-11-0089
    Description / Table of Contents: Contents: PREFACE: The Innovative Entrepreneur in Dynamic Microtheory ; INTRODUCTION: Bringing Entrepreneurship and Innovation into the Theory of Value ; CHAPTER 1: Entrepreneurship in Economic Theory: Reasons for Its Absence and Goals for Its Restoration ; PART I: Pricing, Remuneration, and Allocation of the Agents of Innovation ; CHAPTER 2: Toward Characterization of the Innovation Industry: The David-Goliath Symbiosis ; CHAPTER 3: Entrepreneurship, Invention, and Pricing: Toward Static Microtheory ; CHAPTER 4: Oligopolistic "Red Queen" Innovation Games, Mandatory Price Discrimination, and Markets in Innovation ; PART II: Welfare Theory: Technology Transfer, Imitation, and Creative Destruction ; CHAPTER 5: Optimal Innovation Spillovers: The Growth-Distribution Trade-off ; CHAPTER 6: Enterprising Technology Dissemination: Toward Optimal Transfer Pricing and the Invaluable Contribution of "Mere Imitation" ; CHAPTER 7: The Entrepreneur and the Beneficial Externalities of Creative Destruction ; PART III: Institutions, Payoffs, and the Entrepreneur's Choice of Activity: Historical Origins ; CHAPTER 8: Economic Warfare as a "Red Queen" Game: The Emergence of Productive Entrepreneurship ; CHAPTER 9: On the Origins of Widespread Productive Entrepreneurship ; CHAPTER 10: The Allocation of Entrepreneurship Does Matter ; CHAPTER 11: Mega-enterprising Redesign of Governing Institutions: Keystone of Dynamic Microtheory ; CHAPTER 12: Summing Up: Yes, the Theory of Entrepreneurship Is on Its Way
    Type of Medium: Monograph available for loan
    Pages: XIV, 246 S. : Ill., graph. Darst.
    ISBN: 9780691145846
    Series Statement: The Kauffman Foundation series on innovation and entrepreneurship
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 45
    Monograph available for loan
    Monograph available for loan
    Risk management and governance : concepts, guidelines and applications (2010)
    Berin ; Heidelberg : Springer
    Details Availability
    Call number: PIK D 029-11-0115 ; IASS 16.90132
    Description / Table of Contents: Contents: 1. Introduction: Concept of Risk ; 2. Characteristics of Risks in the Modern World ; 3. Risk Perspectives ; 4. Risk Governance: An Overview ; 5. Pre-assessment and Framing of Risk ; 6. Risk Appraisal ; 7. Risk Characterization and Evaluation ; 8. Risk Management ; 9. Risk Communication ; 10. Stakeholder and Public Involvement ; 11. Case Study 1: Risk Governance of Nanotechnology ; 12. Case Study 2: Cash Depot and Third Party Risk ; 13. Case Study 3: Year-Round Petroleum Activities in the Barents Sea ; 14. Conclusions
    Type of Medium: Monograph available for loan
    Pages: XIII, 292 Seiten , Illustrationen , 235 mm x 155 mm
    ISBN: 9783642139253 , 978-3-642-26520-4
    Series Statement: Risk, governance and society 16
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 46
    Monograph available for loan
    Monograph available for loan
    Managen (2010)
    Offenbach : Gabal-Verl.
    Details Availability
    Call number: PIK B 522-11-0064
    Description / Table of Contents: Contents: 1. Managen - vorwärts marsch! ; 2. Die Dynamik des Managens ; 3. Ein Managementmodell ; 4. Die unzähligen Formen des Managens ; 5. Die Dilemmata des Managens ; 6. Erfolgreich managen
    Type of Medium: Monograph available for loan
    Pages: 390 S. : graph. Darst.
    ISBN: 9783869361055
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 47
    Monograph available for loan
    Monograph available for loan
    The physics of glaciers (2010)
    Amsterdam [u.a.] : Elsevier [u.a.]
    Details Availability
    Call number: PIK N 454-11-0152 ; AWI G7-11-0049
    Description / Table of Contents: Contents: 1. Introduction ; 2. Transformation of Snow to Ice ; 3. Grain-Scale Structures and Deformation of Ice ; 4. Mass Balance Processes: 1. Overview and Regimes ; 5. Mass Balance Processes: 2. Surface Ablation and Energy Budget ; 6. Glacial Hydrology ; 7. Basal Slip ; 8. The Flow of Ice Masses ; 9. Temperatures in Ice Masses ; 10. Large-Scale Structures ; 11. Reaction of Glaciers to Environmental Changes ; 12. Glacier Surges ; 13. Ice Sheets and the Earth System ; 14. Ice, Sea Level, and Contemporary Climate Change ; 15. Ice Core Studies ; Appendix: A Primer on Stress and Strain
    Type of Medium: Monograph available for loan
    Pages: XII, 693 S., [7] Bl. : Ill., graph. Darst., Kt.
    Edition: 4. [rev.] ed., repr. 2011
    ISBN: 9780123694614
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 48
    Monograph available for loan
    Monograph available for loan
    Global commons, domestic decisions : the comparative politics of climate change (2010)
    Cambridge, Mass. [u.a.] : MIT Press
    Details Availability
    Call number: PIK D 024-11-0253
    Description / Table of Contents: Contents: Introduction: Global Commons, Domestic Decisions ; European Union Leadership in Climate Change: Mitigation through Multilevel Reinforcement ; The United States as Outlier: Economic and Institutional Challenges to US Climate Policy ; Russia and the Kyoto Protocol: From Hot Air to Implementation? ; Climate Leadership, Japanese Style: Embedded Symbolism and Post-2001 Kyoto Protocol Politics ; The Struggle of Ideas and Self-Interest in Canadian Climate Policy ; Climate Clever? Kyoto and Australia's Decade of Recalcitrance ; Chinese Climate Policy: Domestic Priorities, Foreign Policy, and Emerging Implementation ; Conclusion: The Comparative Politics of Climate Change
    Type of Medium: Monograph available for loan
    Pages: XI, 312 S. : graph. Darst.
    ISBN: 9780262514316
    Series Statement: American and comparative environmental policy
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 49
    Monograph available for loan
    Monograph available for loan
    Discrete time (2010)
    Associated volumes
    Details Availability
    Call number: PIK B 160-11-0109
    In: Handbook on optimal growth
    Description / Table of Contents: Contents: 1. Optimal Growth Without Discounting ; 2. Optimal Growth Models with Discounted Return ; 3. Duality Theory in Infinite Horizon Optimization Models ; 4. Rationalizability in Optimal Growth Theory ; 5. On Stationary Optimal Stocks in Optimal Growth Theory: Existence and Uniqueness Results ; 6. Optimal Cycles and -Chaos ; 7. Intertemporal Allocation with a Non-convex Technology ; 8. Isotone Recursive Methods: The Case of Homogeneous Agents ; 9. Discrete-Time Recursive Utility ; 10. Indeterminacy in Discrete-Time Infinite-Horizon Models ; 11. Theory of Stochastic Optimal Economic Growth ; 12. The von Neumann-Gale Growth Model and Its Stochastic Generalization ; 13. Equilibrium Dynamics with Many Agents ; 14. Dynamic Games in Economics
    Type of Medium: Monograph available for loan
    Pages: XVIII, 477 S. : graph. Darst.
    ISBN: 9783642068867
    Series Statement: Handbook on optimal growth 1
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 50
    Monograph available for loan
    Monograph available for loan
    Das große Buch vom Klima (2010)
    Köln : Komet
    Details Availability
    Call number: PIK N 456-11-0154 ; PIK N 456-15-0024
    Description / Table of Contents: Contents: Wetter und Klima ; Die Atmosphäre: ein unruhiges Meer von Luft ; Hitze und Kälte - zwischen zwei Extremen ; Luftdruck: die Last der Atmosphäre ; Wolken und Regen: der nasse Planet ; Wind - vom Luftzug zum Orkan ; Wetterforschung und Wettervorhersage ; Die Rolle von Wasser und Eis im Klimasystem ; Der Einfluss von Land und Leben auf das Klimasystem ; Beiderseits des Äquators: die Tropen ; Die trockenen Hochdruckgürtel der Subtropen ; Das Klima der gemäßigten Breiten ; Die Tundren der Subpolargebiete ; Die eisigen Pole der Erde ; Klimaforschung - den Geheimnissen des Klimas auf der Spur ; Streifzug durch die Klimageschichte ; Wie der Mensch das Klima verändert ; Die Folgen der globalen Erwärmung ; Klimawandel: Vermeidung und Anpassung
    Type of Medium: Monograph available for loan
    Pages: 352 S. : zahlr. Ill., graph. Darst., Kt.
    ISBN: 9783898368667
    Location: A 18 - must be ordered
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 51
    Monograph available for loan
    Monograph available for loan
    Designing public policies : an approach based on multi-criteria analysis and computable general equilibrium modeling (2010)
    Berlin [u.a.] : Springer
    Associated volumes
    Details Availability
    Call number: PIK M 370-11-0174
    In: Lecture notes in economics and mathematical systems
    Description / Table of Contents: Contents: 1. General Framework: Policy Making as a Problem with Multiple Criteria ; 2. Economic Policy Using Applied General Equilibrium Models: An Overview ; 3. Basic Aspects of the Multiple Criteria Decision Making Paradigm ; 4. Multicriteria Economic Policies: General Ideas and Some Previous Experiences ; 5. Building a CGE Model for Economic and Environmental Policies ; 6. Designing Efficient Policies in Terms of Economic and Environmental Objectives ; 7. Compromise Policies: An Integration of Economic and Environmental Criteria ; 8. Joint Design of Economic and Environmental Policies: A Simonian Satisficing Approach ; 9. Proposal for an Alternative Multicriteria Policy Approach Based on Welfare Functions ; 10. Conclusions and Further Research
    Type of Medium: Monograph available for loan
    Pages: XVIII, 143 S. : graph. Darst.
    ISBN: 9783642121821
    Series Statement: Lecture notes in economics and mathematical systems 642
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 52
    Monograph available for loan
    Monograph available for loan
    Troubled waters : ocean science and governance (2010)
    Cambridge [u.a.] : Cambridge Univ. Press
    Details Availability
    Call number: PIK N 453-11-0290 ; IASS 12.0012
    Description / Table of Contents: Contents: Part I - Introduction ; Part II - The global context ; 1. For the ocean ; 2. The United Nations, oceans governance and science ; 3. Marine scientific research and the United Nations convention on the law of the sea ; 4. Fifty years of building national marine skills ; 5. The early days and evolution of the Intergovernmental Oceanographic Commission ; Part III - Oceans and science ; 6. Ocean science: an overview ; 7. The development of ocean climate programmes ; 8. The IOC's International Bathymetric Chart Series: a programme facing extermination? ; Harmful algae: a natural phenomenon that became a societal problem ; 10. Non-governmental international marine science organizations ; Part IV - Observations and data ; 11. Ocean observations: the Global Ocean Observing Systems ; 12. Oceanographic data: from paper to pixels ; Part V - Applications ; 13. Life on the edge: managing our coastal zones ; 14. Hazards and warnings ; 15. Regional cooperation: the Caribbean experience ; 16. Oceans, science and governments in Africa ; Part VI - Intergovernmental agencies and science ; 17. The Food and Agriculture Organization ; 18. The International Hydrographic Organization science partnerships ; 19. Ocean science and shipping: IMO's contribution ; 20. The UNEP's contribution to the oceans and marine science ; 21. The World Meteorological Organization need for ocean science ; Part VII - The future ; 22. The future ; 23. Afterword
    Type of Medium: Monograph available for loan
    Pages: XIV, 316 S. : Ill., graph. Darst.
    ISBN: 9780521765817
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 53
    Monograph available for loan
    Monograph available for loan
    Intertemporal resource economics : an introduction to the overlapping generations approach (2010)
    Berlin [u.a.] : Springer
    Details Availability
    Call number: PIK B 160-11-0255
    Description / Table of Contents: Contents: Part I: Basics.- 1 Introduction.- 2 Economic Growth and Natural Resources.- Part II: Efficiency and Market Equilibrium under Resource Abundance.- 3 Intergenerational Efficiency in Log-Linear Cobb-Douglas OLG Models.- 4 Intertemporal Market Equilibrium and Short-Run Intergenerational Efficiency.- 5 Steady-State Market Equilibrium, Long-Run Intergenerational Efficiency, and Optimality.- Part III: Efficiency and Market Equilibrium with Scarce Renewable Resources.- 6 Renewable Resources and Intergenerational Efficiency.- 7 Intertemporal Market Equilibrium and Intergenerational Efficiency with Renewable Resources.- Part IV: Intergenerational Equity and Market Equilibrium with Scarce Renewable Resources.- 8 Sustainable Economic Growth with Linear Resource Regeneration.- 9 Steady-State Sustainability under Logistically Regenerating Resources.- Part V: Shocks to Harvest Technology and Natural Regeneration.- 10 Resource Use with Physical Harvest Costs.- 11 Effects of Harvest Cost and Biological Shocks.- Index
    Type of Medium: Monograph available for loan
    Pages: X, 173 S. : graph. Darst.
    ISBN: 9783642132285
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 54
    Monograph available for loan
    Monograph available for loan
    Environment at the crossroads : [aiming for a sustainable future] (2010)
    Manchester : Carcanet
    Details Availability
    Call number: PIK N 073-11-0291
    Description / Table of Contents: Contents: Climate change as a global shifting force ; Has biodiversity a future? ; The ethical challenge of sustainability in water management ; The environmental crisis and the future of agriculture ; Hyper-consumer society and happiness ; Europe, the USA and China after the crisis: towards new growth models for sustainability? ; Citizen action on climate change and sustainable development ; Emissions trading schemes and the future of the carbon economy ; Charting a course for the future of the oceans: present state and future perspectives ; Governance for sustainability ; Climate change: the perspective from europe ; Climate change politics under Barack Obama ; Prospects for a sustainable future
    Type of Medium: Monograph available for loan
    Pages: XXXVII, 184 S. : graph. Darst.
    ISBN: 9781847771193
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 55
    Monograph available for loan
    Monograph available for loan
    The paradigm shift towards energy sustainability : climate change, innovation and the optimal instrument mix ; proceedings of the Summer Academy "Energy and the Environment", Greifswald, 20 July - 8 August 2008 (2010)
    Berlin : Lexxion
    Details Availability
    Call number: PIK P 129-11-0343
    Description / Table of Contents: Contents: Introduction ; 1 Climate Change Technology Policies, Toolbox Solutions and Social Foundations ; Comparing Environmental and Technology Policies for Climate Mitigation and Renewable Energy ; Pathways to Energy Sustainability: New Instruments for Promoting Energy Efficiency ; Energy, the Environment and Price-Based Instruments: Environmental Taxes as a Tool for Energy Sustainability and Climate Policy ; Domestic Kyoto Implementation or Cheap Certificates? A Decision Support Tool for Policy Makers when Designing Climate Protection Strategies Considering Potential Co-Benefits ; Prospects of Renewables in the CDM Market: Potential, Barriers and Opportunities for their Diffusion ; The Role of Human Actors in the Institutionalization and Application of Technological Innovations forEnergy-Based Sustainable Development Projects ; Social Science Perspectives on the Transition in the Energy System: Dynamics, Instruments and the Case of Photovoltaics ; 2 Regional Experience ; CO2 Emissions Mitigation Potential in Vietnam's Power Sector ; Walking Before Running: Promoting Clean and Affordable Technologies in Developing Countries ; A Survey on Public and Private Actors' Participation in a Technological Diffusion Programme of Production and Use of Biodiesel in Brazil ; Reducing Carbon with Clean Energy Technology: Lessons from Malawi
    Type of Medium: Monograph available for loan
    Pages: VI, 184 S. : graph. Darst.
    ISBN: 9783869651354
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 56
    Monograph available for loan
    Monograph available for loan
    Energy transitions : history, requirements, prospects (2010)
    Santa Barbara, CA [u.a.] : Praeger
    Details Availability
    Call number: PIK P 113-12-0176
    Description / Table of Contents: Contents: 1 Energy Systems: Their Basic Properties ; Resources and Prime Movers ; Conversions and Uses ; Infrastructures and Impacts ; Energy Transitions ; 2 Global Transitions: Universal Patterns ; Grand Fuel Sequence: From Biomass to Coal and Hydrocarbons ; A New Quality: Generation of Electricity ; History of Prime Movers: From Muscles to Machines ; Quantifying the Transitions: Uncertainties and Trends ; 3 National Transitions: Commonalities and Particularities ;European Experience: Britain, France, and the Netherlands ; U.S. Transitions: The Consuming Superpower ; Japan and China: The Asian Leaders ; New Energy Superpowers: Russia and Saudi Arabia ; 4 Coming Transitions: Expectations and Realities ; Renewable Energies: Resources, Conversions, and Constraints ; Pace of Transitions: Innovation, Infrastructures, and Inertia ; National Aspirations: Goals and Realities ; Cautious Anticipations: Trends and Possibilities
    Type of Medium: Monograph available for loan
    Pages: IX, 178 S. : Ill., graph. Darst.
    ISBN: 9780313381775
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 57
    Series available for loan
    Series available for loan
    The global financial crisis and the developing world : transmission channels and fall-outs for industrial development (2010)
    Vienna : UNIDO
    Associated volumes
    Details Availability
    Call number: PIK B 190-12-0174(2009,06)
    In: Working paper
    Description / Table of Contents: Contents: 1 Introduction ; 2 Events leading to the great financial crisis of the twenty-first century ; 3 Transmission channels of immediate financial spillovers ; 4 Recessionary effects of the global financial crisis ; 5 Concluding remarks
    Type of Medium: Series available for loan
    Pages: VIII, 52 S. : graph. Darst.
    Series Statement: Working paper 06/2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 58
    Series available for loan
    Series available for loan
    Virtual teams : practical guide to Wikis and other collaboration tools (2010)
    Vienna : UNIDO
    Associated volumes
    Details Availability
    Call number: PIK B 190-12-0174(2009,10)
    In: Working paper
    Description / Table of Contents: Contents: 1 Introduction ; 2 Comparison with similar technologies ; 3 Purpose, strengths and limits ; 4 Example scenarios ; 5 Wiki engines ; 6 Information retrieval in Wikis ; 7 Collaborative reference management ; 8 Conclusions
    Type of Medium: Series available for loan
    Pages: IV, 33 S. : Ill., graph. Darst.
    Series Statement: Working paper 10/2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 59
    Series available for loan
    Series available for loan
    Human resource management and learning based on in-house R&D : the pharmaceutical industry in Mexico (2010)
    Vienna : UNIDO
    Associated volumes
    Details Availability
    Call number: PIK B 190-12-0174(2009,11)
    In: Working paper
    Description / Table of Contents: Contents: 1 Introduction ; 2 Management practices, learning and R&D in latecomer firms ; 3 Management practices and learning trough R&D: Mexican pharmaceuticals ; 4 Data sources, variable definition and research strategy ; 5 Empirical results ; 6 Discussion ; 7 Conclusions
    Type of Medium: Series available for loan
    Pages: V, 37 S.
    Series Statement: Working paper 11/2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 60
    Series available for loan
    Series available for loan
    Energy infrastructure and industrial development (2010)
    Vienna : UNIDO
    Associated volumes
    Details Availability
    Call number: PIK B 190-12-0174(2009,12)
    In: Working paper
    Description / Table of Contents: Contents: 1 Introduction ; 2 Review of the empirical literature ; 3 Modelling industrial development ; 4 Data ; 5 Regression analysis ; 6 Conclusions
    Type of Medium: Series available for loan
    Pages: V, 57 S. : graph. Darst.
    Series Statement: Working paper 12/2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 61
    Series available for loan
    Series available for loan
    On track for industrial development (2010)
    Vienna : UNIDO
    Associated volumes
    Details Availability
    Call number: PIK B 190-12-0174(2009,13)
    In: Working paper
    Description / Table of Contents: Contents: 1 Introduction ; 2 Transport infrastructure and the empirical literature ; 3 An empirical model of transport infrastructure and industry ; 4 Econometric modelling strategy ; 5 Data ; 6 Regression analysis ; 7 Conclusions
    Type of Medium: Series available for loan
    Pages: V, 75 S. : graph. Darst.
    Series Statement: Working paper 13/2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 62
    Series available for loan
    Series available for loan
    Telecommunications and industrial development (2010)
    Vienna : UNIDO
    Associated volumes
    Details Availability
    Call number: PIK B 190-12-0174(2009,14)
    In: Working paper
    Description / Table of Contents: Contents: 1 Introduction ; 2 Review of empirical literature ; 3 An empirical modelling strategy ; 4 Econometric modelling strategy ; 5 Data ; 6 Regression analysis ; 7 Conclusions
    Type of Medium: Series available for loan
    Pages: V, 48 S. : graph. Darst.
    Series Statement: Working paper 14/2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 63
    Series available for loan
    Series available for loan
    Public capital, infrastructure and industrial development (2010)
    Vienna : UNIDO
    Associated volumes
    Details Availability
    Call number: PIK B 190-12-0174(2009,15)
    In: Working paper
    Description / Table of Contents: Contents: 1 Introduction ; 2 A selective review of the empirical literature ; 3 Determinants of industrial development ; 4 Modelling strategy ; 5 Data ; 6 Regression analysis ; 7 Conclusions
    Type of Medium: Series available for loan
    Pages: V, 59 S. : graph. Darst.
    Series Statement: Working paper 15/2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 64
    Series available for loan
    Series available for loan
    The impact of world recession on the textile and garment industries of Asia (2010)
    Vienna : UNIDO
    Associated volumes
    Details Availability
    Call number: PIK B 190-12-0174(2009,17)
    In: Working paper
    Description / Table of Contents: Contents: 1 Introduction ; 2 Origins of the textile and garments industries ; 3 Structural characteristics and drivers of change ; 4 The effects of world recession on T&G exports from Asia: analysis of import statistics ; 5 Other impacts of recession ; 6 Green issues in garments and textiles ; 7 Responses, policies and prospects for the textile and garment sector
    Type of Medium: Series available for loan
    Pages: IV, 47 S.
    Series Statement: Working paper 17/2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 65
    Series available for loan
    Series available for loan
    Impact of the global economic and financial crisis over the automotive industry in developing countries (2010)
    Vienna : UNIDO
    Associated volumes
    Details Availability
    Call number: PIK B 190-12-0174(2009,16)
    In: Working paper
    Description / Table of Contents: Contents: 1 Introduction ; 2 The origins of the industry ; 3 Trends, drivers and structural characteristics of the industry in the 21st century ; 4 The 2008 financial and economic crisis and its effects over the automotive industry in developing countries ; 5 Key automotive industry actors' responses to the global crisis ; 6 Short and medium term prospects for the industry ; 7 Conclusions and policy recommendations
    Type of Medium: Series available for loan
    Pages: VIII, 35 S.
    Series Statement: Working paper 16/2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 66
    Series available for loan
    Series available for loan
    Structural change in the world economy : main features and trends (2010)
    Vienna : UNIDO
    Associated volumes
    Details Availability
    Call number: PIK B 190-12-0174(2009,24)
    In: Working paper
    Description / Table of Contents: Contents: Introduction ; 1 Structural change in the literature ; 2 Changes in the structure of world production ; 3 Changes in the structure of the world manufacturing industry ; 4 Conclusions
    Type of Medium: Series available for loan
    Pages: V, 52 S. : graph. Darst.
    Series Statement: Working paper 24/2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 67
    Series available for loan
    Series available for loan
    The impact of institutions on structural change in manufacturing : the case of international trade regime in textiles and clothing (2010)
    Vienna : UNIDO
    Associated volumes
    Details Availability
    Call number: PIK B 190-12-0174(2009,25)
    In: Working paper
    Description / Table of Contents: Contents: 1 Introduction ; 2 Globalization of production and trade in T&C industries ; 3 The evolution of T&C international trade regime ; 4 The impact of the MFA regime on specialization patterns ; 5 Other protectionist measures against T&C imports ; 6 T&C trade liberalization after the expiry of the ATC - ex ante analyses ; 7 T&C trade liberalization after the expiry of the ATC - ex post analyses ; 8 Conclusion
    Type of Medium: Series available for loan
    Pages: V, 64 S. : graph. Darst.
    Series Statement: Working paper 25/2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 68
    Series available for loan
    Series available for loan
    Growth, exports and technological change in developing countries : contributions from young scholars (2010)
    Vienna : UNIDO
    Associated volumes
    Details Availability
    Call number: PIK B 190-12-0174(2009,26)
    In: Working paper
    Description / Table of Contents: Contents: 1 Introduction ; 2 The empirics of economic growth: a dual economy approach ; 3 Geography and trade structure: implications fo volatility ; 4 Trade facilitation as a development tool: what can we learn from a decade of quantitative research? ; 5 Trade reform and wages: a case study of South Africa's manufacturing sector ; 6 Determinants of export performance in the Philippines ; 7 How can we turn Ghana into a second Republic of Korea? Technology and skills ; 8 Multinational presence and technological spillovers in Africa ; 9 National system of innovation and the role of demand: a cross country comparison ; 10 Assessing the effectiveness of corporate social responsibility as a tool for "Poverty Reduction through Productive Activities": the case of the Delhi garment cluster
    Type of Medium: Series available for loan
    Pages: III, 165 S. : Ill., graph. Darst.
    Series Statement: Working paper 26/2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 69
    Monograph available for loan
    Monograph available for loan
    Multisector growth models : theory and application (2010)
    New York [u.a.] : Springer
    Details Availability
    Call number: PIK B 160-10-0013
    Description / Table of Contents: Contents: Introduction: Orientation and Focus ; The Preliminaries ; The Two Sector Ramsey Model ; The Three Sector Ramsey Model ; Extensions to the Three-Sector Model ; The Extended Three-Sector Model ; A Three-Sector - Two-Century World ; Data Issues and the Social Accounting Matrix ; Solution Methods in Transition Dynamics
    Type of Medium: Monograph available for loan
    Pages: XIII, 329 S. : graph. Darst.
    ISBN: 9780387773575
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 70
    Monograph available for loan
    Monograph available for loan
    Oil panic and the global crisis : predictions and myths (2010)
    Chichester [u.a.] : Wiley-Blackwell
    Details Availability
    Call number: PIK B 315-10-0110
    Description / Table of Contents: Contents: 1 End of the Oil Era ; 2 The Global Oil Landscape ; 3 The Historical Resource Depletion Debate ; 4 Counter-Arguments to Imminent Global Oil Depletion ; 5 Beyond Panic
    Type of Medium: Monograph available for loan
    Pages: XII, 241 S. : graph. Darst.
    ISBN: 9781405195485
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 71
    Monograph available for loan
    Monograph available for loan
    Global change : impacts on water and food security (2010)
    Berlin [u.a.] : Springer
    Details Availability
    Call number: PIK N 071-10-0099
    Description / Table of Contents: Contents: PART I - Water for food security under growing scarcity ; 1. Water and food security under global change ; 2. Global water and food security: megatrends and emerging issues ; 3. Implications of global climatic change on water and food security ; 4. Biofuels, food security, and the environment: a 2020/2050 perspective ; PART II - Trade for water and food security- help or harm for the poor? ; 5. Implications of globalization and trade for water quality in transboundary rivers ; 6. Failure of the virtual water argument: possible explanations using the case study of Mexico and NAFTA ; 7. Globalization and fisheries: welfare implications of export trade in asia ; PART III - How to finance water for the poor in a globalized world ; 8. Global trends in financing water ; 9. Private-sector participation in water and sanitation services: the answer to public sector failures? ; 10. Mobilizing investment for municipal water supply services ; 11. Water, water services and international investment agreements ; PART IV - Conclusions ; 12. Global change: options for reform ; Appendix
    Type of Medium: Monograph available for loan
    Pages: XV, 265 S. : graph. Darst.
    ISBN: 9783642046148
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 72
    Monograph available for loan
    Monograph available for loan
    2007 (1.11.2006 - 31.12.2007) (2010)
    Magdeburg
    Associated volumes
    Details Availability
    Call number: PIK P 037-10-0140
    In: Elbegebiet, Teil I ; Von der Grenze zur CR bis zur Havelmündung
    Type of Medium: Monograph available for loan
    Pages: 222 S., 1 Karte
    ISSN: 0948-9126
    Series Statement: Elbegebiet, Teil I Von der Grenze zur CR bis zur Havelmündung
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 73
    Monograph available for loan
    Monograph available for loan
    Konfliktmanagement : Ein Handbuch für Führungkräfte, Beraterinnen und Berater (2010)
    Bern [u.a.] : Haupt [u.a.]
    Details Availability
    Call number: PIK D 024-10-0028
    Description / Table of Contents: Contents: EINFÜHRUNG: 1. Sozialer Konflikt und Konfliktlösung im Sozialen ; TEIL 1 KONFLIKTDIAGNOSE: 2. Menschenbild und soziale Konflikte ; 3. Typologie von Konflikten ; 4. Modelle der Konfliktdiagnose ; 5. Inhaltliche Dimensionen der Konfliktdiagnose ; 6. Konfliktkonstellationen im meso-sozialen Rahmen ; TEIL 2 DIE DYNAMIK DER ESKALATION: 7. Einführung zur Eskalationsproblematik ; 8. Basismechanismen der Eskalationsdynamik ; 9. Wendepunkte in der Eskalation ; 10. Phasenmodell der Eskalation ; TEIL 3 STRATEGIE DER KONFLIKTBEHANDLUNG: 11. Interventionen der Konfliktbehandlung ; 12. Die fünf Diagnosedimensionen als Ansatzpunkte für Interventionen ; 13. Allgemeine Prinzipien für Interventionen der Konfliktbehandlung ; 14. Strategiemodelle der Konfliktbehandlung ; 15. Strategie- und Rollenmodelle näher betrachtet ; 16. Phasen der Konfliktbehandlungsstrategien ; 17. Schlussbemerkung
    Type of Medium: Monograph available for loan
    Pages: 529 S. : graph. Darst.
    Edition: 9., aktualisierte und erg. Aufl.
    ISBN: 9783258075563
    Series Statement: Organisationsentwicklung in der Praxis 2
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 74
    Monograph available for loan
    Monograph available for loan
    Forward-looking decision making : dynamic-programming models applied to health, risk, employment, and financial stability (2010)
    Princeton [u.a.] : Princeton University Press
    Details Availability
    Call number: PIK B 020-10-0067
    Description / Table of Contents: Contents: Chapter 1: Basic Analysis of Forward-Looking Decision Making ; 1.1 The Dynamic Program ; 1.2 Approximation ; 1.3 Stationary Case ; 1.4 Markov Representation ; 1.5 Distribution of the Stochastic Driving Force ; Chapter 2: Research on Properties of Preferences ; 2.1 Research Based on Marshallian and Hicksian Labor Supply Functions ; 2.2 Risk Aversion ; 2.3 Intertemporal Substitution ; 2.4 Frisch Elasticity of Labor Supply ; 2.5 Consumption-Hours Complementarity ; Chapter 3: Health ; 3.1 The Issues ; 3.2 Basic Facts ; 3.3 Basic Model ; 3.4 The Full Dynamic-Programming Model ; 3.5 The Health Production Function ; 3.6 Preference Parameters ; 3.7 Solving the Model ; 3.8 Concluding Remarks ; Chapter 4: Insurance ; 4.1 The Model ; 4.2 Calibration ; 4.3 Results ; Chapter 5: Employment ; 5.1 Insurance ; 5.2 Dynamic Labor-Market Equilibrium ; 5.3 The Employment Function ; 5.4 Econometric Model ; 5.5 Properties of the Data ; 5.6 Results ; 5.7 Concluding Remarks ; Chapter 6: Idiosyncratic Risk ; 6.1 The Joint Distribution of Lifetime and Exit Value ; 6.2 Economic Payoffs to Entrepreneurs ; 6.3 Entrepreneurs in Aging Companies ; 6.4 Concluding Remarks ; Chapter 7: Financial Stability with Government-Guaranteed Debt ; 7.1 Introduction ; 7.2 Options ; 7.3 Model ; 7.4 Calibration ; 7.5 Equilibrium ; 7.6 Roles of Key Parameters ; 7.7 Concluding Remarks ; 7.8 Appendix: Value Functions ; References ; Index
    Type of Medium: Monograph available for loan
    Pages: XIII, 126 S. : graph. Darst.
    ISBN: 9780691142425
    Series Statement: The Gorman lectures in economics
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 75
    Monograph available for loan
    Monograph available for loan
    Governance in global policy networks : individual strategies and collective action in five sustainable energy-related type II partnerships (2010)
    Frankfurt am Main [u.a.] : Lang
    Details Availability
    Call number: PIK D 024-10-0191
    Description / Table of Contents: Contents: 1. Introduction: Global governance and global policy networks ; 2. The academic debate on network governance ; 2.0: Phase 0: Why global policy networks came into being ; 2.1: Phase I: What has to be considered when global policy networks emerge? ; 2.2: Phase II: What has to be considered when global policy networks start activities ; 2.3: Phase III: What has to be considered when global policy networks produce long-term outputs ; 3. The jazzier dance of partnerships ; 3.0: Phase 0: The run-up to global policy networks ; 3.1: Phase I: The emergence of global policy networks ; 3.2: Phase II: Activities of global policy networks ; 3.3: Phase III: Long-term strategies and outputs of global policy networks ; 4. Analyzing global policy networks: The emperor's new clothes? ; Appendix
    Type of Medium: Monograph available for loan
    Pages: 350 S. : graph. Darst.
    ISBN: 9783631603116
    Note: Zugl.: Potsdam, Univ., Diss., 2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 76
    Monograph available for loan
    Monograph available for loan
    Water resources management in Ethiopia : implications for the Nile basin (2010)
    Amherst, NY : Cambria Press
    Details Availability
    Call number: PIK N 454-10-0105
    Description / Table of Contents: Contents: Chapter 1: Water Resources Development and Management in Sub-Saharan Africa: Overview and Global Context ; Chapter 2: Water Resources Management in the Nile Basin ; Chapter 3: The Water Resources of Ethiopia and Large-Scale Hydropower and Irrigation Development ; Chapter 4: Small-Scale Irrigation and Microdams ; Chapter 5: Rainwater Harvesting ; Chapter 6: Water Supply and Sanitation ; Chapter 7: Hydrological and Related Aspects of Deforestation and Degradation of Woody Vegetation ; Chapter 8: Land Degradation and Water Problems in the Highlands: Causes, Impacts, and Interventions ; Chapter 9: Problems for Pastoralists in the Lowlands: River Basin Development in the Awash and Omo Valleys ; Chapter 10: Flooding in Ethiopia: Recent History and the 2006 Flood ; Chapter 11: A Case Study of the 2006 Flood: Dire Dawa ; Chapter 12: Water Pollution From Industrial and Agricultural Sources ; Chapter 13: Water-Related, Vector-Borne, and Geochemical DiseasesChapter ; 14: Conclusion
    Type of Medium: Monograph available for loan
    Pages: XXIV, 415 S. : graph. Darst., Kt.
    ISBN: 9781604976656
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 77
    Monograph available for loan
    Monograph available for loan
    The climate fix : what scientists and politicians won't tell you about global warming (2010)
    New York : Basic Books
    Details Availability
    Call number: PIK N 071-10-0268
    Description / Table of Contents: Contents: 1. Dinner table climate science for commonsense climate policy ; 2. What we know for sure, but just ain't so ; 3. Decarbonization of the global economy ; 4. Decarbonization policies around the world ; 5. Technological fixes and backstops ; 6. How climate policy went off course and the first steps back in the right direction ; 7. Disasters, death, and destruction ; 8. The politicization of climate science ; 9. Obliquity, innovation, and a pragmatic future for climate policy
    Type of Medium: Monograph available for loan
    Pages: XI, 276 S. : Ill., graph. Darst.
    ISBN: 9780465020522
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 78
    Monograph available for loan
    Monograph available for loan
    Personal investment : financial planning in an uncertain world (2010)
    Basingstoke, Hampshire [u.a.] : Palgrave Macmillan
    Details Availability
    Call number: PIK B 160-10-0238
    Description / Table of Contents: Contents: Introduction ; PART ONE: PRODUCTS AND PLAYERS ; 1. From saving to investment ; 2. Investment choices ; PART TWO: STRATEGIES AND MARKETS ; 3. Risk-return strategies ; 4. Markets and players ; PART THREE: BUBBLES AND THE ECONOMY ; 5. Economic fluctuations ; 6. Bubbles and investment behaviour ; PART FOUR: REGULATION AND THE LONG TERM ; 7. Regulating the financial system ; 8. Conclusion: investing for the long term
    Type of Medium: Monograph available for loan
    Pages: XII, 446 S. : Ill., graph. Darst.
    ISBN: 9780230246607
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 79
    Monograph available for loan
    Monograph available for loan
    Energieeffizienz in Gebäuden - Jahrbuch 2010 (2010)
    Berlin : VME, Verl. und Medienservice Energie
    Details Availability
    Call number: PIK P 120-10-0108
    Description / Table of Contents: Contents: TEIL I: Strategien und Positionen für Energieeffizienz: Ein Plädoyer für Langfriststrategien im Gebäudebereich ; Energieeffizienz und Klimaschutz - Potenziale im Gebäudebereich nutzen ; Den "schlafenden" Riesen wecken ; Die nachhaltige Wohnungswirtschaft braucht eine nachhaltige Politik ; Intelligente Wärmeregeltechnik - Einfluss- und Erfolgsfaktoren ; Der Bestandsersatz muss als Variante der energetischen Sanierung ernsthaft diskutiert werden ; Hilfe zur Selbsthilfe ; Ziele und Maßnahmen für Effizienz und erneuerbare Energien im Wärmemarkt ; Die Klimapolitik braucht langfristige Ziele und mehr kommunale Verantwortung ; Schrittmacher für Energieeffizienz und Klimaschutz ; Klimaschutzpotenziale von Erdgas- und Erdgas-Plus-Technologien am Beispiel des Berliner Wärmemarktes ; Das Tätigkeitsfeld Energieeffizienz als Karrierechance ; TEIL II: Rechtskonzepte für mehr Energieeffizienz: Contracting im Mietwohnungsbau - Potenziale und rechtliche Aspekte ; Mietrechtliche Hemmnisse für die energetische Gebäudesanierung - Überlegungen zu einer Reform des Mietrechts ; Eigentumsrechtliche Hemmnisse für große Solarwärmeanlagen und für Photovoltaikaufdachanlagen ; TEIL III: Praxis Energieeffizienz heute und morgen: CO2-Neutralität im Gebäudesektor bis 2050 - Vision oder Notwendigkeit? ; Erfahrungen mit Passivhaustechnologie bei der ABG Frankfurt Holding - Ökologische, ökonomische und soziale Aspekte ; ALFA (Allianz für Anlageneffizienz) - Teil der BBU-Klimaschutzstrategie ; Energieeffizienz in der Wohnungswirtschaft - Beispiele der Pro Potsdam GmbH ; CO2-freies Klima für das Klimahaus Bremerhaven 8° Ost ; Die DIN V 18599 ; TEIL IV: Alles smart? Energieeffizienztechnik und Energiedienstleistungen: Steigerung der Anlageneffizienz als Schlüssel für ganzheitlich energieeffiziente Gebäude ; Wärme- und Kältespeicherung - Stand der Technik und Perspektiven ; Neue Fassadenkonzepte und BIPV ; Messtechnologie 2010 - Innovationen für nachhaltige Prozessoptimierung und Energieeffizienz ; Gebäudeperformance-Optimierung als zukunftsweisendes Konzept ; Die beste Energie ist die, die nicht verbraucht wird - Wie intelligente Nutzer nachhaltig Energiekosten senken können ; Renditestrategien für Wohngebäude im Bestand durch die Modernisierung der Wärmeerzeugung ; Modernisierungsobjekt mit Vorbild-Charakter - Energie-Gewinner senken Primärenergiebedarf um 82 Prozent
    Type of Medium: Monograph available for loan
    Pages: 239 S. : Ill., graph. Darst.
    ISBN: 9783936062069
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 80
    Monograph available for loan
    Monograph available for loan
    Networks, crowds, and markets : reasoning about a highly connected world (2010)
    New York [u.a.] : Cambridge Univ. Press
    Details Availability
    Call number: PIK M 370-10-0229 ; PIK M 370-14-0237
    Description / Table of Contents: Contents: 1. Overview; Part I. Graph Theory and Social Networks: 2. Graphs; 3. Strong and weak ties; 4. Networks in their surrounding contexts; 5. Positive and negative relationships; Part II. Game Theory: 6. Games; 7. Evolutionary game theory; 8. Modeling network traffic using game theory; 9. Auctions; Part III. Markets and Strategic Interaction in Networks: 10. Matching markets; 11. Network models of markets with intermediaries; 12. Bargaining and power in networks; Part IV. Information Networks and the World Wide Web: 13. The structure of the Web; 14. Link analysis and Web search; 15. Sponsored search markets; Part V. Network Dynamics: Population Models: 16. Information cascades; 17. Network effects; 18. Power laws and rich-get-richer phenomena; Part VI. Network Dynamics: Structural Models: 19. Cascading behavior in networks; 20. The small-world phenomenon; 21. Epidemics; Part VII. Institutions and Aggregate Behavior: 22. Markets and information; 23. Voting; 24. Property.
    Type of Medium: Monograph available for loan
    Pages: XV, 727 S. : Ill., graph. Darst.
    ISBN: 9780521195331
    Location: A 18 - must be ordered
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 81
    Monograph available for loan
    Monograph available for loan
    Die 2°max-Klimastrategie : ein Memorandum (2010)
    Münster : LIT
    Associated volumes
    Details Availability
    Call number: PIK N 071-10-0206
    In: Studien zur internationalen Umweltpolitik
    Description / Table of Contents: Contents: 1. Der "Copenhagen Accord": Grundlage einer neuen 2°max-Klimastrategie ; 2. Beängstigende Emissionsentwicklungen ; 3. Konstruktionsmängel des bestehenden Klimaregimes beseitigen ; 4. Die 2°max-Klimastrategie: Ein umsetzbares und effizientes "Cap and trade"-Konzept ; 5. Mehr Gerechtigkeit durch "one human - one emissions right" ; 6. Globaler Preis für CO2-Emissionen und Begrenzung der Transferzahlungen ; 7. Ein effizienter Brennstoff-Zertifikatemarkt mit Maximalpreisbeschränkung ; 8. Weltweite Anreize zum klimafreundlichen Investieren und Konsumieren ; 9. Ökosoziale "Marshallpläne" zur klimafreundlichen Entwicklung ; 10. Steuerung der 2°max-Klimastrategie durch eine Weltklimabank ; 11. Zu den Realisierungschancen der 2°max-Klimastrategie - die wichtigsten Interessengruppen ; 12. Die Weichen für globalen Klimaschutz stellen
    Type of Medium: Monograph available for loan
    Pages: VIII, 48 S. : graph. Darst.
    ISBN: 9783643108173
    Series Statement: Studien zur internationalen Umweltpolitik 13
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 82
    Monograph available for loan
    Monograph available for loan
    The new climate policies of the European Union : internal legislation and climate diplomacy (2010)
    Brussels : Vub Press
    Details Availability
    Call number: PIK N 071-10-0177
    Description / Table of Contents: Contents: Introduction ; The EU's internal and external climate policies: an historical overview ; The EU Emissions trading system revised (Directive 2009/29/EC) ; From sharing the burden to sharing the effort: Decision 406/2009/EC on member state emission ; The EU's new renewable energy directive (2009/28/EC) ; The legal framework for carbon capture and storage in the EU (Directive 2009/31/EC) ; Mitigating CO2 emissions from cars in the EU (Regulation (EC) No 443/2009) ; The german paradox: climate leader and green car laggard ; Assessing EU assistance for adaptation to climate change in developing countries: a southern perspective ; The sustainability of the EU's model for climate diplomacy ; Russia and the international climate change regime ; Public perceptions of climate change and energy issues
    Type of Medium: Monograph available for loan
    Pages: 339 S. : Ill., graph. Darst.
    ISBN: 9789054876076
    Series Statement: Publication series / Institute for European Studies 15
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 83
    Monograph available for loan
    Monograph available for loan
    Leitfaden zur Finanzierung indirekter Maßnahmen des 7. Forschungsrahmenprogramms : [Übersetzung des Originaltextes der Europäischen Kommission] (2010)
    Hamburg : TuTech Innovation
    Details Availability
    Call number: PIK A 130-10-0242
    Type of Medium: Monograph available for loan
    Pages: 131 S. : graph. Darst.
    Edition: Version 30.6.2010
    ISBN: 9783941492288
    Uniform Title: Guide to financial issues relating to indirect actions of the seventh framework programmes
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 84
    Monograph available for loan
    Monograph available for loan
    Practical Clojure : [full introduction to Clojure, a full Lisp variant for the JVM] (2010)
    New York : Apress
    Details Availability
    Call number: PIK M 032-10-0245
    Description / Table of Contents: Contents: 1: The Clojure Way ; 2: The Clojure Environment ; 3: Controlling Program Flow ; 4: Data in Clojure ; 5: Sequences ; 6: State Management ; 7: Namespaces and Libraries ; 8: Metadata ; 9: Multimethods and Hierarchies ; 10: Java Interoperability ; 11: Parallel Programming ; 12: Macros and Metaprogramming ; 13: Datatypes and Protocols ; 14: Performance
    Type of Medium: Monograph available for loan
    Pages: XVI, 210 S. : graph. Darst.
    ISBN: 9781430272311
    Series Statement: The expert's voice open source
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 85
    Monograph available for loan
    Monograph available for loan
    Caste in a different mould : understanding the discrimination (2010)
    New Delhi : B.S. Books
    Details Availability
    Call number: PIK E 712-10-0210
    Description / Table of Contents: Contents: Preface ; Introduction: Caste, class and consumption ; 1. Not caste in stone ; 2. Income ; 3. Expenditure ; 4. Savings ; 5. State profiles ; Annexures
    Type of Medium: Monograph available for loan
    Pages: 215 S. : graph. Darst.
    ISBN: 9788190573597
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 86
    Monograph available for loan
    Monograph available for loan
    Complex networks : structure, robustness, and function (2010)
    Cambridge [u.a.] : Cambridge Univ. Press
    Details Availability
    Call number: PIK M 370-10-0232
    Description / Table of Contents: Contents: 1. Introduction; Part I. Random Network Models: 2. The Erdos-Renyi models; 3. Observations in real-world networks - the internet, epidemics, proteins and DNA; 4. Models for complex networks; 5. Growing network models - the Barabási-Albert model and its variants; Part II. Structure and Robustness of Complex Networks: 6. Distances in scale-free networks - the ultra small world; 7. Self-similarity in complex networks; 8. Distances in geographically embedded networks; 9. The structure of networks - the generating function method; 10. Percolation on complex networks; 11. Structure of random directed networks - the bow tie; 12. Introducing weights - bandwidth allocation and multimedia broadcasting; Part III. Network Function - Dynamics and Applications: 13. Optimization of the network structure; 14. Epidemiological models; 15. Immunization; 16. Thermodynamic models on networks; 17. Spectral properties, transport, diffusion and dynamics; 18. Searching in networks; 19. Biological networks and network motifs; Part IV. Appendices; References; Index.
    Type of Medium: Monograph available for loan
    Pages: VIII, 238 S. : Ill., graph. Darst.
    ISBN: 9780521841566
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 87
    Monograph available for loan
    Monograph available for loan
    Kernenergie und Politikberatung : die Vermessung einer Kontroverse (2010)
    Wiesbaden : VS Verl. für Sozialwissenschaften
    Details Availability
    Call number: PIK D 022-11-0019
    Description / Table of Contents: Contents: Einleitung ; Prolog ; A. Enegiepolirik und Politikberatung ; I. Zwischen Ölkrise und Ökologiebewegung ; II. Von der politischen Debatte zur Zukünftigen Kernenergie-Politik ; III. ,Die Kuh ist vom Eis' - vorerst ; B. Die Technologie des Kompromisses ; IV. Die Ueberhorst-Kommission ; V. Mensch und Umwelt ; VI. Ökonomie und Gesellschaft ; VII. Ein historischer Kompromiss'? ; VIII. Die Revolution und das ,Krötenschlucken' ; C. Die Enquete und ihre Rezeption ; IX. Der Einstieg in den Ausstieg? ; X. Die Nachfolgeenquete: Beschwörung eines Geistes ; XI. Expertenmeinung und Wissen im politischen Prozess ; XII. Eine Frage der Zeit? ; Epilog
    Type of Medium: Monograph available for loan
    Pages: 315 S. : Ill.
    Edition: 1. Aufl.
    ISBN: 9783531170206
    Note: Zugl.: Bielefeld, Univ., Diss., 2009
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 88
    Monograph available for loan
    Monograph available for loan
    Souverän Seminare leiten (2010)
    Bielefeld : Bertelsmann
    Details Availability
    Call number: PIK F 261-11-0026
    Description / Table of Contents: Contents: 1. Einleitung ; 2. Den Start meistern ; 3. Motivation erzeugen ; 4. Provokationen begegnen ; 5. Neue Gruppenmitglieder integrieren ; 6. Dilemma-Situationen auflösen ; 7. Störer eingliedern ; 8. Widerstand als Signal verstehen ; 9. Den Schluss gestalten
    Type of Medium: Monograph available for loan
    Pages: 171 S. : graph. Darst.
    Edition: 2., aktualisierte und überarb. Aufl.
    ISBN: 9783763917983
    Series Statement: Perspektive Praxis
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 89
    Monograph available for loan
    Monograph available for loan
    Limiting the magnitude of future climate change (2010)
    Washington, D.C. : National Academies Press
    Associated volumes
    Details Availability
    Call number: PIK N 076-11-0032
    In: America's climate choices
    Description / Table of Contents: Contents: Summary ; 1. Introduction ; 2. Goals for limiting future climate change ; 3. Opportunities for limiting future climate change ; 4. Crafting a portfolio of climate change limiting policies ; 5. Fostering technological innovations ; 6. Interaction with other major policy concerns ; 7. Multilevel response strategies ; 8. Policy durability and adaptability
    Type of Medium: Monograph available for loan
    Pages: XVIII, 257 S. : graph. Darst.
    ISBN: 9780309145978
    Series Statement: America's climate choices
    URL: http://www.nap.edu/catalog.php?record_id=12785#toc
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 90
    Monograph available for loan
    Monograph available for loan
    Steps in Scala : an introduction to object-functional programming (2010)
    Cambridge [u.a.] : Cambridge Univ. Press
    Details Availability
    Call number: PIK M 032-11-0062
    Description / Table of Contents: Contents: 1. Introduction ; 2. Core features ; 3. Advanced features ; 4. Parser builders ; 5. XML processing ; 6. GUI programming ; 7. Concurrent programming ; 8. On paths and a bit of algebraic abstractions ; 9. Virtual files coming into existence ; 10. Compositional file matching ; 11. Searching, iterating, traversing ; 12. The expression problem ; 13. A computer algebra system ; Appendix A. Multimedia processing ; Appendix B. Distributing a Scala application along with Scala itself ; Appendix C. Working with the compiler and the interpreter ; Appendix D. Scala's grammar
    Type of Medium: Monograph available for loan
    Pages: XVII, 485 S. : Ill., graph. Darst.
    ISBN: 0521747589 , 978-0-521-74758-5
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 91
    Monograph available for loan
    Monograph available for loan
    Mit den Meeren leben (2010)
    Hamburg : Maribus
    Associated volumes
    Details Availability
    Call number: 13/M 10.0455 ; AWI G2-10-0077 ; PIK N 453-10-0266
    In: World ocean review
    Type of Medium: Monograph available for loan
    Pages: 234 S. : zahlr. Ill., graph. Darst.
    ISBN: 9783866480001
    Series Statement: World ocean review 1
    URL: http://worldoceanreview.com
    Classification:
    Oceanology
    Location: Reading room
    Location: Reading room
    Location: A 18 - must be ordered
    Branch Library: GFZ Library
    Branch Library: AWI Library
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 92
    Monograph available for loan
    Monograph available for loan
    55 Gründe, Ingenieur zu werden (2010)
    Hamburg : Murmann
    Details Availability
    Call number: PIK F 252-10-0274
    Type of Medium: Monograph available for loan
    Pages: 253 S.. : Ill., graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9783867741057
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 93
    Monograph available for loan
    Monograph available for loan
    Global governance and the UN : an unfinished journey (2010)
    Bloomington [u.a.] : Indiana Univ. Press
    Details Availability
    Call number: PIK D 025-11-0036
    Description / Table of Contents: Contents: Introduction: The Problématique of Global Governance ; 1. Tracing the Origins of an Idea and the UN's Contribution ; Part 1. International Security ; 2. The Use of Force: War, Collective Security, and Peace Operations ; 3. Arms Control and Disarmament ; 4. Terrorism ; Part 2. Development ; 5. Trade, Aid, and Finance ; 6. Sustainable Development ; 7. Saving the Environment: The Ozone Layer and Climate Change ; Part 3. Human Rights ; 8. Generations of Rights ; 9. Protecting against Pandemics ; 10. The Responsibility to Protect
    Type of Medium: Monograph available for loan
    Pages: XXVI, 420 S. : graph. Darst.
    ISBN: 9780253221674
    Series Statement: United Nations intellectual history project
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 94
    Monograph available for loan
    Monograph available for loan
    Der flexible Mensch : die Kultur des neuen Kapitalismus (2010)
    Berlin : Berliner Taschenbuch-Verl.
    Details Availability
    Call number: PIK B 160-11-0101
    Type of Medium: Monograph available for loan
    Pages: 223 S.
    Edition: 8. Aufl.
    ISBN: 9783833303425
    Series Statement: BvT 342
    Uniform Title: The corrosion of character
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 95
    Monograph available for loan
    Monograph available for loan
    Causality : models, reasoning, and inference (2010)
    Cambridge [u.a.] : Cambridge Univ. Press
    Details Availability
    Call number: PIK M 311-11-0141
    Description / Table of Contents: Contents: Introduction to probabilities, graphs, and causal models ; A theory of inferred causation ; Causal diagrams and the identification of causal effects ; Actions, plans, and direct effects ; Causality and structural models in social science and economics ; Simpson's paradox, confounding, and collapsibility ; The logic of structure-based counterfactuals ; Imperfect experiments: bounding effects and counterfactuals ; Probability of causation: interpretation and identification ; The actual cause
    Type of Medium: Monograph available for loan
    Pages: XIX, 464 S. : Ill., graph. Darst.
    Edition: 2. ed., reprinted
    ISBN: 9780521895606
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 96
    Monograph available for loan
    Monograph available for loan
    Advancing the science of climate change (2010)
    Washington, D.C. : National Academies Press
    Associated volumes
    Details Availability
    Call number: PIK N 076-11-0031
    In: America's climate choices
    Description / Table of Contents: Contents: Summary ; Part I. 1. Introduction: science for understanding and responding to climate change ; 2. What we know about climate change and its interactions with people and ecosystems ; 3. A new era of climate change research ; 4. Integrative themes for climate change research ; 5. Recommendations for meeting the challenge of climate change research ; Part II - Technical Chapters 6. Changes in the climate system ; 7. Sea level rise and the coastal environment ; 8. Freshwater resources ; 9. Ecosystems, ecosystem services, and biodiversity ; 10. Agriculture, fisheries, and food production ; 11. Public health ; 12. Cities and the built environment ; 13. Transportation ; 14. Energy supply and use ; 15. Solar radiation management ; 16. National and human security ; 17. Designing, implementing, and evaluating climate policies
    Type of Medium: Monograph available for loan
    Pages: XXI, 503 S. : Ill., graph. Darst., Kt.
    ISBN: 9780309145886
    Series Statement: America's climate choices
    URL: http://www.nap.edu/catalog.php?record_id=12782#toc
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 97
    Monograph available for loan
    Monograph available for loan
    Beyond the age of oil : the myths, realities, and future of fossil fuels and their alternatives (2010)
    Santa Barbara [u.a.] : Praeger
    Details Availability
    Call number: PIK P 120-11-0035
    Description / Table of Contents: Contents: Introduction ; Part I - The Fossil Sources ; 1. "King" oil ; 2. The splendor and misery of coal ; 3. All that gas ; 4. The quest to eliminate carbon dioxide ; Part II - The Alternatives ; 5. Nuclear power: renaissance or decline? ; 6. The weight of water ; 7. Biofuels: behind the smoke and mirrors ; 8. Gone with the wind? ; 9. The sun also rises ; 10. Geothermal power: the primitive energy of the earth ; 11. The hype about hydrogen, the hope about electric cars ; 12. Energy efficiency: the invisible source of energy ; Conclusions: how can we escape our energy trap?
    Type of Medium: Monograph available for loan
    Pages: XXXI, 259 S. : Ill.
    ISBN: 9780313381713
    Uniform Title: Con tutta l'energia possibile
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 98
    Monograph available for loan
    Monograph available for loan
    The economics of ecosystems and biodiversity : ecological and economic foundations (2010)
    London [u.a.] : Earthscan
    Details Availability
    Call number: PIK B 160-11-0164
    Description / Table of Contents: Contents: Introduction ; 1. Integrating the ecological and economic dimensions in biodiversity and ecosystem service valuation ; 2. Biodiversity, ecosystems and ecosystem services ; 3. Measuring biophysical quantities and the use of indicators ; 4. The socio-cultural context of ecosystem and biodiversity valuation ; 5. The economics of valuing ecosystem services and biodiversity ; 6. Discounting, ethics and options for maintaining biodiversity and ecosystem integrity ; 7. Key messages and linkages with national policies
    Type of Medium: Monograph available for loan
    Pages: XXXIX, 410 S. : graph. Darst., Kt.
    ISBN: 9781849712125
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 99
    Monograph available for loan
    Monograph available for loan
    Kulturlandschaften im globalen Klimawandel : [die Tagung "Kulturlandschaften im Globalen Klimawandel", die am 10. und 11. Februar 2009 im Zentrum für Umweltkommunikation der Deutschen Bundesstiftung Umwelt stattfand ...] (2010)
    Berlin : Schmidt
    Details Availability
    Call number: PIK N 531-11-0080
    Description / Table of Contents: Contents: UNESCO-Kulturlandschaften und ihre Bedrohung durch den globalen Klimawandel ; Anmerkungen zur Klimadiskussion ; Globaler Klimawandel als Veränderungsfaktor von Kulturlandschaften: Adaptation und Mitigation ; Strategien zur Untergangsvermeidung: Anpassungen der Nordseeküste an den globalen Anstieg des Meeres ; UNESCO Kulturlandschaft Mittelrheintal ; Einflussmöglichkeiten auf klimainduzierte Veränderungen durch eine angepasste Pflege des Bestandes im Pückler Park ; Auswirkungen des Klimawandels auf Kulturlandschaften im Himalaya ; Climate impact analysis for IWRM in man-made landscapes: Application for Geoinformatics in Africa and Europe ; Die Urbane Kulturlandschaft Rio de Janeiros unter dem Einfluss des Klimawandels ; Zusammenfassung der Podiumsdiskussion ; Kulturelles Erbe und Kulturlandschaften in der Hochschulbildung - Ansätze aus Geographie, Architektur und Umweltplanung
    Type of Medium: Monograph available for loan
    Pages: XII, 192 S. : Ill., graph. Darst., Kt.
    ISBN: 9783503126163
    Series Statement: Initiativen zum Umweltschutz 79
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 100
    Monograph available for loan
    Monograph available for loan
    Klimawandel und Gesundheit : ein Sachstandsbericht (2010)
    Berlin : Robert-Koch-Institut
    Details Availability
    Call number: PIK O 080-11-0135
    Description / Table of Contents: Contents: 1. Einleitung ; 2. Der gegenwärtige Klimawandel ; 3. Gesundheitliche Auswirkungen des Klimawandels im Überblick ; 4. Gesundheitliche Auswirkungen von Hitzewellen und anderen klimaassoziierten Ereignissen ; 5. Gesundheitliche Auswirkungen des Klimawandels unter dem Aspekt erhöhter UV-, Allergen- und Schadstoff-Exposition ; 6. Gesundheitliche Auswirkungen des Klimawandels aus infektiologischer Perspektive ; 7. Zusammenfassung und Schlussfolgerungen
    Type of Medium: Monograph available for loan
    Pages: 244 S. : Ill., graph. Darst.
    ISBN: 9783896061151
    URL: http://www.rki.de/cln_151/nn_196910/DE/Content/Gesund/Klimawandel/Klimawandel-Gesundheit-Sachstandsbericht,templateId=raw,property=publicationFile.pdf/Klimawandel-Gesundheit-Sachstandsbericht.pdf
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...