ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • Books  (900)
  • Online Books  (900)
  • 2010-2014  (900)
Collection
  • Books  (900)
Source
Language
Years
Year
Branch Library
  • 1
    facet.materialart.12
    Oxford [u.a.] : Oxford Univ. Press
    Call number: 9780191758317 (e-book)
    Description / Table of Contents: This invaluable dictionary covers all aspects of statistics, including terms used in computing, mathematics, and probability, presented in a clear and practical way. It also provides biographical entries on over 200 key figures in the field, plus coverage of statistical journals and societies. The new edition features expanded coverage of applied statistics. Entries are complemented by over 120 figures and diagrams, and many provide worked examples. Wide-ranging appendices include a historical calendar of important statistical events, lists of statistical and mathematical notation, and statistical tables. It also features recommended web links for many entries, which provide valuable extra information. It is an invaluable dictionary for statistics students and professionals from a wide range of disciplines, including economics, politics, market research, medicine, psychology, pharmaceuticals, and mathematics, and provides a clear introduction to the subject for the general reader.
    Type of Medium: 12
    Pages: Online-Ressource , 488 S. , graph. Darst.
    Edition: 3. ed.
    ISBN: 9780191758317 (Online) , 9780199679188 (Print)
    Series Statement: Oxford paperback reference
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    Monograph available for loan
    Monograph available for loan
    Dordrecht : Springer
    Call number: PIK B 020-22-94723
    Description / Table of Contents: The book focusses on questions of individual and collective action, the emergence and dynamics of social norms and the feedback between individual behaviour and social phenomena. It discusses traditional modelling approaches to social norms and shows the usefulness of agent-based modelling for the study of these micro-macro interactions. Existing agent-based models of social norms are discussed and it is shown that so far too much priority has been given to parsimonious models and questions of the emergence of norms, with many aspects of social norms, such as norm-change, not being modelled.  Juvenile delinquency, group radicalisation and moral decision making are used as case studies for agent-based models of collective action extending existing models by providing an embedding into social networks, social influence via argumentation and a causal action theory of moral decision making. The major contribution of the book is to highlight the multifaceted nature of the dynamics of social norms, consisting not only of emergence, and the importance of embedding of agent-based models into existing theory. 
    Type of Medium: Monograph available for loan
    Pages: 215 Seiten
    Edition: Online edition Springer eBook Collection. Humanities, Social Sciences and Law
    ISBN: 978-94-017-8514-3
    Language: English
    Note: IntroductionTheorising Norms -- Theorising Crime -- Agent-based Modelling -- The Environment and Social Norms -- Punishment and Social Norms -- Imitation and Social Norms -- Socially Situated Social Norms -- Internalisation and Social Norms -- Modelling Norms -- Delinquent Networks -- Social Construction of Knowledge -- Morality -- We-Intentionality -- Conclusion -- Index..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
    Monograph available for loan
    Monograph available for loan
    Princeton : Princeton University Press
    Call number: PIK E 713-15-0146
    Description / Table of Contents: As countless love songs, movies, and self-help books attest, men and women have long sought different things. The result? Seemingly inevitable conflict. Yet we belong to the most cooperative species on the planet. Isn't there a way we can use this capacity to achieve greater harmony and equality between the sexes? In The War of the Sexes, Paul Seabright argues that there is--but first we must understand how the tension between conflict and cooperation developed in our remote evolutionary past, how it shaped the modern world, and how it still holds us back, both at home and at work. 〈
    Type of Medium: Monograph available for loan
    Pages: XI, 241 S. : Ill.
    ISBN: 9780691159720
    Language: English
    Note: Cover; Title Page; Copyright Page; Dedication Page; Table of Contents; Acknowledgments; Part One: Prehistory; 1. Introduction; 2. Sex and Salesmanship; 3. Seduction and the Emotions; 4. Social Primates; Part Two: Today; 5. Testing for Talent; 6. What Do Women Want?; 7. Coalitions of the Willing; 8. The Scarcity of Charm; 9. The Tender War; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 4
    Monograph available for loan
    Monograph available for loan
    Princeton : Princeton University Press
    Call number: PIK D 020-15-0143 ; IASS 15.89713
    Description / Table of Contents: Complexity science-made possible by modern analytical and computational advances-is changing the way we think about social systems and social theory. Unfortunately, economists' policy models have not kept up and are stuck in either a market fundamentalist or government control narrative. While these standard narratives are useful in some cases, they are damaging in others, directing thinking away from creative, innovative policy solutions. Complexity and the Art of Public Policy outlines a new, more flexible policy narrative, which envisions society as a complex evolving system that is uncont
    Type of Medium: Monograph available for loan
    Pages: VIII, 310 S.
    ISBN: 9780691152097
    Language: English
    Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; PART I. THE COMPLEXITY FRAME FOR POLICY; Chapter 1. Twin Peaks; Chapter 2. Government With, Not Versus, the Market; Chapter 3. I Pencil Revisited: Beyond Market Fundamentalism; Chapter 4. The Complexity Policy Frame; PART II. EXPLORING THE FOUNDATIONS; Chapter 5. How Economics Lost the Complexity Vision; Chapter 6. How Macroeconomics Lost the Complexity Vision; Chapter 7. Complexity: A New Kind of Science?; Chapter 8: A New Kind of Complexity Economics?; Chapter 9. Nudging toward a Complexity Policy Frame. , PART III. LAISSEZ-FAIRE ACTIVISM IN PRACTICEChapter 10. The Economics of Influence; Chapter 11. Implementing Influence Policy; Chapter 12. Laissez-Faire Activism; Chapter 13. Getting the Ecostructure of Government Right; PART IV. THE LOST AGENDA; Chapter 14. Getting the Ecostructure of Social Science Education Right; Chapter 15. The Lost Agenda; Notes; Bibliography; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    Monograph available for loan
    Monograph available for loan
    Cambridge : Green Books
    Call number: IASS 15.89662
    Description / Table of Contents: 〈div〉Is flying an irreplaceable part of 21st-century life? Flying is never zero-carbon, so can we reduce it, or even do without it? Can businesses succeed in a globalized world without international air travel? What about ?love miles' ? visiting friends and family overseas? Fourteen authors from around the world ? lawyers, journalists, scientists, architects ? share their travel stories about life and work ?beyond flying', offering us an inspiring catalogue of reasons to fly less, some great ways of switching to sustainable choices, and the delights of richer travel experiences.〈/div〉
    Type of Medium: Monograph available for loan
    Pages: 204 p.
    ISBN: 9780857842091
    Parallel Title: Print version: Beyond Flying : Rethinking air travel in a globally connected world
    Language: English
    Note: Front cover; Title page; Copyright page; Contents; Dedication; Friends of the Earth: rethinking travel; Foreword; Preface; Introduction; PART 1: THINKING BEYOND FLYING; Chapter 1: To fly or not to fly?; Chapter 2: Deciding never to fly again; Chapter 3: Young people and climate change; Chapter 4: Waking up to the downsides of flying; Chapter 5: Slow and low - the way to go: a systems view of travel emissions; PART 2: BUSINESS BEYOND FLYING; Chapter 6: A green travel experiment; Chapter 7: Trains versus planes: building a low-carbon travel agency. , Chapter 8: Going cold turkey: a law practice without any flightsChapter 9: The no-flying conference: Signs of Change; Chapter 10: Slowlier than thou: why flight-free travel is about better, not less; PART 3: SAVOURING THE JOURNEY; Chapter 11: The human engine: bicycling to Beijing; Chapter 12: Walking distance; Chapter 13: bike2oz: the world going through you instead of around you; Chapter 14: A small matter of distance: trying not to fly to climate talks; Chapter 15: Travel on a hot planet: exploring the global tourist industry overland; How to fly less; Index; Other Green Books titles. , About Green Books.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Ulmer
    Call number: IASS 16.90047
    Type of Medium: Monograph available for loan
    Pages: 413 S. , Ill., graph. Darst.
    ISBN: 9783825236762 (print)
    Series Statement: UTB 3676
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Call number: IASS 16.90013
    Description / Table of Contents: The 2008-10 financial crisis and the global recession it created is a complex phenomenon that warrants detailed examination. The various essays in this book utilise several alternative paradigms to provide a plausible explanation and a credible cure. Great detail is given to this important analysis from different theoretical perspectives, presenting a clearer understanding of what went wrong and expounding misinterpretations of current theories and practices. Fourteen insightful chapters by eminent scholars investigate the background of the crisis and draw lessons for economic theory and polic
    Type of Medium: Monograph available for loan
    Pages: ix, 260 Seiten
    ISBN: 9781849807456 , 1283072130 (ebk) , 9781283072137 (MyiLibrary) , 9781849807463 (electronic) , 1855754827 (print)
    Language: English
    Note: CONTENTS; List of Figures; List of Tables; List of Contributors; Introduction; PART I: ECONOMISTS ON TRIAL; 1. Who predicted the crisis and what can we learn from them? ; 2 A brief note on economic recessions, banking reform and the future of capitalism; 3 Understanding crisis: on the meaning of uncertainty and probability; 4 Financial crisis and risk measurement: the historical perspective and a new methodology; 5 Did economic analysis fail in the current financial crisis?; PART II: WHAT DOES HISTORY TELL US? ; 6 Does the current global crisis remind us of the Great Depression?. , 7 Innovation, growth, cycles and finance: three (or four or more) stories from the 1930s and their lessons8 Epic Recession and economic theory; 9 Did asset prices cause the current crisis?; 10 The role of the history of economic thought in the development of economic theory and policy; PART III: COUNTRY CASES IN A GLOBAL CRISIS; 11. Testimony to the Financial Crisis Inquiry Commission by Alan Greenspan; 12 Long-term depression and new markets: economists and the 2008 recession; 13 Manifestations of the global crisis in a small open economy. , 14 The aftermath of a long decade of real nil interest rates (Spain 1996-2008)Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Monograph available for loan
    Monograph available for loan
    Basingstoke, England : Palgrave Macmillan
    Call number: PIK B 160-16-90200
    Description / Table of Contents: This updated and revised edition outlines strategies and models for how to use technology and knowledge to improve performance, create jobs and increase income. It shows what skills will be required to produce, sell and manage performance over time, and how manual jobs can contribute to reduce the consumption of non-renewable resources
    Type of Medium: Monograph available for loan
    Pages: XXIII, 349 Seiten , graph. Darst.
    Edition: 2nd edition
    ISBN: 0230584667 (hbk.) , 9781349369195 (pbk.) , 9780230584662 (hbk.)
    Language: English
    Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    Monograph available for loan
    Monograph available for loan
    New York, NY : Springer
    Call number: PIK N 531-16-90092
    Description / Table of Contents: Ecotones are dynamic over-lapping boundary areas where major terrestrial biomes meet.  As past studies have shown, and as the chapters in this book will illustrate, their structure, size, and scope have changed considerably over the millennia, expanding and shrinking as climate and/or other driving conditions, also changed.  Today, however, many of them are changing at a rate not seen for a long time, perhaps largely due to climate change and other human-induced factors.  Indeed ecotones are more sensitive to climate change than the biomes on either side, and thus may serve as critical early indicators of future climate change.  As ecotones change, they also redefine the limits of the biomes on either side by altering their distributions of species because, in addition to their own endemic species, any ecotone will also have species from both adjoining biomes.  Consequently, they may also be places of high levels of species interaction, serving as active evolutionary laboratories, which generate new species that then migrate back into adjacent biomes.Ecotones Between Forest and Grassland explores how these ecotones have changed in the past, how they are changing today, and how they are likely to change in the future. The book includes chapters from around the world with a special focus on South American and Neotropical ecotones. 
    Type of Medium: Monograph available for loan
    Pages: XIII, 327 Seiten , Ill., graph. Darst.
    ISBN: 9781461437963 (print)
    Language: English
    Note: Ecotones Between Forest and Grassland; Preface; Contents; Contributors; Chapter 1: Introduction; 1.1 Rationale; 1.2 Case Study: The Cross Timbers; 1.3 About This Book; References; Part I: Temperate Forest-Grassland Ecotones: Prairies, Steppes, and Pampas; Chapter 2: Woodland-Grassland Ecotonal Shifts in Environmental Mosaics: Lessons Learnt from the Environmental History of the Carpathian Basin (Central Europe) During the Holocene and the Last Ice Age Based on Investigation of Paleobotanical and Mollusk Remains; 2.1 Introduction. , 2.2 Modern Woodland-Grassland Ecotone in the Carpathian Basin and Controversies Around Definitions2.3 Profiles Selected and Methods Applied in Modeling Woodland-Grassland Ecotone Shifts in the Carpathian Basin; 2.3.1 The Climate-Zonal Hypothesis Put to the Test; 2.3.2 Testing the Model of Edaphic Ecological Factors; 2.3.3 Testing the Idea of Human-Induced Ecotone Development; 2.4 The Vegetation History of the Great Hungarian Plains as Inferred from the Evaluation of Quaternary Paleoecological and Environmental Historical Data; 2.4.1 Vegetation Development During Last Ice Age. , 2.4.2 Vegetation Development During the Terminal Part of the Last Ice Age2.4.3 Vegetation Development During the Pleistocene/Holocene Transition; 2.4.4 Vegetation History of the Carpathian Basin from the Settlement of the First Farmers; 2.5 Summary; References; Chapter 3: Ecotones as Complex Arenas of Disturbance, Climate, and Human Impacts: The Trans-Andean Forest-Steppe Ecotone of Northern Patagonia; 3.1 Introduction; 3.2 Physical and Biological Setting of Forest-Steppe Ecotone of Northern Patagonia; 3.2.1 Abiotic Transition; 3.2.2 Ecosystem Properties Across the Transition. , 3.2.3 Plant Communities and Plant Diversity Across the Transition3.3 Disturbance Variation and Forest Dynamics Across the Transition; 3.3.1 Fine-Scale Disturbances; 3.3.2 Coarse-Scale Disturbances; 3.4 Direct and Disturbances-Mediated In fl uences of Climate Variability Across the Transition; 3.5 Climate, Fire, Land Use, and Long-Term Vegetation Changes Across the Transition; 3.5.1 Xeric Steppe-Woodland Belt; 3.5.2 The Nothofagus Forest-Shrubland Belt; 3.5.3 The Wet Rainforest Belt; 3.6 Conclusions; References; Chapter 4: Woody-Herbaceous-Livestock Species Interaction; 4.1 Introduction. , 4.2 Woody-Herbaceous Species Interactions and Associated Models4.3 Woodland and Grassland Stable States and Conceptual Models; 4.4 Woody-Herbaceous Ecotones; 4.5 Rates and Patterns of Woody-Herbaceous Ecotone Shift; 4.6 Woody-Herbaceous-Livestock Species Dynamics; 4.7 Other Potential Factors In fl uencing Woody-Herbaceous Species Dynamics; 4.8 Current and Future Research on Woody-Herbaceous-Livestock Species Interaction; References; Chapter 5: Woody Plant Invasions in Pampa Grasslands: A Biogeographical and Community Assembly Perspective; 5.1 Introduction. , 5.2 Woody Invasions as Hierarchical Assembly Processes.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Monograph available for loan
    Monograph available for loan
    Oldenbourg : De Gruyter
    Call number: 18/M 16.90219
    Description / Table of Contents: 〈!doctype html public ""-//w3c//dtd html 4.0 transitional//en""〉 〈html〉〈head〉 〈meta content=""text/html; charset=iso-8859-1"" http-equiv=content-type〉 〈meta name=generator content=""mshtml 8.00.6001.23619""〉〈/head〉 〈body〉 〈P〉This book systematically describes important aspects when planning secure IT systems, as well as the different approaches that may be used. It presents procedures and protocols in detail and explains them with case examples. This book is a must-read for anyone involved in IT security.〈/P〉〈/body〉〈/html〉
    Type of Medium: Monograph available for loan
    Pages: XIV, 990 Seiten
    Edition: 9. Aufl.
    ISBN: 9783486778489
    Language: German
    Note: Vorwort; Inhaltsverzeichnis; 1 Einführung; 1.1 Grundlegende Begriffe; 1.2 Schutzziele; 1.3 Schwachstellen, Bedrohungen, Angriffe; 1.3.1 Bedrohungen; 1.3.2 Angriffs- undAngreifer-Typen; 1.3.3 Rechtliche Rahmenbedingungen; 1.4 ComputerForensik; 1.5 Sicherheitsrichtlinie; 1.6 Sicherheitsinfrastruktur; 2 Spezielle Bedrohungen; 2.1 Einführung; 2.2 Buffer-Overflow; 2.2.1 Einführung; 2.2.2 Angriffe; 2.2.3 Gegenmaßnahmen; 2.3 Computerviren; 2.3.1 Eigenschaften; 2.3.2 Viren-Typen; 2.3.3 Gegenmaßnahmen; 2.4 Würmer; 2.5 Trojanisches Pferd; 2.5.1 Eigenschaften; 2.5.2 Gegenmaßnahmen; 2.6 Bot-Netze undSpam. , 2.6.1 Bot-Netze2.6.2 Spam; 2.7 MobilerCode; 2.7.1 Eigenschaften; 2.7.2 Sicherheitsbedrohungen; 2.7.3 Gegenmaßnahmen; 2.7.4 MobileApps; 3 Internet-(Un-)Sicherheit; 3.1 Einführung; 3.2 Internet-Protokollfamilie; 3.2.1 ISO/OSI-Referenzmodell; 3.2.2 DasTCP/IP-Referenzmodell; 3.2.3 Das Internet-Protokoll IP; 3.2.4 DasTransmissionControlProtokoll TCP; 3.2.5 DasUserDatagramProtocolUDP; 3.2.6 DHCP und NAT; 3.3 Sicherheitsprobleme; 3.3.1 Sicherheitsprobleme von IP; 3.3.2 Sicherheitsprobleme von ICMP; 3.3.3 Sicherheitsprobleme vonARP; 3.3.4 Sicherheitsprobleme vonUDPundTCP. , 3.4 Sicherheitsprobleme vonNetzdiensten3.4.1 DomainNameService (DNS); 3.4.2 NetworkFileSystem(NFS); 3.4.3 WeitereDienste; 3.5 Web-Anwendungen; 3.5.1 World Wide Web (WWW); 3.5.2 Sicherheitsprobleme; 3.5.3 OWASPTop-TenSicherheitsprobleme; 3.6 Analysetools undSystemhärtung; 4 Security Engineering; 4.1 Entwicklungsprozess; 4.1.1 AllgemeineKonstruktionsprinzipien; 4.1.2 Phasen; 4.1.3 BSI-Sicherheitsprozess; 4.2 Strukturanalyse; 4.3 Schutzbedarfsermittlung; 4.3.1 Schadensszenarien; 4.3.2 Schutzbedarf; 4.4 Bedrohungsanalyse; 4.4.1 Bedrohungsmatrix; 4.4.2 Bedrohungsbaum; 4.5 Risikoanalyse. , 4.5.1 Attributierung4.5.2 Penetrationstests; 4.6 Sicherheitsarchitektur und Betrieb; 4.6.1 Sicherheitsstrategie undSicherheitsmodell; 4.6.2 Systemarchitektur undValidierung; 4.6.3 Aufrechterhaltung im laufenden Betrieb; 4.7 Sicherheitsgrundfunktionen; 4.8 Realisierung der Grundfunktionen; 4.9 Security Development Lifecycle (SDL); 4.9.1 Die Entwicklungsphasen; 4.9.2 Bedrohungs- und Risikoanalyse; 5 Bewertungskriterien; 5.1 TCSEC-Kriterien; 5.1.1 Sicherheitsstufen; 5.1.2 Kritik am Orange Book; 5.2 IT-Kriterien; 5.2.1 Mechanismen; 5.2.2 Funktionsklassen; 5.2.3 Qualität; 5.3 ITSEC-Kriterien. , 5.3.1 Evaluationsstufen5.3.2 Qualität und Bewertung; 5.4 Common Criteria; 5.4.1 Überblick über dieCC; 5.4.2 CC-Funktionsklassen; 5.4.3 Schutzprofile; 5.4.4 Vertrauenswürdigkeitsklassen; 5.5 Zertifizierung; 6 Sicherheitsmodelle; 6.1 Modell-Klassifikation; 6.1.1 Objekte undSubjekte; 6.1.2 Zugriffsrechte; 6.1.3 Zugriffsbeschränkungen; 6.1.4 Sicherheitsstrategien; 6.2 Zugriffskontrollmodelle; 6.2.1 Zugriffsmatrix-Modell; 6.2.2 RollenbasierteModelle; 6.2.3 Chinese-Wall Modell; 6.2.4 Bell-LaPadula Modell; 6.3 Informationsflussmodelle; 6.3.1 Verbands-Modell; 6.4 Fazit undAusblick. , 7 Kryptografische Verfahren.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    facet.materialart.12
    New York, Basingstoke : Freeman
    Call number: 9781464138744
    Type of Medium: 12
    Pages: 1 Online-Ressource (755 Seiten) , Illustrationen, Diagramme, Karten
    Edition: 7th edition
    ISBN: 978-1-4641-3874-4 , 1-4641-3874-5
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
    Monograph available for loan
    Monograph available for loan
    Hoboken : Taylor and Francis
    Call number: M.19 92130
    Description / Table of Contents: Learn How to Design Effective Visualization SystemsVisualization Analysis and Design provides a systematic, comprehensive framework for thinking about visualization in terms of principles and design choices. The book features a unified approach encompassing information visualization techniques for abstract data, scientific visualization techniques for spatial data, and visual analytics techniques for interweaving data transformation and analysis with interactive visual exploration. It emphasizes the careful validation of effectiveness and the consideration of function before form. The book bre
    Type of Medium: Monograph available for loan
    ISBN: 9781466508910
    Series Statement: AK Peters Visualization Series
    Classification:
    Informatics
    Language: English
    Note: Front Cover; Contents; Preface; 1. What's Vis, and Why Do It?; 2. What: Data Abstraction; 3. Why: Task Abstraction; 4. Analysis: Four Levels for Validation; 5. Marks and Channels; 6. Rules of Thumb; 7. Arrange Tables; 8. Arrange Spatial Data; 9. Arrange Networks and Trees; 10. Map Color and Other Channels; 11. Manipulate View; 12. Facet into Multiple Views; 13. Reduce Items and Attributes; 14. Embed: Focus+Context; 15. Analysis Case Studies; Figure Credits; Bibliography.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 13
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 14
    Call number: PIK A 190-16-89749
    Description / Table of Contents: Modern science is a model-building activity. But how are models contructed? How are they related to theories and data? How do they explain complex scientific phenomena, and which role do computer simulations play? To address these questions which are highly relevant to scientists as well as to philosophers of science, 8 leading natural, engineering and social scientists reflect upon their modeling work, and 8 philosophers provide a commentary
    Description / Table of Contents: Modern science is a model-building activity. But how are models contructed? How are they related to theories and data? How do they explain complex scientific phenomena, and which role do computer simulations play? To address these questions which are highly relevant to scientists as well as to philosophers of science, 8 leading natural, engineering and social scientists reflect upon their modeling work, and 8 philosophers provide a commentary. U. Gähde and J. H. Wolf, University of Hamburg; S. Hartmann, Ludwig-Maximilians-Universität Munich.
    Type of Medium: Monograph available for loan
    Pages: VIII, 274 Seiten , graph. Darst.
    ISBN: 9783110313680 , 9783110313604
    Series Statement: Abhandlungen der Akademie der Wissenschaften in Hamburg 4
    Language: English
    Note: Preface; Contributors; Content; Introduction; Cosmology - The Largest Possible Model?; The Standard Model of Cosmology as a Tool for Interpretation and Discovery; Patterns in Physical and Biological Systems; Symmetry and the Explanation of Organismal Form; Pluralistic Modeling of Complex Systems; The Methodological Challenges of Complex Systems; Contested Modeling: The Case of Economics; A Unifying Approach to High- and Low-Level Cognition; High-vs Low-Level Cognition and the Neuro- Emulative Theory of Mental Representation. , Evaluating a Computational Model of Eye-Movement Control in ReadingConsidering Criteria for Model Modification and Theory Change in Psychology; Identification of Kinetic Models by Incremental Refinement; Kinetics, Models, and Mechanism; Modeling Complexity: The Case of Climate Science; Chaos, Plurality, and Model Metrics in Climate Science; Subject Index; Author Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Monograph available for loan
    Monograph available for loan
    Princeton [u.a.] : Princeton University Press
    Call number: PIK O 071-16-89977
    Description / Table of Contents: For epidemiologists, evolutionary biologists, and health-care professionals, real-time and predictive modeling of infectious disease is of growing importance. This book provides a timely and comprehensive introduction to the modeling of infectious diseases in humans and animals, focusing on recent developments as well as more traditional approaches. Matt Keeling and Pejman Rohani move from modeling with simple differential equations to more recent, complex models, where spatial structure, seasonal ""forcing,"" or stochasticity influence the dynamics, and where computer simulation needs to
    Type of Medium: Monograph available for loan
    Pages: XI, 366 Seiten , graph. Darst.
    ISBN: 9780691116174
    Language: English
    Note: ""Cover""; ""Contents""; ""Acknowledgments""; ""Chapter 1 Introduction""; ""1.1 Types of Disease""; ""1.2 Characterization of Diseases""; ""1.3 Control of Infectious Diseases""; ""1.4 What Are Mathematical Models?""; ""1.5 What Models Can Do""; ""1.6 What Models Cannot Do""; ""1.7 What Is a Good Model?""; ""1.8 Layout of This Book""; ""1.9 What Else Should You Know?""; ""Chapter 2 Introduction to Simple Epidemic Models""; ""2.1 Formulating the Deterministic SIR Model""; ""2.1.1 The SIR Model Without Demography""; ""2.1.1.1 The Threshold Phenomenon""; ""2.1.1.2 Epidemic Burnout"". , ""2.1.1.3 Worked Example: Influenza in a Boarding School""""2.1.2 The SIR Model With Demography""; ""2.1.2.1 The Equilibrium State""; ""2.1.2.2 Stability Properties""; ""2.1.2.3 Oscillatory Dynamics""; ""2.1.2.4 Mean Age at Infection""; ""2.2 Infection-Induced Mortality and SI Models""; ""2.2.1 Mortality Throughout Infection""; ""2.2.1.1 Density-Dependent Transmission""; ""2.2.1.2 Frequency Dependent Transmission""; ""2.2.2 Mortality Late in Infection""; ""2.2.3 Fatal Infections""; ""2.3 Without Immunity: The SIS Model""; ""2.4 Waning Immunity: The SIRS Model"". , ""2.5 Adding a Latent Period: The SEIR Model""""2.6 Infections with a Carrier State""; ""2.7 Discrete-Time Models""; ""2.8 Parameterization""; ""2.8.1 Estimating R[sub(0)] from Reported Cases""; ""2.8.2 Estimating R[sub(0)] from Seroprevalence Data""; ""2.8.3 Estimating Parameters in General""; ""2.9 Summary""; ""Chapter 3 Host Heterogeneities""; ""3.1 Risk-Structure: Sexually Transmitted Infections""; ""3.1.1 Modeling Risk Structure""; ""3.1.1.1 High-Risk and Low-Risk Groups""; ""3.1.1.2 Initial Dynamics""; ""3.1.1.3 Equilibrium Prevalence""; ""3.1.1.4 Targeted Control"". , ""3.1.1.5 Generalizing the Model""""3.1.1.6 Parameterization""; ""3.1.2 Two Applications of Risk Structure""; ""3.1.2.1 Early Dynamics of HIV""; ""3.1.2.2 Chlamydia Infections in Koalas""; ""3.1.3 Other Types of Risk Structure""; ""3.2 Age-Structure: Childhood Infections""; ""3.2.1 Basic Methodology""; ""3.2.1.1 Initial Dynamics""; ""3.2.1.2 Equilibrium Prevalence""; ""3.2.1.3 Control by Vaccination""; ""3.2.1.3 Parameterization""; ""3.2.2 Applications of Age Structure""; ""3.2.2.1 Dynamics of Measles""; ""3.2.2.2 Spread and Control of BSE""; ""3.3 Dependence on Time Since Infection"". , ""3.3.1 SEIR and Multi-Compartment Models""""3.3.2 Models with Memory""; ""3.3.3 Application: SARS""; ""3.4 Future Directions""; ""3.5 Summary""; ""Chapter 4 Multi-Pathogen/Multi-Host Models""; ""4.1 Multiple Pathogens""; ""4.1.1 Complete Cross-Immunity""; ""4.1.1.1 Evolutionary Implications""; ""4.1.2 No Cross-Immunity""; ""4.1.2.1 Application: The Interaction of Measles and Whooping Cough""; ""4.1.2.2 Application: Multiple Malaria Strains""; ""4.1.3 Enhanced Susceptibility""; ""4.1.4 Partial Cross-Immunity""; ""4.1.4.1 Evolutionary Implications"". , ""4.1.4.2 Oscillations Driven by Cross-Immunity"".
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    Monograph available for loan
    Monograph available for loan
    Waterloo, Ontario :CIGI,
    Call number: IASS 16.90382
    Description / Table of Contents: Acronyms -- Acknowledgments -- Introduction -- Kimie Hara and Ken Coates -- Forces for Change in the Arctic: Reflections on a Region in Transition -- Ken Coates -- The Process of Formulating Japan's Arctic Policy: From Involvement to Engagement -- Fujio Ohnishi -- China and the Arctic: China's Interests and Participation in the Region -- Kai Sun -- Arctic Prospects and Challenges from a Korean Perspective -- Young Kil Park -- East Asia and the Arctic: Alaskan and American Perspectives -- Jerry McBeath -- Canada's Northern Strategy and East Asian Interests in the Arctic
    Description / Table of Contents: P. Whitney Lackenbauer and James Manicom -- The Cooperation of Russia and Northeast Asian Countries in the Arctic: Challenges and Opportunities -- Tamara Troyakova -- From Cold War Thaws to the Arctic Thaw: The Changing Arctic and Its Security Implications to East Asia -- Kimie Hara -- The Business of Arctic Development: East Asian Economic Interests in the Far North -- Carin Holroyd -- Border Dynamics in Eurasia: Implications for the Arctic Thaw -- Akihiro Iwashita -- The Arctic and Geopolitics -- David A. Welch -- East Asian States and the Pursuit of Arctic Council Observer Status
    Description / Table of Contents: James Manicom and P. Whitney Lackenbauer -- Contributors
    Description / Table of Contents: The Arctic's profile as a region for engagement and opportunity is rising among both circumpolar and non-circumpolar states
    Type of Medium: Monograph available for loan
    Pages: viii, 217 Seiten , Illustrationen, Karten
    ISBN: 9781928096023 (print) , 9781928096030
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
    Call number: IASS 16.90380
    Description / Table of Contents: Chapter 2 Governance of marine fisheries and biodiversity conservation: Convergence or coevolution?Introduction; Selected strands in fishery governance; Selected strands in conservation governance; Parallel strands in conservation and fishery governance; Discussion and conclusion; Notes; References; Chapter 3 Governance of marine fisheries and biodiversity conservation: The integration challenge; Introduction; Sustainable development backdrop; Integration process; Integration factors; Integration through interaction; Concluding thoughts; Notes; References; Part 2 Governance dimensions
    Description / Table of Contents: Chapter 4 Bio-ecological dimensions of fisheries management, biodiversity and governanceIntroduction and background; Fisheries management up to the 1990s; The ecological categories of impacts of fishing and their management; Areas of overlap and potential for inconsistencies between fisheries and conservation of biodiversity approaches; Venues for change; Conclusions; References; Chapter 5 The economic dimension: Addressing behaviour, incentives and context for effective governance; Introduction; Economic foundations of governance; The economic context of governance
    Description / Table of Contents: Evolving economic scope of governanceEconomic instruments in fisheries and marine conservation; Discussion: Economic instruments and prospects for governance integration; References; Chapter 6 The social dimension: The challenge of dealing with equity; Introduction: The two cultures; Fisheries management: creating wealth, forgetting about distribution; Conservation: creating values with unequal distribution of costs; Reconciling fisheries management and conservation; Consultation and co-management; Fisheries management and conservation within larger frameworks; Lessons learnt; Notes
    Description / Table of Contents: Governance of Marine Fisheries and Biodiversity Conservation; Copyright; Contents; Notes on contributors; Foreword Bonnie J. McCay; Foreword Árni M. Mathiesen; Foreword Braulio Ferreira de Souza Dias; Preface Serge M. Garcia, Jake Rice and Anthony Charles; Acknowledgements; List of selected acronyms; Glossary; Part 1 Governance trends and challenges; Chapter 1 Governance of marine fisheries and biodiversity conservation: A history; Introduction; Historical developments in fishery governance; Historical developments in biodiversity conservation; Conclusions; Notes; References
    Description / Table of Contents: Part 4. Regional governance. Regional governance for fisheries and biodiversity / R. Warner, K.M. Gjerde and D. Freestone ; Regional governance: The case of NEAFC and OSPAR / K. Hoydal, D. Johnson and A.H. Hoel ; Regional governance: The Mediterranean cradle / F. Simard, M. Camilleri and L. Sbai ; CCAMLR and Antarctic conservation: The leader to follow? / D. Miller and N.M. Slicer ; Implementation of the Ecosystem Approach to Fisheries in the Benguela Current LME area / J. Augustyn, S. Petersen, L. Shannon and H. Hamukuaya ; Governance of marine fisheries and conservation in the context of the European Union / S. Beslier and B. Drobenko -- Part 5. National governance. The use of national frameworks for sustainable development of marine fisheries and conservation, ecosystem-based management and integrated ocean management / K. Sainsbury, P. Gullestad and J. Rice ; Small-scale fisheries: Importance, vulnerability and deficient knowledge / J. Kolding, C. Béné and M. Bavinck ; Stewardship in tropical small-scale fisheries: Community and national perspectives / P. Christie, L.M. Campbell and N. Armada ; Making space for small-scale fishing communities: Use and misuse of spatial management instruments / M.R. Sowman, R. Rajagopalan, C. Sharma and J. Sunde ; ENGOs and SIDS: Environmental interventions in small island developing states / P. McConney, R. Pomeroy and Z. Khan ; The role of capacity building for improving governance of fisheries and conservation of marine ecosystems / J.C. Seijo and S. Salas ; Fishers' organizations: Their role in decision-making for fisheries and conservation / M. Makino, A.S. Cabanban and S. Jentoft ; The role of courts in fisheries management and marine biodiversity protection: US and EU systems / P. Shelley and T. van Rijn --
    Description / Table of Contents: Part 5. Conclusion. A tale of two streams: Synthesizing governance of marine fisheries and biodiversity conservation / A. Charles, S.M. Garcia and J. Rice -- Annexes. Annex 1: History of fisheries and biodiversity conservation: A timeline of key events (1850-2012) ; Annex 2: Key global institutions, bodies and processes: Roles, participation and main focus
    Description / Table of Contents: Part 1. Governance trends and challenges. Governance of marine fisheries and biodiversity conservation: A history / S.M. Garcia, J. Rice and A. Charles ; Governance of marine fisheries and biodiversity conservation: Convergence or coevolution? / S.M. Garcia, J. Rice and A. Charles ; Governance of marine fisheries and biodiversity conservation: The integration challenge / S.M. Garcia, J. Rice and A. Charles -- Part 2. Governance dimensions. Bio-ecological dimensions of fisheries management, biodiversity and governance / J. Rice and P. Mace ; The economic dimension: Addressing behaviour, incentives and context for effective governance / S. Hanna ; The social dimension: The challenge of dealing with equity / B. Hersoug ; The global legal dimension: Navigating the legal currents of rights and responsibilities / A.H. Hoel and D. VanderZwaag ; Spatial dimensions of fisheries and biodiversity governance / R. Kenchington, O. Vestergaard and S.M. Garcia ; Scientific foundation: Towards integration / J. Rice, S. Jennings and A. Charles -- Part 3. Global governance. Global level institutions and processes: Frameworks for understanding critical roles and foundations of cooperation and integration / L. Ridgeway ; Global level institutions and processes: Assessment of critical roles, foundations of cooperation and integration and their contribution to integrated marine governance / L. Ridgeway ; Integrative policy and legal instruments, approaches and tools: Fisheries and biodiversity conservation / B. Kuemlangan, J. Sanders, P. Deupmann and C. De Young ; Conservation and risk of extinction of marine species / P. Mace, C. O'Criodain, J. Rice and G. Sant ; Parallel initiatives: CBD's Ecologically or Biologically Significant Areas (EBSAs) and FAO's Vulnerable Marine Ecosystems (VMEs) criteria and processes / J. Rice, J. Lee and M. Tandstad --
    Description / Table of Contents: Governance of Marine Fisheries and Biodiversity Conservation explores governance of the world's oceans with a focus on the impacts of two inter-connected but historically separate streams of governance: one for fisheries, the other for biodiversity conservation. Chapters, most co-authored by leading experts from both streams, investigate the interaction of these governance streams from ecological, economic, social and legal perspectives, with emphasis on policies, institutions processes, and outcomes on scales from the global to the local community, and with coverage of a range of them
    Type of Medium: Monograph available for loan
    Pages: XXXVIII, 511 Seiten , Illustrationen, Karten
    ISBN: 9781118392645 (cloth)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 18
    facet.materialart.12
    Berlin, New York : De Gruyter Saur
    Call number: 9783110232103 (e-book)
    Description / Table of Contents: With the term "Library 2.0" the editors mean an institution which applies the principles of the Web 2.0 such as openness, re-use, collaboration and interaction in the entire organization. Libraries are extending their service offerings and work processes to include the potential of Web 2.0 technologies. This changes the job description and self-image of librarians. The collective volume offers a complete overview of the topic Library 2.0 and the current state of developments from a technological, sociological, information theoretical and practice-oriented perspective
    Type of Medium: 12
    Pages: 1 Online-Ressource (1 electronic resource (xii, 392 p.))
    Edition: Online-Ausg.
    ISBN: 9783110232103 , 9783110232097
    Series Statement: Bibliotheks- und Informationspraxis 41
    Language: Undetermined
    Note: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 19
    Monograph available for loan
    Monograph available for loan
    Cambridge, Mass. [u.a.] : MIT Press
    Call number: PIK B 020-16-89772
    Type of Medium: Monograph available for loan
    Pages: XXVII, 1064 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 0262232588 (hbk.) , 9780262232586
    Language: English
    Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 20
    Monograph available for loan
    Monograph available for loan
    Berkeley : University of California Press
    Call number: IASS 16.89932
    Description / Table of Contents: Charles C. Ragin's "The Comparative Method" proposes a synthetic strategy, based on an application of Boolean algebra, that combines the strengths of both qualitative and quantitative sociology. Elegantly accessible and germane to the work of all the social sciences, and now updated with a new introduction, this book will continue to garner interest, debate, and praise
    Type of Medium: Monograph available for loan
    Pages: xxx, 185 S.
    ISBN: 9780520280038
    Language: English
    Note: Cover; Contents; Preface and Overview; Acknowledgments; Introduction to the 2014 Edition; 1. The Distinctiveness of Comparative Social Science; 2. Heterogeneity and Causal Complexity; 3. Case-Oriented Comparative Methods; 4. The Variable-Oriented Approach; 5. Combined Versus Synthetic Comparative Strategies; 6. A Boolean Approach to Qualitative Comparison: Basic Concepts; 7. Extensions of Boolean Methods of Qualitative Comparison; 8. Applications of Boolean Methods of Qualitative Comparison; 9. The Dialogue of Ideas and Evidence in Social Research; Bibliography; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 21
    Monograph available for loan
    Monograph available for loan
    New York : Routledge
    Call number: IASS 16.89933
    Description / Table of Contents: Bringing together papers written by Norman Fairclough over a 25 year period, Critical Discourse Analysis represents a comprehensive and important contribution to the development of this popular field.  The book is divided into seven sections covering the following themes:  language in relation to ideology and powerdiscourse in processes of social and cultural change dialectics of discourse, dialectical relations between discourse and other moments of social lifemethodology of critical discourse analysis research analysis of political discourse discourse in globalisation and ?transition' critic
    Type of Medium: Monograph available for loan
    Pages: xi, 591 S.
    Edition: Second edition
    Edition: Online-Ausg.
    ISBN: 9781405858229 (pbk.)
    Language: English
    Note: section A. Language, ideology and powersection B. Discourse and sociocultural change -- section C. Dialectics of discourse: theoretical developments -- section D. Methodology in CDA research -- section E. Political discourse -- F. Globalisation and 'transition' -- section G. Language and education..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    Monograph available for loan
    Monograph available for loan
    Berlin : Springer
    Call number: 6/M 16.89656
    Description / Table of Contents: Geodetic datum (including coordinate datum, height datum, depth datum, gravimetry datum) and geodetic systems (including geodetic coordinate system, plane coordinate system, height system, gravimetry system) are the common foundations for every aspect of geomatics. This course book focuses on geodetic datum and geodetic systems, and describes the basic theories, techniques, methods of geodesy. The main themes include: the various techniques of geodetic data acquisition, geodetic datum and geodetic control networks, geoid and height systems, reference ellipsoid and geodetic coordinate systems, Gaussian projection and Gaussian plan coordinates and the establishment of geodetic coordinate systems. The framework of this book is based on several decades of lecture noted and the contents are developed systematically for a complete introduction to the geodetic foundations of geomatics.
    Description / Table of Contents: REVIEW: "The present work integrates both classical materials and modern developments in geodesy, it describes pure theoretical approaches and recent practical applications. The book can be used as a general textbook for undergraduates studying geomatics and survejing and mapping in higher education institutions. For technicians who are engaged in geomatic and surveying engineering, the book is strongly recommended as a basic and useful reference guide."
    Type of Medium: Monograph available for loan
    Pages: XXI, 401 S.
    ISBN: 9783642412455 , 9783642412448
    Classification:
    Geodesy
    Language: English
    Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: M 16.89855
    Description / Table of Contents: The first global overview of intraplate earthquakes, their mechanical models and investigative geophysical techniques, for academic researchers, professionals and engineers
    Type of Medium: Monograph available for loan
    ISBN: 9781107040380
    Parallel Title: Print version: Intraplate Earthquakes
    Language: English
    Note: Cover; Half title; Title; Copyright; Contents; Contributors; Preface; 1 Introduction; 2 Intraplate earthquakes in Australia; 2.1 Introduction; 2.2 Two centuries of earthquake observations in Australia; 2.2.1 Mechanism, geographic distribution, and strain rate; 2.2.2 Seismogenic depth; 2.2.3 Attenuation and scaling relations; 2.3 A long-term landscape record of large (morphogenic) earthquakes; 2.3.1 Variation in fault scarp length and vertical displacement; 2.3.2 The influence of crustal type and character on seismic activity rates; 2.4 Patterns in earthquake occurrence. , 2.5 Maximum magnitude earthquake2.5.1 Scarp length as a proxy for paleo-earthquake magnitude; 2.6 Implications for SCR analogue studies: factors important in earthquake localisation; 2.6.1 Mechanical and thermal influences; 2.6.2 Structural architectural influences; 2.7 Conclusions; Acknowledgements; 3 Intraplate seismicity in Brazil; 3.1 Introduction; 3.2 Earthquake catalogue; 3.3 Seismicity map; 3.4 Seismotectonic correlations; 3.4.1 Lower seismicity in Precambrian cratonic provinces; 3.4.2 Intraplate seismicity and cratonic roots; 3.4.3 Passive margin seismicity. , 3.4.4 Influence of neotectonic faults3.4.5 Flexural stresses; 3.5 Discussion and conclusions; Acknowledgments; 4 Earthquakes and geological structures of the St. Lawrence Rift System; 4.1 Introduction; 4.2 Historical earthquakes and their impact; 4.3 Seismic zones of the SLRS; 4.3.1 Charlevoix; 4.3.2 Lower St. Lawrence; 4.3.3 Western Quebec; 4.3.4 Background seismicity; 4.4 The St. Lawrence Rift System; 4.5 The rift hypothesis and the SLRS: discussion and conclusions; Acknowledgments; 5 Intraplate earthquakes in North China; 5.1 Introduction; 5.2 Tectonic background; 5.2.1 Geological history. , 5.2.2 Lithospheric structure5.2.3 Major seismogenic faults; 5.3 Active tectonics and crustal kinematics; 5.4 Strain rates and seismicity; 5.5 Seismicity; 5.5.1 Paleoseismicity; 5.5.2 Large historic events; 1303 Hongdong earthquake (M 8.0); 1556 Huaxian earthquake (M 8.3); 1668 Tancheng earthquake (M 8.5); 1679 Sanhe earthquake (M 8.0); 1695 Linfen earthquake (M 7.5-8.0); 5.5.3 Large instrumentally recorded earthquake; The 1966 Xingtai earthquake (Ms 7.2); The 1975 Haicheng earthquake (Ms 7.3); The 1976 Tangshan earthquake (Ms 7.8); 5.6 Spatiotemporal patterns of large earthquakes. , 5.6.1 Long-distance roaming of large earthquakes5.6.2 Fault coupling and interaction; 5.6.3 A conceptual model for mid-continental earthquakes; 5.7 Implications for earthquake hazards; Acknowledgements; 6 Seismogenesis of earthquakes occurring in the ancient rift basin of Kachchh, Western India; 6.1 Introduction; 6.2 Tectonic framework, structure, and tectonic evolution of Kachchh Rift basin; 6.2.1 Structure and tectonics; 6.2.2 Tectono-volcanic events; 6.2.3 Tectonic evolution and existing earthquake generation models of the Kachchh Rift zone. , 6.2.4 Identification of magmatic intrusive bodies.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 24
    Monograph available for loan
    Monograph available for loan
    Hoboken : Taylor and Francis
    Call number: IASS 16.90022
    Description / Table of Contents: Today, the risks associated with global environmental change and the dangers of extreme climatic and geological events remind us of humanity's dependence on favourable environmental conditions. Our relationships with the landscapes and ecologies that we are a part of, the plants and animals that we share them with, and the natural resources that we extract, lie at the heart of contemporary social and political debates. It is no longer possible to understand key social scientific concerns without at the same time also understanding contemporary patterns of ecosystem change.The Routledge Interna
    Type of Medium: Monograph available for loan
    Pages: xv, 338 Seiten
    ISBN: 9781138645332
    Series Statement: Routledge International Handbooks
    Language: English
    Note: Cover; Title Page; Copyright Page; Table of Contents; List of illustrations; Notes on contributors; Acknowledgements; 1 Socio-ecological transformations and the social sciences; PART I Challenges, contradictions and consequences of global socio-ecological change; 2 Ecological modernization theory: taking stock, moving forward; 3 The emergence of new world-systems perspectives on global environmental change; 4 China's economic growth and environmental protection: approaching a 'win-win' situation? A discussion of ecological modernization theory; 5 Eco-imperialism and environmental justice. , 6 Neoliberalism by design: changing modalities of market-based environmental governance7 Dilemmas for standardizers of sustainable consumption; PART II Climate change, energy and adaptation; 8 Climate, scenario-building and governance: comprehending the temporalities of social-ecological change; 9 From Rio to Copenhagen: multilateral agreements, disagreements and situated actions; 10 Marriage on the rocks: sociology's counsel for our struggling energy-society relationships; 11 Sustainability as social practice: new perspectives on the theory and policies of reducing energy consumption. , 12 Environmental migration: nature, society and population movementPART III Urban environmental change, governance and adaptation; 13 Climate change and urban governance: a new politics?; 14 Recovering the city level in the global environmental struggle: going beyond carbon trading; 15 Hybrid arrangements within the environmental state; 16 The new mobilities paradigm and sustainable transport: finding synergies and creating new methods; PART IV Risk, uncertainty and social learning; 17 Towards a socio-ecological foundation for environmental risk research. , 18 Uncertainty and claims of uncertainty as impediments to risk management19 Transboundary risk governance: co-constructing environmental issues and political solutions; 20 The role of professionals in managing technological hazards: the Montara blowout; 21 Social learning to cope with global environmental change and unsustainability; PART V (Re)assembling social-ecological systems; 22 The social-ecological co-constitution of nature through ecological restoration: experimentally coping with inevitable ignorance and surprise. , 23 Biological invasions as cause and consequence of 'our' changing world: social and environmental paradoxes24 Biological resources, knowledge and property; 25 Disassembling and reassembling socionatural networks: integrated natural resource management in the Great Bear Rainforest; 26 Land use tensions for the development of renewable sources of energy; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: IASS 16.89972
    Description / Table of Contents: "The scale, effectiveness and legitimacy of global governance lag far behind the world's needs. This path-breaking book examines how far civil society involvement provides an answer to these problems. Does civil society make global governance more democratic? Have citizen action groups raised the accountability of global bodies that deal with challenges such as climate change, financial crises, conflict, disease and inequality? What circumstances have promoted (or blocked) civil society efforts to make global governance institutions more democratically accountable? What could improve these outcomes in the future? The authors base their argument on studies of thirteen global institutions, including the UN, G8, WTO, ICANN and IMF. Specialists from around the world critically assess what has and has not worked in efforts to make global bodies answer to publics as well as states. Combining intellectual depth and political relevance, Building Global Democracy? will appeal to students, researchers, activists and policymakers"--
    Type of Medium: Monograph available for loan
    Pages: xxv, 397 S.
    ISBN: 9780521140553
    Language: English
    Note: Machine generated contents note: Introduction Jan Aart Scholte; 1. Global governance, accountability and civil society Jan Aart Scholte; 2. Civil society and accountability of the United Nations Kerstin Martens; 3. The World Bank and democratic accountability: the role of civil society Alnoor Ebrahim and Steven Herz; 4. Civil society and IMF accountability Jan Aart Scholte; 5. Civil society and the WTO: contesting accountability Marc Williams; 6. Civil society and accountability in the Commonwealth Timothy M. Shaw and Pamela K. Mbabazi; 7. The organisation of the Islamic conference, accountability and civil society Saied Reza Ameli; 8. Civil society and patterns of accountability in the OECD Morten Ougaard; 9. Civil society and G8 accountability Peter I. Hajnal; 10. Structuring accountability: the Asia-Europe meeting Julie Gilson; 11. Civil society and accountability in global governance of climate change Peter Newell; 12. Civil society and accountability promotion in the global fund Carolyn Long and Nata Duvvury; 13. Accountability in private global governance: ICANN and civil society Mawaki Chango; 14. Civil society and the World Fair Trade Organisation: developing responsive accountability Heidi Ullrich; Conclusion Jan Aart Scholte..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    Call number: M 17.90543
    Description / Table of Contents: This book is a new edition of Roederer’s classic Dynamics of Geomagnetically Trapped Radiation, updated and considerably expanded. The main objective is to describe the dynamic properties of magnetically trapped particles in planetary radiation belts and plasmas and explain the physical processes involved from the theoretical point of view. The approach is to examine in detail the orbital and adiabatic motion of individual particles in typical configurations of magnetic and electric fields in the magnetosphere and, from there, derive basic features of the particles’ collective “macroscopic” behavior in general planetary environments. Emphasis is not on the “what” but on the “why” of particle phenomena in near-earth space, providing a solid and clear understanding of the principal basic physical mechanisms and dynamic processes involved. The book will also serve as an introduction to general space plasma physics, with abundant basic examples to illustrate and explain the physical origin of different types of plasma current systems and their self-organizing character via the magnetic field. The ultimate aim is to help both graduate students and interested scientists to successfully face the theoretical and experimental challenges lying ahead in space physics in view of recent and upcoming satellite missions and an expected wealth of data on radiation belts and plasmas
    Type of Medium: Monograph available for loan
    Pages: xviii, 192 Seiten
    Edition: Second edition
    ISBN: 9783642415296
    Series Statement: Astrophysics and Space Science Library 403
    Classification:
    Geomagnetism, Geoelectromagnetism
    Language: English
    Note: Particle Drifts and the First Adiabatic InvariantParticle Trapping, Drift Shells and the Second Adiabatic Invariant -- Periodic Drift Motion and the Third Adiabatic Invariant -- Trapped Particle Distributions and Flux Mapping -- Violation of the Adiabatic Invariants and Trapped Particle Diffusion -- Introduction to Plasma Physics..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Call number: 3/S 07.0034(2016)
    In: Annual report
    Type of Medium: Monograph available for loan
    Pages: 51 Seiten
    ISSN: 1865-6439 , 1865-6447
    Parallel Title: Erscheint auch als Annual report ... / Helmholtz Association of German Research Centres
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    facet.materialart.12
    Berlin : De Gruyter Saur
    Call number: 9783110278736 (e-book)
    Description / Table of Contents: Das Buch ist sowohl eine Einführung in die Themen Linked Data, Open Data und Open Linked Data als es auch den konkreten Bezug auf Bibliotheken behandelt. Hierzu werden konkrete Anwendungsprojekte beschrieben. Der Band wendet sich dabei sowohl an Personen aus der Bibliothekspraxis als auch an Personen aus dem Bibliotheksmanagement, die noch nicht mit dem Thema vertraut sind. Das Buch ist eine Einführung in die Themen Data. | This book is an introduction to the subjects of linked data, open data and open linked data, and to their specific relevance for libraries. It illustrates these concepts through detailed descriptions of actual data projects. The volume will be useful to individuals involved in library practice and those in library management who have not yet become familiarized with these important contemporary fields.
    Type of Medium: 12
    Pages: 1 Online-Ressource (1 electronic resource (vi, 244 p.))
    Edition: Online-Ausg.
    ISBN: 9783110278736 , 9783110276343
    Series Statement: Bibliotheks- und Informationspraxis 50
    Language: Undetermined
    Note: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
  • 30
  • 31
    Non-book medium
    Non-book medium
    Heidelberg : Spektrum der Wissenschaft Verlagsgesellschaft
    Call number: (OCoLC)838497963
    Type of Medium: Non-book medium
    Pages: Online-Ressource (114 Seiten) , Illustrationen
    Series Statement: Sterne und Weltraum 50.2011,5
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Unknown
    Chicago : Precision Wordage Press
    Call number: 22/M 15.89567 (1. Ex.) ; 22/M 15.89567 (2. Ex.) ; 22/M 15.89567 (3. Ex.) ; 22/M 15.89567 (4. Ex.) ; 22/M 15.89567 (5. Ex.) ; 22/M 15.89567 (6. Ex.) ; 22/M 15.89567 (7. Ex.) ; 22/M 15.89567 (8. Ex.) ; 22/M 15.89567 (9. Ex.) ; 22/M 15.89567 (10. Ex.)
    Description / Table of Contents: Drawing from his own experience with corporations both large and small and as a business owner, Jack Molisani has seen every mistake the professional (or not-so-professional) can make in today's highly competitive job market. This book provides the tools for navigating these choppy waters. Starting with how to escape a dead-end job or an overbearing boss, to advancing one's career, and finally to achieving a higher standard of living, the book is divided into sections on finding new directions, making things happen, and optimizing the results. While most business guides focus on either job hun
    Pages: Online-Ressource (111 p)
    Edition: Online-Ausg.
    ISBN: 9780962709029
    Parallel Title: Print version: Be the Captain of Your Career : A New Approach to Career Planning and Advancement
    Language: English
    Note: Cover; Copyright; Praise; Introduction; Contents; Section 1: THINK IT; The First Thing to Do When You Find Yourself in a Hole: Stop Digging; Stay Positive; Never Lose Faith; Seven Career Lessons I Learned from Selling Ginsu Knives; A Turning Point; Stop. Breathe. Think. Then Act.; Overcoming Inertia; Overcoming Fear; Keep Swimming; Section 2: DO IT; What Is a Resume?; What Are Managers Looking For?; Dirty Little Resume Secrets; The T-Bomb; Current Experience; What You Do Is More Important than What You're Called; The Top Ten Mistakes Professionals Make When Looking for Work. , Resumes: A SummaryCover Your Letter; Following Up; Getting Interviews; Be Proactive; Be Visible; Social Networking; Four Critical Steps to Getting a Job Offer; Send Out Ships; Gold Calling; Section 3: HAVE IT; Creating the Path; Recession-Proof Your Career; Creating a PR Campaign; Taking the Initiative; Increase Your Ability to Find Work; Advancing Your Career through Personal Branding; Advancing Your Career through Progressive Information Disclosure; Honing Your Workplace Negotiation Skills; The Sky's the Limit; What Are You Waiting For?; About Making Money; Creating the Life You Want. , Recommended ReadingAbout the Author.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: IASS 16.90372 ; PIK D 022-19-89867
    Description / Table of Contents: Wir leben auf Kosten der Zukunft. Warum? Kurzfristige Interessen der Bürger (sichere Arbeit) ergänzen sich mit kurzfristigen Interessen der Politiker (Wiederwahl). Das politische System trägt Mitschuld. Wie kann man es ändern, um  diese Schwächen zu vermeiden? Lässt es sich demokratisch rechtfertigen, wenn Anwälte zukünftiger Generationen heute schon mitentscheiden? Diese Fragen werden  von Wissenschaftlern, Schriftstellern, Politikern und Unternehmern behandelt, um methodische Analyse, politischen und ökonomischen Sachverstand und kreative Ideen zu kombinieren. Das Buch enthält Beiträge von H. Geißler, H. J. Schellnhuber, I. Trojanow u.a. „Die Demokratie hat viele große Vorzüge und Stärken. Langfristigkeit und Nachhaltigkeit gehören bislang nicht dazu. Dem kann man institutionell abhelfen. Das Buch zeigt, wie.“ (Ernst Ulrich von Weizsäcker, MdB a.D.)   Der Inhalt ·         Problemanalyse und Überblick ·         Neue Institutionen: Zukunftsräte ·         Neue Institutionen: Ombudspersonen ·         Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten ·         Ombudspersonen in Unternehmen?   Die Zielgruppen   ·         PolitikwissenschaftlerInnen ·         PhilosophInnen ·         politisch interessierte Bürger     Der Herausgeber Prof. Dr. Bernward Gesang lehrt Philosophie an der Universität Mannheim
    Type of Medium: Monograph available for loan
    Pages: XII, 150 S.
    ISBN: 9783658048952 , 9783658048945
    Parallel Title: Print version: Kann Demokratie Nachhaltigkeit
    Language: German
    Note: Problemanalyse und ÜberblickNeue Institutionen: Zukunftsräte -- Neue Institutionen: Ombudspersonen -- Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten -- Ombudspersonen in Unternehmen?..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: PIK P 120-16-89806
    Description / Table of Contents: Deutschland wird seine bisher weitgehend auf fossilen Brennstoffen basierende Energieversorgung bis zum Jahr 2050 auf großtenteils regenerative Energien umstellen. Die Burgerinnen und Burger dieses Landes kennen dieses weltweit einzigartige Projekt unter dem Namen Energiewende. Von ihren gesellschaftlichen Wurzeln, dem Beginn ihrer Umsetzung und ihrer rasanten Entwicklung in den letzten Jahren berichtet Klaus-Dieter Maubach. Er beschreibt, wie das deutsche Energiesystem der Zukunft aussehen muss, und schlagt einen kurzfristigen Aktionsplan vor, der die volkswirtschaftlichen Kosten eindammt und
    Type of Medium: Monograph available for loan
    Pages: XX, 293 Seiten
    Edition: 2. Auflage
    ISBN: 3658054735 , 9783658054731
    Language: German
    Note: Vorwort zur zweiten Auflage; Vorwort; Inhalt; Abkürzungen; Einführung; Teil I; Eine kurze Geschichte der Energiewende; Fukushima und Ausstieg (2011); Fundamente der Energiewende (1980 - 1998); EnWG und EEG (1998 - 2003); Emissionshandel und Energiepreise (2003 - 2008); Netzregulierung und EEG (2004 - 2008); Krise in Europa (2009 - 2012); Teil II; Die Zukunft der Energiewende; Standortbestimmung (2013); 2050: Energiewende; Fossile Primärenergien; Die Regenerativen; Energiesystem der Zukunft; Politik für die Energiewende; 1 Braunkohle und Erdgas; 2 Auslaufbetrieb der Kernenergie ; 3 Energieeffizienz ; 4 Emissionshandel ; 5 EEG Reform ; 6 Regulierung der Stromnetze ; 7 Strommarktgestaltung ; 8 Koordinierung der Energiewende ; Zusammenfassung.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Call number: PIK 16-89825
    Type of Medium: Monograph available for loan
    Pages: Getr. Zählung , Ill., graph. Darst.
    Edition: Online-Ausg. Berlin Humboldt-Universität zu Berlin, Universitätsbibliothek 2011 〈〈Nach einem Exemplar der Humboldt-Universität zu Berlin, Universitätsbibliothek mit der Signatur: 〉〉Diss Geo11 P134
    Language: German
    Note: Berlin, Humboldt-Univ., Diss., 2011
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: M 16.89755
    Description / Table of Contents: Provides a deeper understanding of earthquake processes, based on laboratory-derived physical laws and formulae, for researchers, professionals and graduate students
    Type of Medium: Monograph available for loan
    Pages: x, 270 S.
    Edition: Online-Ausg. 2013
    ISBN: 9781107030060
    Classification:
    Seismology
    Parallel Title: Print version: The Physics of Rock Failure and Earthquakes
    Language: English
    Note: Contents; Preface; 1 Introduction; 2 Fundamentals of rock failure physics; 2.1 Mechanical properties and constitutive relations; 2.1.1 Elastic deformation; 2.1.2 Ductile deformation; 2.1.3 Fracture; 2.1.4 Friction; 2.2 Basics of rock fracture mechanics; 2.2.1 Energy release rate and resistance to rupture growth; 2.2.2 Stress concentration and cohesive zone model; 2.2.3 Breakdown zone model for shear failure; 2.2.4 j-integral and energy criterion for shear failure; 2.2.5 Relation between resistance to rupture growth and constitutive relation parameters. , 3 Laboratory-derived constitutive relations for shear failure3.1 Shear failure of intact rock; 3.1.1 Method and apparatus used; 3.1.2 Constitutive relations derived from data on the shear failure of intact rock; 3.1.3 Geometric irregularity of shear-fractured surfaces and characteristic length; 3.2 Frictional slip failure on precut rock interface; 3.2.1 Method and apparatus used; 3.2.2 Geometric irregularity of precut fault surfaces and characteristic length; 3.2.3 Constitutive relations derived from data on frictional stick-slip failure. , 3.2.4 Laboratory-derived relationships between physical quantities observed during dynamic slip rupture propagation3.3 Unifying constitutive formulation and a constitutive scaling law; 3.3.1 Unification of constitutive relations for shear fracture and for frictional slip failure; 3.3.2 A constitutive scaling law; 3.3.3 Critical energy required for shear fracture and for frictional stick-slip failure; 3.3.4 Stabilityinstability of the breakdown process; 3.3.5 Breakdown zone size; 3.4 Dependence of constitutive law parameters on environmental factors; 3.4.1 Introduction. , 3.4.2 Dependence of shear failure strength on environmental factors3.4.3 Dependence of breakdown stress drop on environmental factors; 3.4.4 Dependence of breakdown displacement on environmental factors; 4 Constitutive laws for earthquake ruptures; 4.1 Basic foundations for constitutive formulations; 4.2 Rate-dependent constitutive formulations; 4.3 Slip-dependent constitutive formulations; 4.4 Depth dependence of constitutive law parameters; 5 Earthquake generation processes; 5.1 Shear failure nucleation processes observed in the laboratory; 5.1.1 Introduction; 5.1.2 Experimental method. , 5.1.3 Nucleation phases observed on faults with different surface roughnessesRough fault; Smooth fault; Extremely smooth fault; 5.1.4 Scaling of the nucleation zone size; 5.2 Earthquake rupture nucleation; 5.2.1 Seismogenic background; 5.2.2 Physical modeling and theoretical derivation of the nucleation zone size; 5.2.3 Comparison of theoretical relations with seismological data; 5.2.4 Foreshock activity associated with the nucleation process; 5.3 Dynamic propagation and generation of strong motion seismic waves; 5.3.1 Slip velocity and slip acceleration in the breakdown zone. , 5.3.2 The cutoff frequency fs max of the power spectral density of slip acceleration at the source.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    Call number: PIK E 713-17-90095
    Description / Table of Contents: Die Herausgeberinnen: Prof. Dr.-Ing. Sabine Hofmeister, Dr. rer. nat. Christine Katz, Dr. rer. soc. Tanja Mölders, alle: Lehr- und Forschungsgebiet Umweltplanung, Fakultät Nachhaltigkeit, Leuphana Universität Lüneburg
    Description / Table of Contents: Zwischen Geschlechter- und Nachhaltigkeitsforschung sind zahlreiche Synergien möglich. Die AutorInnen zeigen, warum die Umweltwissenschaften nicht auf die Kategorie Geschlecht verzichten dürfen. Den LeserInnen wird ein Überblick über das komplexe und vielfältig verwobene Forschungsfeld gegeben.
    Type of Medium: Monograph available for loan
    Pages: 403 Seiten
    ISBN: 9783847400103
    Language: German
    Note: Contents: I Grundlegungen und Orientierungen ; 1. Grundlegungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; 2. Orientierungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; II Forschungs- und Handlungsfelder der Nachhaltigkeitswissenschaften und -politik ; 1. Einführung ; 2. Wissenschaft und Forschung ; 3. Wirtschaften und Arbeiten ; 4. Raumentwicklung ; 5. Mobilität ; 6. Klimawandel und -politik ; 7. Ressourcenpolitik und Infrastruktur ; 8. Natur und Landschaft ; 9. Konsum- und Lebensstile ; 10. Zeit(en) ; 11. Governance, Partizipation, Empowerment ; III Fazit - Die Kategorie Geschlecht: Neue Perspektiven für die Nachhaltigkeitswissenschaften
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS Verlag für Sozialwissenschaften
    Call number: IASS 16.90103
    Description / Table of Contents: Ob in Medien, in der Wissenschaft, in der Politik oder in der Alltagskommuni­kation - wir sind stets mit einer Fülle an schriftlichen und mündlichen Erzäh­lungen konfrontiert. Sie schaffen gemeinsame Wirklichkeiten und Identitäten, auf die wir uns als soziale Akteure in unseren Handlungen bewusst oder unbewusst beziehen. Erzählungen im öffentlichen Raum prägen Normen und Moralvorstellungen, helfen beim Aufbau sozialer und kultureller Ordnungen und festigen oder verschieben damit bestehende Normen. Es sind Erzählungen, die in öffentlichen Diskursen bestimmen, was in einer Gesellschaft als wahr
    Type of Medium: Monograph available for loan
    Pages: 394 Seiten
    ISBN: 9783531932569 , 9783531173993 (print)
    Series Statement: Theorie und Praxis der Diskursforschung
    Language: German
    Note: Inhalt; Über dieses Buch; Teil I Einführungen: Theorien der Erzählungen; Erzählen. Die ethisch-politische Funktion narrativer Diskurse; 1 Narrative Diskurse: Eigenschaften und Funktionen; 1.1 Die narrative Kunst der Begründung; 1.2 Ein semantisches Modell der Erzählung: Algirdas J. Greimas' Aktantentheorie; 1.3 Narrative Begründungen: Eine semantische Typologie; 1.4 Die Schuld und die Vergebung: Zum Verantwortungsmanagement narrativer Diskurse; 1.5 In medias res: Warum Erzählungen oft mit dem Ende beginnen; 1.6 Die doppelte Referenz: Das Allgemeine und das Einzigartige. , 2 Die Erzähler und ihr Publikum: Zur Öffentlichkeit narrativer Diskurse2.1 Öffentliche Urteile: Die Erzähler und ihr Publikum; 2.2 Die zwei Stimmen des Erzählers; 2.3 Die Präsenz des Erzählers in der Erzählung; 2.4 Die Öffentlichkeiten des Erzählers; 2.5 Autobiografisches Erzählen: Der innere Dialog und das Denken; 2.6 Ausblick: Die Öffentlichkeitsregime narrativer Diskurse; Literatur; »Menschen lesbarer machen«1: Narration, Diskurs,Referenz; 1 Narrationen als sozialwissenschaftliches Konzept; 1.1 Erzählungen zwischen Text und Handlung; 1.2 Typen der Erzählung. , 1.3 Zur lebensweltlichen Einbettung von Narrativen2 Zum Verhältnis von Narration und Diskurs; 2.1 Brauchen Diskurse Erzählungen?; 2.2 Narrationen als Sprech-Handlungen (über Satzniveau); 3 Erzählungen: Strukturen, Ereignisse und dieKomposition der Fabel; 3.1 Narration und Fabelkomposition; 3.2 Ebenen der Erzählung; 3.3 Kollektiv-Symbole und ihre Erzählungen; 3.4 Narrative und ihre Bedeutung für die kulturelle Reproduktion und Innovation; 4 Referenz und Erzählung: Jenseits der Innenwelt von Texten; 4.1 Öffentliche Erzählungen als Mimesis von Handlungen?. , 5 ConclusioLiteratur; Öffentliche Erzählungen und der globale Wandel des Klimas; 1 Einleitung; 2 Der Mensch als Klimageschichtenerzähler; 2.1 Was heißt Narrativisierung des Klimas?; 2.2 Narrationen als Geburtshelfer möglicher Welten; 2.3 Klimageschichten sind lebende Geschichten; 3 Globaler Klimawandel: Geburt eines Konzepts; 4 Sechs Varianten der Narrativisierung des globalenKlimawandels; 4.1 Das »globale Treibhaus« als anthropogene Katastrophe; 4.2 Anthropogene Eiszeiten: die Katastrophe des; 4.3 Die Geschichte vom »nuklearen Winter«; 4.4 »Paradiesische Warmzeiten«. , 4.5 Die ewige Wiederkehr der »Sonnenflecken«: Normalität statt Katastrophe. , 4.2 Die Konfiguration von Charakteren in öffentlichen Erzählungen4.3 Re-figuration und die Rolle des Lesers; Teil II Erzählungen in den Medien; Kollektivsymbolik und die deutsche Krise seit dem Jahr 2000; Heimat, Natur und die gute alte Zeit. Erzählungenüber Nachhaltige Entwicklung im Spannungsfeldöffentlicher und wissenschaftlicher Diskurse1; 1 Einleitung; 2 Wissenschaftliche Diskurse über Nachhaltige Entwicklung; 3 Nachhaltige Ernährung und Ernährungskommunikation; 4 Erzählungen über Ernährung in den Medien; 4.1 Polarisierende Rhetorik; 4.2 Affirmative Rhetorik; 4.3 Reflektierende Rhetorik.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 39
    Monograph available for loan
    Monograph available for loan
    University Park, Pa : Pennsylvania State University Press
    Call number: IASS 16.90520
    Description / Table of Contents: "An interdisciplinary study of democratic theory, empirical political science, psychology, and philosophy. Proposes a multidimensional process model of empathy that incorporates both affective and cognitive features to demonstrate the importance of empathy in fulfilling democracy's promise of giving equal consideration to all citizens in collective decisions"--Provided by publisher
    Type of Medium: Monograph available for loan
    Pages: viii, 221 S. , graph. Darst.
    ISBN: 9780271036595 (cloth) , 9780271036601 (pbk)
    Language: English
    Note: The democratic promiseThe deliberative turn in democratic theory -- The elusive concept of empathy -- Empathy in deliberative theory -- Empathy's importance : the empirical evidence -- Deliberative democracy and its critics -- Empathy and democracy..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
    Monograph available for loan
    Monograph available for loan
    Princeton and Oxford : Princeton University Press,
    Call number: M 17.90645
    Description / Table of Contents: Cover; Title; Copyright; Contents; List of Illustrations; Preface; PART ONE: What Has Controlled Earth's Climate?; CHAPTER ONE: Climate and Human History; PART TWO: Nature in Control; CHAPTER TWO: Slow Going for a Few Million Years; CHAPTER THREE: Linking Earth's Orbit to Its Climate; CHAPTER FOUR: Orbital Changes Control Ice-Age Cycles; CHAPTER FIVE: Orbital Changes Control Monsoon Cycles; CHAPTER SIX: Stirrings of Change; PART THREE: Humans Begin to Take Control; CHAPTER SEVEN: Early Agriculture and Civilization; CHAPTER EIGHT: Taking Control of Methane
    Description / Table of Contents: CHAPTER NINE: Taking Control of CO[sub(2)]CHAPTER TEN: Have We Delayed a Glaciation?; CHAPTER ELEVEN: Challenges and Responses; PART FOUR: Disease Enters the Picture; CHAPTER TWELVE: But What about Those CO[sub(2)] "Wiggles"?; CHAPTER THIRTEEN: The Horsemen of the Apocalypse: Which One?; CHAPTER FOURTEEN: Pandemics, CO[sub(2)], and Climate; PART FIVE: Humans in Control; CHAPTER FIFTEEN: Greenhouse Warming: Tortoise and Hare; CHAPTER SIXTEEN: Future Warming: Large or Small?; CHAPTER SEVENTEEN: From the Past into the Distant Future; EPILOGUE; CHAPTER EIGHTEEN: Global-Change Science and Politics
    Description / Table of Contents: CHAPTER NINETEEN: Consuming Earth's GiftsAfterword to the Princeton Science Library Edition; Bibliography; Figure Sources; Index; A; B; C; D; E; F; G; H; I; K; L; M; N; O; P; R; S; T; U; V; W; Y
    Description / Table of Contents: The impact on climate from 200 years of industrial development is an everyday fact of life, but did humankind''s active involvement in climate change really begin with the industrial revolution, as commonly believed? Plows, Plagues, and Petroleum has sparked lively scientific debate since it was first published--arguing that humans have actually been changing the climate for some 8,000 years--as a result of the earlier discovery of agriculture. The ""Ruddiman Hypothesis"" will spark intense debate. We learn that the impact of farming on greenhouse-gas levels, thousands of years before the i
    Type of Medium: Monograph available for loan
    Pages: xiv, 226 Seiten , Illustrationen
    Edition: New Princeton Science Library edition
    ISBN: 9780691173214
    Series Statement: Princeton Science Library
    Classification:
    Meteorology and Climatology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 41
    Monograph available for loan
    Monograph available for loan
    Dordrecht : Springer Netherlands
    Call number: M 17.90938
    Description / Table of Contents: Over the last 30 years, Dr. Nikita V. Chukanov has collected IR spectra of about 2000 mineral species, including 247 holotype samples. In this book, he presents 3309 spectra of these minerals with detailed  description and analytical data for reference samples. In the course of this work, about 150 new mineral species have been discovered. This book presents spectra of each mineral together with a description and comments on standard samples used (occurrence, appearance, associated minerals, empirical formula etc.). Sections are organized according to different classes of compounds (silicates, phosphates, arsenates, oxides etc.)
    Type of Medium: Monograph available for loan
    Pages: IX, 1726 p. 3547 illus., 1 illus. in color
    Edition: Online edition Springer eBook Collection. Earth and Environmental Science
    ISBN: 9789400771284 , 9789400771277 (print)
    Series Statement: Springer Geochemistry / Mineralogy
    Parallel Title: Print version Infrared spectra of mineral species : Extended library
    Language: English
    Note: The Application of IR Spectroscopy to the Investigation of MineralsThe Discrete Approach -- The Full-Profile Analysis -- Polymerization of coordination polyhedra and structure topology -- Hydrogen-bearing groups and hydrogen bonding -- Solid-solution series -- Force parameters of cations in silicates -- IR spectra of minerals and reference samples data -- Borates, including sulfato-borates and arsenato-borates -- Carbides and carbonates -- Organic compounds and salts of organic acids -- Ammino-complexes, nitrates and sulfato-nitrates -- Oxides and hydroxides -- Fluorides -- Silicates -- Phosphates -- Sulfates, carbonato-sulfates, phosphato-sulfates and sulfides -- Chlorides -- Vanadates and vanadium oxides -- Chromates -- Arsenates, arsenites and sulfato-arsenates -- Selenites, molybdates, tellurites, tellurates, iodites, wolframates and wolfram oxides..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    facet.materialart.12
    Wiesbaden, Germany : Springer Gabler
    Call number: 9783658065287 (e-book)
    Description / Table of Contents: Die zügige und ganzheitliche Einarbeitung und Integration eines neuen Mitarbeiters (Onboarding) ist ein zentraler Prozess, um die Leistungsfähigkeit einer Organisation dauerhaft sicherstellen zu können. Diese Investitionsleistung zahlt sich mehrfach aus, denn nur auf dieser Grundlage wird der neue Mitarbeiter seine volle Leistungsfähigkeit und Leistungsbereitschaft zum Nutzen der Organisation entwickeln. Dieses Essential bietet konkrete Hilfestellungen, um den Onboarding-Prozess für alle Beteiligten - den neuen Mitarbeiter, die Führungskraft und den HR Bereich - erfolgreich gestalten zu können.
    Type of Medium: 12
    Pages: 1 online resource (39 pages)
    ISBN: 9783658065287 (e-book)
    ISSN: 2197-6716
    Series Statement: Essentials
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
    Call number: ISO 50001
    Type of Medium: Non-book medium
    Pages: Online Ressource
    Series Statement: ISO 50001:2011
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 44
    Monograph available for loan
    Monograph available for loan
    Paris : OECD
    Call number: PIK P 113-10-0202
    Description / Table of Contents: This joint IEA/NEA report on electricity generating costs presents the latest data available for a wide variety of fuels and technologies, including coal and gas (with and without carbon capture), nuclear, hydro, onshore and offshore wind, biomass, solar, wave and tidal as well as combined heat and power (CHP).  It provides levelised costs of electricity (LCOE) per MWh for almost 200 plants, based on data covering 21 countries (including four major non-OECD countries), and several industrial companies and organisations.  For the first time, the report contains an extensive sensitivit
    Type of Medium: Monograph available for loan
    Pages: 215 S. : graph. Darst.
    ISBN: 9789264084308
    Language: English
    Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
    facet.materialart.12
    facet.materialart.12
    Berlin : De Gruyter Saur
    Call number: 9783110269550 (e-book)
    Description / Table of Contents: Das Buch bietet umfassende Hilfestellung für die verschiedensten Kommunikationssituationen zwischen Mitarbeitern und Kunden einer Bibliothek: Erstgespräch, Auskunftsinterview, Schulungs- und Konfliktsituationen, Beschwerden sowie Kundenorientierung. Jedes Kapitel beginnt mit einem konkreten Beispiel, an dem die Problematik der Situation analysiert wird. Zahlreiche Übungsaufgaben dienen dem Selbststudium. Tipps, Formulierungshilfen, Leitsätze und ein Gesprächsleitfaden machen das Buch zu einem einzigartigen Praxisratgeber für den bibliothekarischen Alltag. (Verlagstext)
    Type of Medium: 12
    Pages: 1 Online-Ressource (VII, 155 Seiten) , Illustrationen
    Edition: Electronic reproduction. Ann Arbor, MI : ProQuest, 2015. Available via World Wide Web. Access may be limited to ProQuest affiliated libraries.
    Series Statement: Praxiswissen
    Language: German
    Note: Inhalt 1 Einleitung 2 Der erste Eindruck - Das Anmeldegespräch 2.1 Ein Beispiel 2.2 Die Raumsituation 2.3 Die Kommunikationssituation mit Kunden 2.3.1 Gast und Gastgeber 2.3.2 Wir kommunizieren ständig 2.3.3 Wie wirke ich auf andere? 2.3.4 Beziehungs- und Sachaspekt der Kommunikation 2.3.5 Rolleneinnahme und Gesamthaltung der Bibliothek 2.4 Die Gesprächssituation 2.4.1 Augenhöhe und Respekt 2.4.2 Einstellen auf verschiedene Gesprächspartner 2.4.3 Der Gesprächsverlauf 2.4.4 Verständlichkeit und Anschaulichkeit 2.4.5 Schwierige Situationen im Anmeldegespräch 2.5 Vertiefung 3 Professionell beraten - Das Auskunftsgespräch 3.1 Ein Beispiel 3.2 Verantwortung im Gespräch übernehmen - Rollenklarheit 3.3 Reden wir über das Gleiche? 3.4 Durch die Phasen des Gesprächs steuern 3.4.1 Kontakt aufnehmen 3.4.2 Die Ausgangsfrage stellen 3.4.3 Nachfragen 3.4.4 Absichern 3.4.5 Lösungen entwickeln und anbieten 3.4.6 Vereinbarung treffen 3.4.7 Verabschieden 3.5 Die richtigen Fragen stellen 3.6 Störungen in der Auskunftssituation und die Etablierung von Standards 3.7 Tipps im Auskunftsgespräch 3.8 Vertiefung 4 Schulungen und Führungen entwickeln 4.1 Ein Beispiel 4.2 Lerntheoretische Hintergründe 4.2.1 Das Gedächtnis: Wie merken wir uns etwas? 4.2.2 Lerntypen: Wer lernt wie? 4.2.3 Lernpyramide: Mit welchen Lernmethoden lernen wir am effektivsten? 4.2.4 Die Hirnforschung: Wie lernt unser Gehirn am besten? 4.3 Modelle der Didaktik 4.3.1 Instruktionsorientierte Didaktik 4.3.2 Kompetenzorientierte Didaktik 4.4 Die Rolle der Lehrenden 4.5 Auftragsklärung 4.6 Die Konzeptentwicklung in sechs Schritten 4.6.1 Mit der Zielgruppe beschäftigen 4.6.2 Lernziele entwickeln 4.6.3 Themen sammeln und sortieren 4.6.4 Methodik festlegen 4.6.5 Lernkreislauf entwickeln 4.6.6 Dramaturgie und Zeitplan festlegen 4.7 Methodenpool 4.8 Schwierige Situationen in Schulungen 4.9 Wir lernen weiter: Eine Methode für das Schulungsteam 4.10 Vertiefung 5 Schwierige Situationen mit Kunden bewältigen 5.1 Ein Beispiel 5.2 Der Hintergrund 5.2.1 Ebenen der Kommunikation 5.2.2 Vier Reaktionsmöglichkeiten 5.2.3 Der Teufelskreis in der Kommunikation 5.3 Was lässt manche Menschen schwierig werden? 5.3.1 Ein Beispiel 5.3.2 Menschliche Bedürfnisse und Aggressionen 5.3.3 Wie wir den Konflikt betrachten - verschiedene Konfliktebenen 5.4 Das Dilemma der guten Mitarbeiterin 5.5 Die Entschärfung der Situation 5.6 Formulierungstipps - kleines Glossar der hilfreichen Worte 5.7 Kommunikative Basics für schwierige Situationen 5.7.1 So tun als ob 5.7.2 Distanz wahren 5.7.3 Die Flucht nach vornantreten 5.7.4 Verlierer und Schein-Sieger 5.7.5 Eigene Irrtümer vermeiden 5.8 Fallbeispiele 5.8.1 Typologie nach Fritz Riemann 5.8.2 Fünf Fälle und Handlungsmöglichkeiten 5.9 Deeskalationsstrategien - wenn es ganz schwierig wird 5.10 Vertiefung 6 Beschwerdemanagement in Bibliotheken 6.1 Ein Beispiel 6.2 Was ist Beschwerdemanagement? 6.3 Die Komponenten eines Beschwerdemanagement-Systems 6.3.1 Beschwerdestimulierung 6.3.2 Beschwerdekanäle 6.3.3 Beschwerdeannahme 6.3.4 Beschwerdebearbeitung 6.3.5 Beschwerdereaktion 6.3.6 Beschwerdeauswertung 6.3.7 Beschwerdereporting (öffentlich) 6.4 Die Kommunikationssituation der Beschwerde 6.4.1 Worüber beschweren sich Kunden der Bibliothek? 6.4.2 Beschwerdeschreiben verstehen und beantworten 6.4.3 Unzufriedenheit und Schweregrad der Beschwerde 6.4.4 Die Entschärfung der Situation 6.4.5 Ein Gesprächsleitfaden für Beschwerdegespräche 6.4.6 Deeskalieren 6.4.7 Tipps für die Gesprächssituation 6.4.8 Mitarbeiter einbeziehen und schulen 6.5 Vertiefung 7 Kundenorientierung in der Bibliothek 7.1 Ein Beispiel 7.2 Was heißt Kundenorientierung in der Bibliothek? 7.3 Vom Nutzer zum Kunden 7.4 Von der Produkt- zur Kundenorientierung 7.5 Ein Gesamtkonzept zur Einführung von Kundenorientierung 7.6 Eins greift ins andere - Kundenzentrierung und Mitarbeiterorientierung 7.7 Gemeinsame Verhaltensstandards einführen 7.7.1 Was sind Leistungsstandards 7.7.2 Kontaktsituationen mit Kunden und mögliche Verhaltensstandards 7.8 Damit alle an einem Strang ziehen 7.9 Vertiefung 8 Sicher und gewandt auftreten 8.1 Ein Beispiel 8.2 Die eigene Einstellung 8.2.1 Persönliche Denkmuster 8.2.2 Innere Dialoge 8.3 Woran wir arbeiten können - das rhetorische Handwerkszeug 8.4 Sicheres Auftreten braucht Übung 8.5 Erklären und überzeugen 8.6 Anschaulich und lebendig sprechen 8.7 Präsenz zeigen 8.8 Stimmlich überzeugen 8.9 Lampenfieber - die Spannung nutzen 8.10 Vertiefung Literatur und Internet-Links Sachregister Über die Autorin
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 46
    Journal available for loan
    Journal available for loan
    Tübingen : Mohr Siebeck ; 1.1884 - 48.1931; N.F. 1.1932/33 - 10.1943/44(1945),3; 11.1948/49(1949) -
    Call number: ZS 22.95039
    Type of Medium: Journal available for loan
    Pages: Online-Ressource
    ISSN: 1614-0974 , 0015-2218 , 0015-2218
    Language: German , English
    Note: N.F. entfällt ab 57.2000. - Volltext auch als Teil einer Datenbank verfügbar , Ersch. ab 2000 in engl. Sprache mit dt. Hauptsacht.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 47
    Call number: 9783034803960 (e-book)
    Type of Medium: 12
    Pages: 1 Online-Ressource (XI, 220 Seiten) , Illustrationen
    ISBN: 9783034803960 (e-book) , 978-3-0348-0396-0
    Language: English
    Note: Contents 1 High elevation treelines 1.1 The task 1.2 Previous works 2 Definitions and conventions 2.1 The life form ‘tree’ 2.2 Lines and transitions 2.3 Limitation, stress and disturbance 2.4 Altitude-related and other environmental drivers 2.5 Treeline nomenclature 3 Treeline patterns 3.1 Treeline taxa 3.2 The summit syndrome and other treeline depressions 3.3 Mass elevation effect 3.4 Treeline elevation 3.5 Time matters 3.6 Forest structure near treeline 4 Treeline climate 4.1 Specific aspects of treeline climatology 4.2 Criteria to define temperature regimes at treeline 4.3 Treeline temperatures in different bioclimatic regions 4.3.1 Subarctic and boreal zone (45–68° N) 4.3.2 Cool temperate zone (45–47° N, 44° S) 4.3.3 Warm temperate zone (28–42° N, 36° S) 4.3.4 Subtropical zone (19° S, 19° N) 4.3.5 Equatorial tropics (6° N to 3° S) 4.3.6 Mediterranean ‘treelines’ (38–42° N) 4.3.7 The Nothofagus and Metrosideros case 4.3.8 Treeline temperatures across bioclimatic zones 4.4 Seedbed and branch temperatures 4.5 Whole forest temperatures 5 Global mountain statistics based on treeline elevation 5.1 Mountain geostatistics 5.2 Elevational belts 5.3 Global treeline ecotones 6 Structure and stature of treeline trees 6.1 Foliage properties 6.2 Wood properties 6.3 Bark properties 6.4 Root traits 6.5 Tree stature 6.6 Dry matter allocation in treeline trees 7 Growth and development 7.1 Tree growth near the treeline 7.1.1 In situ growth of seedlings 7.1.2 In situ growth of saplings and adult trees 7.2 Xylogenesis at the treeline 7.2.1 In situ cambial activity 7.2.2 Apical growth dynamics 7.3 Root growth 7.4 Phenology at the treeline 8 Evolutionary adjustments to life at the treeline 8.1 Phylogenetic selection 8.2 Genotypic responses of growth and development 8.3 Genotypic responses of physiological traits 9 Reproduction, early life stages and tree demography 9.1 Amount and quality of seeds at high elevation 9.2 Germination, seedling and sapling stage 9.3 Tree demography at the treeline 10 Freezing and other forms of stress 10.1 Stress at the treeline in a fitness context 10.2 Mechanisms and principles of freezing resistance 10.3 Freezing resistance in treeline trees 10.4 Other forms of stress at the treeline 10.4.1 Freeze-thaw cycles and hydraulic failure 10.4.2 Winter desiccation 11 Water, nutrient and carbon relations 11.1 Tree water relations during the growing season 11.2 Nutrient relations 11.3 Carbon relations 12 Treeline formation - currently, in the past and in the future 12.1 Causes of current treelines 12.2 Treelines in the recent past 12.3 Treelines in the distant past (Holocene) 12.4 Treelines in the future References Subject Index Taxonomic Index
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    facet.materialart.12
    Chichester, [England] : Wiley
    Call number: 9781444328479 (e-book)
    Type of Medium: 12
    Pages: 1 Online-Ressource (XIII, 768 Seiten) , Illustrationen
    Edition: Second edition
    ISBN: 9781444328479 (e-book) , 978-1-4443-2847-9
    Language: English
    Note: Contents Contents Preface Acknowledgements Part 1: Making Sediment Introduction Clastic sediment as a chemical and physical breakdown product 1.1 Introduction: clastic sediments—'accidents' of weathering 1.2 Silicate minerals and chemical weathering 1.3 Solute flux: rates and mechanisms of silicate chemical weathering 1.4 Physical weathering 1.5 Soils as valves and filters for the natural landscape 1.6 Links between soil age, chemical weathering and weathered-rock removal 1.7 Provenance: siliciclastic sediment-sourcing Further reading 2 Carbonate, siliceous, iron-rich and evaporite sediments 2.1 Marine vs. freshwater chemical composition and fluxes 2.2 The calcium carbonate system in the oceans 2.3 Ooid carbonate grains 2.4 Carbonate grains from marine plants and animals 2.5 Carbonate muds, oozes and chalks 2.6 Other carbonate grains of biological origins 2.7 Organic productivity, sea-level and atmospheric controls of biogenic CaCO3 deposition rates 2.8 CaCO3 dissolution in the deep ocean and the oceanic CaCO3 compensation mechanism 2.9 The carbonate system on land 2.10 Evaporite salts and their inorganic precipitation as sediment 2.11 Silica and pelagic plankton 2.12 Iron minerals and biomineralizers 2.13 Desert varnish 2.14 Phosphates 2.15 Primary microbial-induced sediments: algal mats and stromatolites Further reading 3 Sediment grain properties 3.1 General 3.2 Grain size 3.3 Grain-size distributions 3.4 Grain shape and form 3.5 Bulk properties of grain aggregates Further reading Part 2: Moving Fluid Introduction 4 Fluid basics 4.1 Material properties of fluids 4.2 Fluid kinematics 4.3 Fluid continuity with constant density 4.4 Fluid dynamics 4.5 Energy, mechanical work and power Further reading 5 Types of fluid motion 5.1 Osborne Reynolds and flow types 5.2 The distribution of velocity in viscous flows: the boundary layer 5.3 Turbulent flows 5.4 The structure of turbulent shear flows 5.5 Shear flow instabilities, flow separation and secondary currents 5.6 Subcritical and supercritical flows: the Froude number and hydraulic jumps 5.7 Stratified flow generally 5.8 Water waves 5.9 Tidal flow—long-period waves Further reading Part 3: Transporting Sediment Introduction 6 Sediment in fluid and fluid flow—general 6.1 Fall of grains through stationary fluids 6.2 Natural flows carrying particulate material are complex 6.3 Fluids as transporting machines 6.4 Initiation of grain motion 6.5 Paths of grain motion 6.6 Categories of transported sediment 6.7 Some contrasts between wind and water flows 6.8 Cohesive sediment transport and erosion 6.9 A warning: nonequilibrium effects dominate natural sediment transport systems 6.10 Steady state, deposition or erosion: the sediment continuity equation and competence vs. capacity Further reading 7 Bedforms and sedimentary structures in flows and under waves 7.1 Trinity of interaction: turbulent flow, sediment transport and bedform development 7.2 Water-flow bedforms 7.3 Bedform phase diagrams for water flows 7.4 Water flow erosional bedforms on cohesive beds 7.5 Water wave bedforms 7.6 Combined flows: wave-current ripples and hummocky cross-stratification 7.7 Bedforms and structures formed by atmospheric flows Further reading 8 Sediment gravity flows and their deposits 8.1 Introduction 8.2 Granular flows 8.3 Debris flows 8.4 Turbidity flows 8.5 Turbidite evidence for downslope transformation from turbidity to debris flows Further reading 9 Liquefaction, fluidization and sliding sediment deformation 9.1 Liquefaction 9.2 Sedimentary structures formed by and during liquefaction 9.3 Submarine landslides, growth faults and slumps 9.4 Desiccation and synaeresis shrinkage structures Further reading Part 4: Major External Controls on Sedimentation and Sedimentary Environments Introduction 10 Major external controls on sedimentation 10.1 Climate 10.2 Global climates: a summary 10.3 Sea-level changes 10.4 Tectonics 10.5 Sediment yield, denudation rate and the sedimentary record Further reading Part 5: Continental Sedimentary Environments Introduction 11 Rivers 11.1 Introduction 11.2 River networks, hydrographs,patterns and long profiles 11.3 Channel form 11.4 Channel sediment transport processes, bedforms and internal structures 11.5 The floodplain 11.6 Channel belts, alluvial ridges and avulsion 11.7 River channel changes, adjustable variables and equilibrium 11.8 Alluvial architecture: product of complex responses 11.9 Alluvial architecture: scale, controls and time Further reading 12 Subaerial Fans: Alluvial and Colluvial 12.1 Introduction 12.2 Controls on the size (area) and gradient of fans 12.3 Physical processes on alluvial fans 12.4 Debris-flow-dominated alluvial fans 12.5 Stream-flow-dominated alluvial fans 12.6 Recognition of ancient alluvial fans and talus cones Further reading 13 Aeolian Sediments in Low-Latitude Deserts 13.1 Introduction 13.2 Aeolian system state 13.3 Physical processes and erg formation 13.4 Erg margins and interbedform areas 13.5 Erg and draa evolution and sedimentary architecture 13.6 Erg construction, stasis and destruction: climate and sea-level controls 13.7 Ancient desert facies Further reading 14 Lakes 14.1 Introduction 14.2 Lake stratification 14.3 Clastic input by rivers and the effect of turbidity currents 14.4 Wind-forced physical processes 14.5 Temperate lake chemical processes and cycles 14.6 Saline lake chemical processes and cycles 14.7 Biological processes and cycles 14.8 Modern temperate lakes and their sedimentary facies 14.9 Lakes in the East African rifts 14.10 Lake Baikal 14.11 The succession of facies as lakes evolve 14.12 Ancient lake facies Further reading 15 Ice 15.1 Introduction 15.2 Physical processes of ice flow 15.3 Glacier flow, basal lubrication and surges 15.4 Sediment transport, erosion and deposition by flowing ice 15.5 Glacigenic sediment: nomenclature and classification 15.6 Quaternary and modern glacial environments and facies 15.7 Ice-produced glacigenic erosion and depositional facies on land and in the periglacial realm 15.8 Glaciofluvial processes on land at and within the ice-front 15.9 Glacimarine environments 15.10 Glacilacustrine environments 15.11 Glacial facies in the pre-Quaternary geological record: case of Cenozoic Antarctica Further reading Part 6: Marine Sedimentary Environments Introduction 16. Estuaries 16.1 Introduction 16.2 Estuarine dynamics 16.3 Modern estuarine morphology and sedimentary environments 16.4 Estuaries and sequence stratigraphy Further reading 17. River and Fan Deltas 17.1 Introduction to river deltas 17.2 Basic physical processes and sedimentation at the river delta front 17.3 Mass movements and slope failure on the subaqueous delta 17.4 Organic deposition in river deltas 17.5 River delta case histories 17.6 River deltas and sea-level change 17.7 Ancient river delta deposits 17.8 Fan deltas Further reading 18. Linear Siliciclastic Shorelines 18.1 Introduction 18.2 Beach processes and sedimentation 18.3 Barrier-inlet-spit systems and their deposits 18.4 Tidal flats, salt marsh and chenier ridges 18.5 Ancient clastic shoreline facies Further reading 19 Siliciclastic Shelves 19.1 Introduction: shelf sinks and lowstand bypass 19.2 Shelf water dynamics 19.3 Holocene highstand shelf sediments: general 19.4 Tide-dominated, low river input, highstand shelves 19.5 Tide-dominated, high river input, highstand shelves 19.6 Weather-dominated highstand shelves Further reading 20 Calcium-carbonate-evaporite Shorelines, Shelves and Basins 20.1 Introduction: calcium carbonate 'nurseries' and their consequences 20.2 Arid carbonate tidal flats, lagoons and evaporite sabkhas 20.3 Humid carbonate tidal flats and marshes 20.4 Lagoons and bays 20.5 Tidal delta and margin-spillover carbonate tidal sands 20.6 Open-shelf carbonate ramps 20.7 Platform margin reefs and carbonate build-ups 20.8 Platform margin slopes and basins 20.9 Carbonate sediments, cycles and sea-level change 20.10 Displacement and destruction of carbonate environments: silicicl
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    Call number: 9781629487991 (e-book)
    Description / Table of Contents: This book described the current status and possible future changes of the thermokarst (thaw) lakes of western Siberia as dominant forms of landscape and regulators of greenhouse gas exchange within the atmosphere. Thawing permafrost and resulting microbial decomposition of previously frozen organic carbon is one of the most significant terrestrial ecosystem positive feedbacks to a warming climate. Ongoing processes of the permafrost thawing in Western Siberia are likely to increase the surface of water bodies via forming so-called thermokarst lakes, mobilizing the organic carbon (OC) from the soil pool to the rivers and, finally, to the ocean, and thus modifying the fluxes of methane (CH4) and CO2 to the atmosphere. Despite their tremendous importance for green house gazes regulation and hydrological regime control, very little is known about hydrochemistry of western Siberia thaw lakes. This book assesses the variation of major and trace elements (TE) and organic carbon (OC) concentration along the chronosequence of lake development and the latitude profile of variable permafrost abundance; characterizes the colloidal status of TE and distinguishes between the relative proportion of organic and organo-mineral colloids; describes the particularity of microbiological composition of thermokarst lake waters and production/mineralization processes in the water column; and presents the perspective of water chemical composition evolution under the climate change scenario. Each of these aforementioned objectives present a scientific challenge given mainly the paucity of existing information on these important but still very poorly studied ecosystems. Taken together, understanding of these issues and identification and quantification of controlling environmental parameters should produce conceptually new knowledge of biogeochemical processes operating within the Western Siberia Plain with the possibility of extrapolation of generated knowledge to much larger territories of arctic and subarctic permafrost-affected areas. (Imprint: Nova)
    Type of Medium: 12
    Pages: 1 Online-Ressource (179 Seiten) , Illustrationen
    ISBN: 9781629487991 (e-book)
    Series Statement: Biochemistry research trends
    Language: English
    Note: Table of Contents Introduction: Thermokarst Lakes of Western Siberia as Dominant Forms of Landscape and Regulators of Greenhouse Gas Exchange with the Atmosphere Chapter 1. Thermokarst Lakes: Distribution, Cycle of Development, Surface Coverage and Evolution Chapter 2. Sources of Dissolved Components in Thermokarst Lakes Chapter 3. Temperature and Gas Regime Chapter 4. Dissolved Organic Carbon Chapter 5. Microbiology of Thermokarst Lake Systems Chapter 6. Trace Elements in Thermokarst Lakes Chapter 7. Colloids in Thermokarst Lakes Chapter 8. Latitude Profile Gradients of Lakes: Substituting Space for Time Chapter 9. Possible Impact of Climate Warming on Stocks and Fluxes of Carbon and Related Elements in Western Siberian Lakes Conclusions: Thaw Lakes as Indicators of Climate Change References Index
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    facet.materialart.12
    facet.materialart.12
    Bremerhaven : Alfred-Wegener-Inst. für Polar- und Meeresforschung
    Associated volumes
    Call number: ZSP-168-631
    In: Berichte zur Polar- und Meeresforschung
    Description / Table of Contents: ANT-XXVI/4: 7 April -17 May 2010 Punta Arenas -Mindelo - Las Palmas - Bremerhaven
    Type of Medium: 12
    Pages: Online-Ressource
    Series Statement: Berichte zur Polar- und Meeresforschung 631
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
    Call number: M 20.94085
    Type of Medium: Monograph available for loan
    Pages: v, 146 Seiten , Graphiken
    Language: English
    Note: Dissertation
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 52
    Call number: 9781630810504 (e-book)
    Type of Medium: 12
    Pages: 1 Online-Ressource (1.014 Seiten) , Illustrationen
    ISBN: 9781630810504 (e-book)
    Language: English
    Note: CONTENTS Preface Photo Credits Computer Codes 1 Introduction 1-1 Why Microwaves for Remote Sensing? 1-2 A Brief Overview of Microwave Sensors 1-3 A Short History of Microwave Remote Sensing 1-3.1 Radar 1-3.2 Radiometers 1-4 The Electromagnetic Spectrum 1-5 Basic Operation and Applications of Radar 1-5.1 Operation of Remote-Sensing Radars 1-5.2 Applications of Remote-Sensing Radars 1-6 Basic Operation and Applications of Radiometers 1-6.1 Radiometer Operation 1-6.2 Applications of Microwave Radiometry 1-7 Image Examples 2 Electromagnetic Wave Propagation 2-1 EM Plane Waves 2-1.1 Constitutive Parameters 2-1.2 Maxwell's Equations 2-1.3 Complex Permittivity 2-1.4 Wave Equations 2-2 Plane-Wave Propagation in Lossless Media 2-2.1 Uniform Plane Waves 2-2.2 General Relation between E and H 2-3 Wave Polarization in a Lossless Medium 2-3.1 Linear Polarization 2-3.2 Circular Polarization 2-3.3 Elliptical Polarization 2-4 Plane Wave Propagation in Lossy Media 2-4.1 Low Loss Dielectric 2-4.2 Good Conductor 2-5 Electromagnetic Power Density 2-5.1 Plane Wave in a Lossless Medium 2-5.2 Plane Wave in a Lossy Medium 2-5.3 Decibel Scale tor Power Ratios 2-6 Wave Reflection and Transmission at Normal Incidence 2-6.1 Boundary between Lossless Media 2-6.2 Boundary between Lossy Media 2-7 Wave Reflection and Transmission at Oblique Incidence 2-7.1 Horizontal Polarization—Lossless Media 2-7.2 Vertical Polarization 2-8 Reflectivity and Transmissivity 2-9 Oblique Incidence onto a Lossy Medium 2- 10 Oblique Incidence onto a Two-Layer Composite 2-10.1 Input Parameters 2-10.2 Propagation Matrix Method 2-10.3 Multiple Reflection Method 3 Remote-Sensing Antennas 3-1 The Hertzian Dipole 3-2 Antenna Radiation Characteristics 3-2.1 Antenna Pattern 3-2.2 Beam Dimensions 3-2.3 Antenna Directivity 3-2.4 Antenna Gain 3-2.5 Radiation Efficiency 3-2.6 Effective Area of a Receiving Antenna 3-3 Friis Transmission Formula 3-4 Radiation by Large-Aperture Antennas 3-5 Rectangular Aperture with Uniform Field Distribution 3-5.1 Antenna Pattern in x-y Plane 3-5.2 Beamwidth 3-5.3 Directivity and Effective Area 3-6 Circular Aperture with Uniform Field Illumination 3-7 Nonuniform-Amplitude Illumination 3-8 Beam Efficiency 3-9 Antenna Arrays 3-10 N-Element Array with Uniform Phase Distribution 3-10.1 Uniform Amplitude Distribution 3-10.2 Grating Lobes 3-10.3 Binomial Distribution 3-11 Electronic Scanning of Arrays 3-12 Antenna Types 3-12.1 Horn Antennas 3-12.2 Slot Antennas 3-12.3 Microstrip Antennas 3-13 Active Antennas 3-13.1 Advantages of Active Antennas 3-13.2 Digital Beamforming with Active Antennas 4 Microwave Dielectric Properties of Natural Earth Materials 4-1 Pure-Water Single-Debye Dielectric Model (f 〈 50 GHz) 4-2 Saline-Water Double-Debye Dielectric Model (f〈 1000 GHz) 4-3 Dielectric Constant of Pure Ice 4-4 Dielectric Mixing Models for Heterogeneous Materials 4-4.1 Randomly Oriented Ellipsoidal Inclusions 4-4.2 Polder-van Santen/de Loor Formulas 4-4.3 Tinga-Voss-Blossey (TVB) Formulas 4-4.4 Other Dielectric Mixing Formulas 4-5 Sea Ice 4-5.1 Dielectric Constant of Brine 4-5.2 Brine Volume Fraction 4-5.3 Dielectric Properties 4-6 Dielectric Constant of Snow 4-6.1 Dry Snow 4-6.2 Wet Snow 4-7 Dielectric Constant of Dry Rocks 4-7.1 Powdered Rocks 4-7.2 Solid Rocks 4-8 Dielectric Constant of Soils 4-8.1 Dry Soil 4-8.2 Wet Soil 4-8.3 εsoil in 0.3-1.5 GHz Band 4-9 Dielectric Constant of Vegetation 4-9.1 Dielectric Constant of Canopy Constituents 4-9.2 Dielectric Model 5 Radar Scattering 5-1 Wave Polarization in a Spherical Coordinate System 5-2 Scattering Coordinate Systems 5-2.1 Forward Scattering Alignment (FSA) Convention 5-2.2 Backscatter Alignment (BSA) Convention 5-3 Scattering Matrix 5-3.1 FSA Convention 5-3.2 BSA Convention 5-3.3 Stokes Parameters and Mueller Matrix 5-4 Radar Equation 5-5 Scattering from Distributed Targets 5-5.1 Narrow-Beam Scatterometer 5-5.2 Imaging Radar 5-5.3 Specific Intensities for Distributed Target 5-6 RCS Statistics 5-7 Rayleigh Fading Model 5-7.1 Underlying Assumptions 5-7.2 Linear Detection 5-7.3 Square-Law Detection 5-7.4 Interpretation 5-8 Multiple Independent Samples 5-8.1 N-Look Amplitude Image 5-8.2 N-Look Intensity Image 5-8.3 N-Look Square-Root Intensity Image 5-8.4 Spatial Resolution vs. Radiometric Resolution 5-8.5 Applicability of the Rayleigh Fading Model 5-9 Image Texture and Despeckle Filtering . 5-9.1 Image Texture 5-9.2 Despeckling Filters 5-10 Coherent and Noncoherent Scattering 5-10.1 Surface Roughness 5-10.2 Bistatic Scattering 5-10.3 Specular Reflectivity 5-10.4 Bistatic-Scattering Coefficient 5-10.5 Backscattering Response of a Smooth Surface 5-11 Polarization Synthesis 5-11.1 RCS Polarization Response 5-11.2 Distributed Targets 5-11.3 Mueller Matrix Approach 5-12 Polarimetric Scattering Statistics 5-13 Polarimetric Analysis Tools 5-13.1 Scattering Covariance Matrix 5-13.2 Eigenvector Decomposition 5-13.3 Useful Polarimetric Parameters 5-13.4 Image Examples 5-13.5 Freeman-Durden Decomposition 6 Microwave Radiometry and Radiative Transfer 6-1 Radiometric Quantities 6-2 Thermal Radiation 6-2.1 Quantum Theory of Radiation 6-2.2 Planck's Blackbody Radiation Law 6-2.3 The Rayleigh-Jeans Law 6-3 Power-Temperature Correspondence 6-4 Radiation by Natural Materials 6-4.1 Brightness Temperature 6-4.2 Brightness Temperature Distribution 6-4.3 Antenna Temperature 6-5 Antenna Efficiency Considerations 6-5.1 Beam Efficiency 6-5.2 Radiation Efficiency 6-5.3 Radiometer Measurement Ambiguity 6-6 Theory of Radiative Transfer 6-6.1 Equation of Radiative Transfer 6-6.2 Brightness-Temperature Equation 6-6.3 Brightness Temperature of a Stratified Medium 6-6.4 Brightness Temperature of a Scatter-Free Medium 6-6.5 Upwelling and Downwelling Atmospheric Brightness Temperatures 6-7 Terrain Brightness Temperature 6-7.1 Brightness Transmission Across a Specular Boundary 6-7.2 Emission by a Specular Surface 6-7.3 Emissivity of a Rough Surface 6-7.4 Extreme Surface Conditions 6-7.5 Emissivity of a Two-Layer Composite 6-8 Downward-Looking Satellite Radiometer 6-9 Polarimetric Radiometry 6-10 Stokes Parameters and Periodic Structures 7 Microwave Radiometric Systems 7-1 Equivalent Noise Temperature 7-2 Characterization of Noise 7-2.1 Noise Figure 7-2.2 Equivalent Input Noise Temperature 7-2.3 Noise Temperature of a Cascaded System 7-2.4 Noise Temperature of a Lossy Two-Port Device 7-3 Receiver and System Noise Temperatures 7-3.1 Receiver Alone 7-3.2 Total System Including Antenna 7-4 Radiometer Operation 7-4.1 Measurement Accuracy 7-4.2 Total-Power Radiometer 7-4.3 Radiometric Resolution 7-5 Effects of Receiver Gain Variations 7-6 Dicke Radiometer 7-7 Balancing Techniques 7-7.1 Reference-Channel Control Method 7-7.2 Antenna-Channel Noise-Injection Method 7-7.3 Pulsed Noise-Injection Method 7-7.4 Gain-Modulation Method 7-8 Automatic-Gain-Control (AGC) Techniques 7-9 Noise-Adding Radiometer 7-10 Summary of Radiometer Properties 7-11 Radiometer Calibration Techniques 7-11.1 Receiver Calibration 7-11.2 Calibration Sources 7-11.3 Effects of Impedance Mismatches 7-11.4 Antenna Calibration 7-11.5 Cryoload Technique 7-11.6 Bucket Technique 7-12 Imaging Considerations 7-12.1 Scanning Configurations 7-12.2 Radiometer Uncertainty Principle 7-13 Interferometric Aperture Synthesis 7-13.1 Image Reconstruction 7-13.2 MIR Radiometric Sensitivity 7-14 Polarimetric Radiometer 7-14.1 Coherent Detection 7-14.2 Incoherent Detection 7-15 Calibration of Polarimetric Radiometers 7-15.1 Forward Model for a Fully Polarimetric Radiometer 7-15.2 Forward Model for the Polarimetric Calibration Source 7-15.3 Calibration by Inversion of the Forward Models 7-16 Digital Radiometers 8 Microwave Interaction with Atmospheric Constituents 8-1 Standard Atmosphere 8-1.1 Atmospheric Composition 8-1.2 Temperature Profile 8-1.3 Density Profile 8-1.4 Pressure Profi
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 53
    Keywords: Ubuntu
    Description / Table of Contents: Umfassender geht es nicht! Hier erfahren Sie alles, was Sie mit der Version 11.04 »Natty Narwhal« (dt. »Schicker Zahnwal«) der beliebtesten Linux-Distribution Ubuntu anstellen können. Von der Installation, der Paketverwaltung über Optimierung, Programmierung, Migration und Kernelkompilierung bis hin zur Virtualisierung und Netzwerktechnik finden Sie alle wichtigen Fragen zu Ubuntu Linux in diesem Buch beantwortet. Darüber hinaus profitieren Sie von mehr als 300 eigens gekennzeichneten Tipps und Tricks sowie von zahlreichen Praxisworkshops. Werden Sie mit diesem Buch ganz einfach zum Ubuntu-Profi! Übrigens: Auch eingefleischte Ubuntu-Nutzer werden in dieser Ausgabe zur aktuellen Version viel Neues entdecken - denn Ubuntu setzt seit »Natty Narwhal« mit der Unity-Oberfläche auf einen neuen Look.
    Pages: Online-Ressource (1118 Seiten)
    Edition: 7., akt. Aufl.
    ISBN: 9783836217651
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
    Unknown
    Basel, Boston, Berlin : Birkhäuser
    Keywords: fault surfaces ; fault zones
    Description / Table of Contents: Considerable progress has been made recently in quantifying geometrical and physical properties of fault surfaces and adjacent fractured and granulated damage zones in active faulting environments. There has also been significant progress in developing rheologies and computational frameworks that can model the dynamics of fault zone processes. This volume provides state-of-the-art theoretical and observational results on the mechanics, structure and evolution of fault zones. Subjects discussed include damage rheologies, development of instabilities, fracture and friction, dynamic rupture experiments, and analyses of earthquake and fault zone data.
    Pages: Online-Ressource (381 Seiten)
    ISBN: 9783034601375
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 55
    Keywords: greenhouse gas emission reduction ; energy consumption ; bus ; greenhouse gas emission ; rapid transit ; pedestrian ; pedestrian pathway ; climate change ; transportation network ; road pricing ; emission ; urban transportation ; travel demand ; rebates ; greenhouse gas ; road ; transport ; transport sector ; transit ; travel demand management
    Description / Table of Contents: The Eco2 Cities approach is a point of departure for cities that would like to reap the many benefits of ecological and economic sustainability. It provides an analytical and operational framework that offers strategic guidance to cities on sustainable and integrated urban development. At the same time case studies are used throughout the book to provide a matter-of-fact and ground-level perspective. The Eco2 framework is flexible and easily customized to the context of each country or city. Based on the particular circumstances and the development priorities of a city - the application of the framework can contribute to the development of a unique action plan or roadmap in each case. This action plan can be triggered through catalyst projects.To support this framework, the book also begins to introduce some powerful and practical methods and tools that can further enable sustainable and integrated city planning and decision making. These include 1) operational and process methods that can strengthen collaborative decision making and cross-sector synergies in a city; 2) analytical methods ranging from diagnostics, simulation, design and scenario-generation; and 3) accounting and benchmarking methods which can help clarify, define and measure what it means to truly invest in sustainability and resilience.As additional reference reading, the book also features a series of case studies from best practice cities around the world, each demonstrating a very different dimension of the Eco2 approach. It also features a series of infrastructure sector notes (on spatial development, transport, energy, water and waste management), each of which explore sector specific issues as they pertain to urban development, and the many opportunities for coordination and integration across sectors.
    Pages: Online-Ressource (XXVIII, 358 Seiten)
    ISBN: 9780821381441
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 56
    Keywords: oil spill ; valuation ; environmental degradation ; deforestation ; demolition and military waste ; air pollution ; middle east and north africa ; water degradation ; forest degradation ; land degradation
    Description / Table of Contents: How much is a cleaner environment worth? For policy makers, that question goes largely unanswered. It's not that the environment is seen as unimportant. It's simply much easier to compare the costs and benefits of tangible projects such as airports and electrical grids, than it is to weigh the merits of a landfill cleanup. Over the past decades, the World Bank has undertaken a systematic effort to put a monetary value on environmental degradation, which results sparked policy changes. This book brings together the best case studies of the Cost of Environmental Degradation undertaken in the Middle East and North Africa region and summarizes the major policy impacts at the national and regional levels. The case studies evaluate in monetary terms the annual damages caused by economic activities to natural resources and environment – water, forests, agricultural land, air quality, waste and coastal zone – and reflects the estimates as percentages of the countries’ gross domestic product. It then captures the estimated values in a holistic picture and illuminates their concrete implications on policy, investments, and institutions for the selected countries and for the region as a whole. In addition to being a multi-nation effort, the book stands out by applying updated methods and techniques to estimate natural resource damages both in times of peace and of conflict. This is particularly relevant for the Middle East and North Africa, a region located at the crossroads of different cultures, continents, and religions. This book is primarily targeted at policy makers at the regional, national and local levels and to decision makers in government agencies, NGOs, and natural resource development institutions. It is suitable for use in training courses of decision makers working in environment, forests and water related fields. The book should also be of interest to advanced undergraduates, master’s level students and undergraduates.
    Pages: Online-Ressource (XVIII, 168 Seiten)
    ISBN: 9780821383964
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
    Description / Table of Contents: The Earth's climate varies through geological time as a result of external, orbital processes, as well as the positions of continents, growth of mountains and the opening and closure of oceanic gateways. Climate modelling suggests that the intensity of the Asian monsoon should correlate, at least in part, with the uplift history of the Tibetan Plateau and the Himalaya, as well as the evolution of gateways and the retreat of shallow seas in Central Asia. Long-term reconstructions of both mountain building and monsoon activity are key to testing the proposed links. This collection of papers presents a series of new studies documenting the variations of the Asian monsoon on orbital and tectonic timescales, together with the impact this has had on environmental conditions. The issue of which proxies are best suited to measuring monsoons is addressed, as is the effect that the monsoon has had on erosion and the formation of the stratigraphic record both on and offshore.
    Pages: Online-Ressource (308 Seiten)
    ISBN: 9781862393103
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 58
    Unknown
    London : The Geological Society
    Description / Table of Contents: The Mesozoic Era begins with the approximately 50-million-year-long Triassic Period, a major juncture in Earth history when the vast Pangaean supercontinent completed its assembly and began its fragmentation, and the global biota diversified and modernized after the end-Permian mass extinction, the most extensive biotic decimation of the Phanerozoic. The temporal ordering of geological and biotic events during Triassic time thus is critical to the interpretation of some unique and pivotal events in Earth history. This temporal ordering is mostly based on the Triassic timescale, which has been developed and refined for nearly two centuries. This book reviews the state of the art of the Triassic timescale and includes comprehensive analyses of Triassic radio-isotopic ages, magnetostratigraphy, isotope-based and cyclostratigraphic correlations and timescale -relevant marine and non-marine biostratigraphy.
    Pages: Online-Ressource (514 Seiten) , Illustrationen, Diagramme, Karten
    ISBN: 9781862392960
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 59
    Description / Table of Contents: This volume contains a collection of stratigraphic and diagenetic case studies of Mesozoic and Cenozoic carbonate sequences from the Tethyan realm. High levels of industry and academic interest in the region have generated numerous multi-disciplinary studies of these sequences, a selection of which are presented in this volume. The studies presented are based on both comprehensive subsurface datasets from important hydrocarbon-bearing strata of the Middle East and the excellent surface exposures in the region of interest. The studies presented in this volume may serve as suitable starting points in the development of age and architecture specific carbonate reference models. Such models can form the basis of internally consistent models for carbonate deposition, sequence development and reservoir performance. Ideally such models, suitably scaled, will be equally applicable to academic studies, the exploration and development phases of the field life cycle and in the prediction of future reservoir performance.
    Pages: Online-Ressource (422 Seiten)
    ISBN: 9781862392922
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
    Description / Table of Contents: Fjords are glacially over-deepened, semi-enclosed marine basins, but are often neglected as a sedimentary realm. They represent the transition from the terrestrial to the marine environment and as such have the potential to preserve evidence of environmental change. Typically most fjords have been glaciated a number of times and some high-latitude fjords still possess a resident glacier. The stratigraphic record in fjords largely preserves a glacial–deglacial cycle of deposition. Sheltered water and high sedimentation rates potentially make fjords ideal depositional environments for preserving continuous records of climate and environmental change with high temporal resolution. Fjords are also referred to as miniature oceans providing the unique opportunity to study marine processes in great detail. With predictions of warming climates, changing ocean circulation and rising sea levels, this volume is a timely look at these environmentally sensitive coastlines.
    Pages: Online-Ressource (VII, 380 Seiten)
    ISBN: 9781862393127
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 61
    Description / Table of Contents: Echinoderms are a vast group of spiny-skinned animals including starfish, brittle-stars, sea urchins, sand dollars, feather stars, sea lilies and sea cucumbers. These relatives of chordates and hemichordates have inhabited the world’s oceans for more than 500 million years. Modern members of the Echinodermata are, with over 7 000 species, an integral part of marine communities from the intertidal to the deep sea. Echinoderms play a major ecological role in marine habitats and are of economic importance in fisheries, aquaculture and biomedicine. The present volume contains the abstracts of lectures and posters presented during the 7th European Conference on Echinoderms (ECE) as well as excursion guides. This year’s conference was held at the northern campus of the Georg-August University in Göttingen, Germany, from October 2-9, 2010. More than 100 biologists, palaeontologists and other scientists from 25 countries participated.
    Pages: Online-Ressource (145 Seiten)
    ISBN: 9783941875685
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 62
    Description / Table of Contents: This volume brings together a collection of papers that summarize current ideas and recent progress in the study of granite-related mineralization systems. They provide a combination of field, experimental and theoretical studies. Papers are grouped according to the main granite-related ore systems: granite-pegmatite, skarn and greisen-veins, porphyry, orogenic gold, intrusion-related, epithermal and porphyry-related gold and base metal, iron oxide-copper-gold (IOCG), and special case studies. The studies provide a broad spread in terms of both space and time, highlighting granite-related ore deposits from Europe (Russia, Sweden, Croatia and Turkey), the Middle East (Iran), Asia (Japan and China) and South America (Brazil and Argentina) and spanning rocks from Palaeoproterozoic to Miocene in age.
    Pages: Online-Ressource (192 Seiten)
    ISBN: 9781862393219
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Description / Table of Contents: Fold-and-thrust belts occur worldwide, have formed in all eras of geological time, and are widely recognized as the most common mode in which the crust accommodates shortening. Much current research on the structure of fold-and-thrust belts is focused on structural studies of regions or individual structures and on the geometry and evolution of these regions employing kinematic, mechanical and experimental modelling. In keeping with the main trends of current research, this title is devoted to the kinematic evolution and structural styles of a number of fold-and-thrust belts formed from Palaeozoic to Recent times. The papers included in this book cover a broad range of different topics, from modelling approaches to predict internal deformation of single structures, 3D reconstructions to decipher the structural evolution of groups of structures, palaeomagnetic studies of portions of fold-and-thrust belts, geometrical and kinematical aspects of Coulomb thrust wedges and structural analyses of fold-and-thrust belts to unravel their sequence of deformations.
    Pages: Online-Ressource (VI, 255 Seiten)
    ISBN: 9781862393202
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
    Keywords: carbon ; energy ; climate change ; coal emissions ; energy efficiency
    Description / Table of Contents: This study from the Independent Evaluation Group draws lessons for development and climate change mitigation from the World Bank Group’s far-reaching portfolio of projects in energy, forestry, transport, coal power, and technology transfer. Reviewing what has worked, what hasn’t, and why, the evaluation’s key findings include: Energy efficiency can offer countries direct economic returns that dwarf those of most other development projects, while also reducing greenhouse gas emissions. Tropical forest protected areas, on average, significantly reduce tropical deforestation, preserving carbon and biodiversity. Deforestation rates are lower in areas that allowed sustainable use by local populations than in strictly protected areas. Deforestation rates were lowest of all in indigenous forest areas. For renewable energy projects, long-duration loans have been important in making projects financially viable.. But at prevailing carbon prices, carbon offset sales had little impact on most renewable energy projects’ rate of returns, and did not address investors’ need for up-front capital. Technology transfer – broadly understood to include diffusion of technical and financial innovations related to low-carbon development – has worked well when the logic of piloting and demonstration is well thought out, and when grants are used to mitigate the risk of pioneering efforts.
    Pages: Online-Ressource (XXXIX, 128 Seiten)
    ISBN: 9780821386545
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 65
    Description / Table of Contents: Human impact on our environment is not a new phenomenon. For millennia, humans have been coping with – or provoking – environmental change. We have exploited, extracted, over-used, but also in many cases nurtured, the resources that the geosphere offers. Geoarchaeology studies the traces of human interactions with the geosphere and provides the key to recognizing landscape and environmental change, human impacts and the effects of environmental change on human societies. This collection of papers from around the world includes case studies and broader reviews covering the time period since before modern human beings came into existence up until the present day. To understand ourselves, we need to understand that our world is constantly changing, and that change is dynamic and complex. Geoarchaeology provides an inclusive and long-term view of human–geosphere interactions and serves as a valuable aid to those who try to determine sustainable policies for the future.
    Pages: Online-Ressource (VII, 200 Seiten)
    ISBN: 9781862393257
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Unknown
    London : The Geological Society
    Keywords: mass movements ; slope stability ; slopes ; tectonics
    Description / Table of Contents: Slope tectonics: a short introduction / Michel Jaboyedoff, Giovanni B. Crosta and Doug Stead / Geological Society, London, Special Publications, 351, 1-10, 1 January 2011, https://doi.org/10.1144/SP351.1 --- Paraglacial gravitational deformations in the SW Alps: a review of field investigations, 10Be cosmogenic dating and physical modelling / S. El Bedoui, T. Bois, H. Jomard, G. Sanchez, T. Lebourg, E. Trics, Y. Guglielmi, S. Bouissou, A. Chemenda, Y. Rolland, M. Corsini and J. L. Pérez / Geological Society, London, Special Publications, 351, 11-25, 1 January 2011, https://doi.org/10.1144/SP351.2 --- Inheritance of ductile and brittle structures in the development of large rock slope instabilities: examples from western Norway / A. Saintot, I. H. C. Henderson and M.-H. Derron / Geological Society, London, Special Publications, 351, 27-78, 1 January 2011, https://doi.org/10.1144/SP351.3 --- Regional spatial variations in rockslide distribution from structural geology ranking: an example from Storfjorden, western Norway / Iain H. C. Henderson and Aline Saintot / Geological Society, London, Special Publications, 351, 79-95, 1 January 2011, https://doi.org/10.1144/SP351.4 --- Rock slope instabilities in Sogn and Fjordane County, Norway: a detailed structural and geomorphological analysis / Martina Böhme, Aline Saintot, Iain H. C. Henderson, Helge Henriksen and Reginald L. Hermanns / Geological Society, London, Special Publications, 351, 97-111, 1 January 2011, https://doi.org/10.1144/SP351.5 --- Controlling factors for deep-seated gravitational slope deformation (DSGSD) in the Aosta Valley (NW Alps, Italy) / G. Martinotti, D. Giordan, M. Giardino and S. Ratto / Geological Society, London, Special Publications, 351, 113-131, 1 January 2011, https://doi.org/10.1144/SP351.6 --- Palaeostress analysis of a giant Holocene rockslide near Boaco and Santa Lucia (Nicaragua, Central America) / Ivo Baron̆, Markéta Kernstocková, Roman Novotný, David Buriánek, Petr Hradecký, Pavel Havlic̆ek and Rostislav Melichar / Geological Society, London, Special Publications, 351, 133-145, 1 January 2011, https://doi.org/10.1144/SP351.7 --- Complex landslide behaviour and structural control: a three-dimensional conceptual model of Åknes rockslide, Norway / Michel Jaboyedoff, Thierry Oppikofer, Marc-Henri Derron, Lars Harald Blikra, Martina Böhme and Aline Saintot / Geological Society, London, Special Publications, 351, 147-161, 1 January 2011, https://doi.org/10.1144/SP351.8 --- Structural analysis of Turtle Mountain: origin and influence of fractures in the development of rock slope failures / Andrea Pedrazzini, Michel Jaboyedoff, Corey R. Froese, C. Willem Langenberg and Francisco Moreno / Geological Society, London, Special Publications, 351, 163-183, 1 January 2011, https://doi.org/10.1144/SP351.9 --- A structural, geomorphological and InSAR study of an active rock slope failure development / I. H. C. Henderson, T. R. Lauknes, P. T. Osmundsen, J. Dehls, Y. Larsen and T. F. Redfield / Geological Society, London, Special Publications, 351, 185-199, 1 January 2011, https://doi.org/10.1144/SP351.10 --- Numerical modelling of Plio-Quaternary slope evolution based on geological constraints: a case study from the Caramanico Valley (Central Apennines, Italy) / G. Bianchi Fasani, E. Di Luzio, C. Esposito, S. Martino and G. Scarascia-Mugnozza / Geological Society, London, Special Publications, 351, 201-214, 1 January 2011, https://doi.org/10.1144/SP351.11 --- Valley shape influence on deformation mechanisms of rock slopes / Christian Ambrosi and Giovanni B. Crosta / Geological Society, London, Special Publications, 351, 215-233, 1 January 2011, https://doi.org/10.1144/SP351.12 --- The Celentino deep-seated gravitational slope deformation (DSGSD): structural and geomechanical analyses (Peio Valley, NE Italy) / M. Ghirotti, S. Martin and R. Genevois / Geological Society, London, Special Publications, 351, 235-251, 1 January 2011, https://doi.org/10.1144/SP351.13 --- Megafans and outsize fans from catastrophic slope failures in Alpine glacial troughs: the Malser Haide and the Val Venosta cluster, Italy / David Jarman, Federico Agliardi and Giovanni B. Crosta / Geological Society, London, Special Publications, 351, 253-277, 1 January 2011, https://doi.org/10.1144/SP351.14
    Pages: Online-Ressource (VII, 283 Seiten) , Illustrationen, Diagramme
    ISBN: 9781862395992
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    Keywords: low-carbon growth ; emission ; greenhouse gas ; carbon ; Poland ; Europe
    Description / Table of Contents: This study on Poland is part of the World Bank's series of low-carbon growth studies. It poses the question of how Poland, an EU member state, an industrialized 'Annex I' country for the purposes of international climate discussions,1 and an OECD member, can transition to a low emissions economy as successfully as it underwent transition to a market economy in the early 1990s. With a broad consensus that global coordinated action is needed to prevent dangerous climate change estimated to cost about 1 percent of global GDP) and with EU policies on climate change already in place, Poland faces immediate policy challenges. Could the country commit to more ambitious overall greenhouse gas mitigation targets for the longer term - to 2030 and beyond? What technological options are available, and how expensive are they compared with existing technologies? Would there be high costs in lost growth and employment? Over a shorter horizon, to 2020, what are the implications for Poland of implementing EU policies on climate change? The report addresses these questions while advancing the approach of the Bank's low carbon studies by integrating 'bottom-up' engineering analysis with 'top-down' economy-wide modeling.
    Pages: Online-Ressource (193 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Unknown
    Washington, D. C. : The World Bank
    Keywords: alternative energy ; sustainable forest management ; carbon finance ; carbon ; forests ; climate change ; biodiversity conservation ; emissions ; oceans ; silver ; colors ; carbon sinks ; carbon offsets ; climate ; ecosystem ; emissions from deforestation ; coral reefs ; carbon stores ; forest ; sustainable forest
    Description / Table of Contents: Global warming and changes in climate will have severe and lasting impacts on national efforts to alleviate poverty and promote sustainable development. Some of the world s poorest countries and communities are the most vulnerable and are already suffering the consequences. Yet often these countries are rich in natural capital, ecosystems, and biodiversity that can contribute to solutions as they can to climate change. Biodiversity is the foundation and mainstay of agriculture, forests, and fisheries. Biological resources provide the raw materials for livelihoods, agriculture, medicines, trade, tourism, and industry. Forests, grasslands, freshwater, and marine and other natural ecosystems provide a range of services, often not recognized in national economic accounts but vital to human welfare: regulating water flows and water quality, flood control, pollination, decontamination, carbon sequestration, soil conservation, and nutrient and hydrological cycling. Current efforts to address climate change focus mainly on reducing emissions of greenhouse gases, mainly through cleaner energy strategies, and on attempting to reduce vulnerability of the communities at risk by improving infrastructure to meet new energy and water needs. This book book sets out a compelling argument for including ecosystem-based approaches to mitigation and adaptation as a third essential pillar in national strategies to address climate change. Such ecosystem-based strategies can offer cost-effective, proven and sustainable solutions contributing to, and complementing, other national and regional adaptation strategies.
    Pages: Online-Ressource (XII, 114 Seiten)
    ISBN: 9780821381274
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    Description / Table of Contents: Elevation data are a critical element in most geoscience applications. From geological mapping to modelling Earth systems and processes geologists need to understand the shape of the Earth's surface. Vast amounts of digital elevation data exist, from large-scale global to smaller scale regional datasets, and many datasets have been merged to improve scale and accuracy. For each application, decisions are made on which elevation data to use driven by cost, resolution and accuracy. This publication shows the current status of available digital elevation data and illustrates the key applications. The types of data assessed include: ASTER stereo satellite imagery, Shuttle Radar Topographic Mapping data, airborne laser and radar such as NEXTMap, and Multibeam Bathymetry. Applications covered include: glacial deposits, landslides, coastal erosion and other geological hazards. Technical issues discussed include: accuracy analysis, derived product creation, software comparisons and copyright considerations. This volume is a comprehensive look at elevation models for geoscience.
    Pages: Online-Ressource (148 Seiten)
    ISBN: 978186239313
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Keywords: carbon emission
    Description / Table of Contents: The purpose of the ET Carbon Ranking is to provide information on a company's greenhouse gas emissions intensity as well as its level of disclosure and verification. The aim of the ET Carbon Ranking is to encourage increasingly higher levels of disclosure and verification while incentivising corporate greenhouse gas (GHG) emissions reduction on a global scale.
    Pages: Online-Ressource (42 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Keywords: climate change ; global warming
    Description / Table of Contents: This book addresses the theme of the impacts of global warming on different specific fields, ranging from the regional and global economy, to agriculture, human health, urban areas, land vegetation, marine areas and mangroves. Despite the volume of scientific work that has been undertaken in relation to each of each of these issues, the study of the impacts of global warming upon them is a relatively recent and unexplored topic. The chapters of this book offer a broad overview of potential applications of global warming science. As this science continues to evolve, confirm and reject study hypotheses, it is hoped that that this book will stimulate further developments in relation to the impacts of changes in the global climate.
    Pages: Online-Ressource (290 Seiten)
    ISBN: 9789533077857
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    Keywords: edwards aquifer ; trinity aquifer ; hydraulic interaction
    Description / Table of Contents: The Edwards and Trinity Aquifers are critical water resources, supplying high-quality potable water to over two million people in the greater Austin-San Antonio region of central Texas, USA. These Cretaceous carbonate aquifers are hydrogeologically juxtaposed by extensive Miocene tectonic deformation associated with the Balcones Fault Zone, where the younger Edwards Group limestone has been downthrown relative to the older Trinity Group. The karstic aquifers are managed separately by regional water regulatory entities, and they have been historically treated as independent systems, both scientifically and from a water policy standpoint. Recent awareness of a significant interconnection between the Edwards and Trinity Aquifers has resulted in a number of hydrogeologic investigations documenting how they may actually operate as a single system. Studies related to upland recharge variability (spatial and temporal), stream loss, phreatic dye tracing, multi-port well monitoring, geochemistry, biologic habitat analysis, geophysics, and groundwater modeling indicate that the two are much less separated than previously observed. Summaries of these investigations conclude that changes in management strategies may be required to properly protect the quantity and quality of water in the Edwards and Trinity Aquifers. The proceedings volume contains nine contributions presented during the Karst Conservation Initiative Meeting held in February 17, 2011 at The University of Texas at Austin.
    Pages: Online-Ressource (45 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
    Description / Table of Contents: This collection of papers presents recent advances in the study of deformation mechanisms and rheology and their applications to tectonics. Many of the contributions exploit new petrofabric techniques, particularly electron backscatter diffraction, to help understand evolution of rock microstructure and mechanical properties. Papers in the first section (lattice preferred orientations and anisotropy) show a growing emphasis on the determination of elastic properties from petrofabrics, from which acoustic properties can be computed for comparison with in-situ seismic measurements. Such research will underpin geodynamic interpretation of large-scale active tectonics. Contributions in the second section (microstructures, mechanisms and rheology) study the relations between microstructural evolution during deformation and mechanical properties. Many of the papers explore how different mechanisms compete and interact to control the evolution of grain size and petrofabrics. Contributors make use of combinations of laboratory experiments, field studies and computational methods, and several relate microstructural and mechanical evolution to large-scale tectonic processes observed in nature.
    Pages: Online-Ressource (XII, 342 Seiten)
    ISBN: 9781862393387
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 74
    Unknown
    Rijeka : InTech
    Keywords: oceanography ; atmospheric sciences ; air pollution ; air quality
    Description / Table of Contents: Human beings need to breathe oxygen diluted in certain quantity of inert gas for living. In the atmosphere, there is a gas mixture of, mainly, oxygen and nitrogen, in appropriate proportions. However, the air also contains other gases, vapours and aerosols that humans incorporate when breathing and whose composition and concentration vary spatially. Some of these are physiologically inert. Air pollution has become a problem of major concern in the last few decades as it has caused negative effects on human health, nature and properties. This book presents the results of research studies carried out by international researchers in seventeen chapters which can be grouped into two main sections: a) air quality monitoring and b) air quality assessment and management, and serves as a source of material for all those involved in the field, whether as a student, scientific researcher, industrialist, consultant, or government agency with responsibility in this area.
    Pages: Online-Ressource (378 Seiten)
    ISBN: 9789533073170
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Keywords: environmental chemistry
    Description / Table of Contents: The book offers a professional look on the recent achievements and emerging trends in pesticides analysis, including pesticides identification and characterization. The 20 chapters are organized in three sections. The first book section addresses issues associated with pesticides classification, pesticides properties and environmental risks, and pesticides safe management, and provides a general overview on the advanced chromatographic and sensors- and biosensors-based methods for pesticides determination. The second book section is specially devoted to the chromatographic pesticides quantification, including sample preparation. The basic principles of the modern extraction techniques, such as: accelerated solvent extraction, supercritical fluid extraction, microwave assisted extraction, solid phase extraction, solid phase microextraction, matrix solid phase dispersion extraction, cloud point extraction, and QuEChERS are comprehensively described and critically evaluated. The third book section describes some alternative analytical approaches to the conventional methods of pesticides determination. These include voltammetric techniques making use of electrochemical sensors and biosensors, and solid-phase spectrometry combined with flow-injection analysis applying flow-based optosensors.
    Pages: Online-Ressource (514 Seiten)
    ISBN: 9789533074375
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    Unknown
    Rijeka : InTech
    Keywords: oceanography ; atmospheric sciences ; air pollution ; air quality ; environmental engineering
    Description / Table of Contents: Air pollution is about five decades or so old field and continues to be a global concern. Therefore, the governments around the world are involved in managing air quality in their countries for the welfare of their citizens. The management of air pollution involves understanding air pollution sources, monitoring of contaminants, modeling air quality, performing laboratory experiments, the use of satellite images for quantifying air quality levels, indoor air pollution, and elimination of contaminants through control. Research activities are being performed on every aspect of air pollution throughout the world, in order to respond to public concerns. The book is grouped in five different sections. Some topics are more detailed than others. The readers should be aware that multi-authored books have difficulty maintaining consistency. A reader will find, however, that each chapter is intellectually stimulating. Our goal was to provide current information and present a reasonable analysis of air quality data compiled by knowledgeable professionals in the field of air pollution.
    Pages: Online-Ressource (382 Seiten)
    ISBN: 9789533071312
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Unknown
    Open Humanities Press
    Keywords: astrobiology ; Mars ; life
    Description / Table of Contents: INTRODUCTION: WHAT IS LIFE? I’m not going to answer this question. In fact, I doubt if it will ever be possible to give a full answer. (Haldane, 1949: 58) What Is Life? J. B. S. Haldane (1949) and Erwin Schrödinger (1944), two of the twentieth century’s most influential scientists, posed the direct question, ‘what is life?’ and declared that it was a question unlikely to find an answer. Life, they suggested, might exceed the ability of science to represent it and even though the sciences of biology, physics and chemistry might usefully describe life’s structures, systems and processes, those sciences should not seek to reduce it to the sum of its parts. While Schrödinger drew attention to the physical structure of living matter, including especially the cell, Haldane asserted that ‘what is common to life is the chemical events’ (1949: 59) and so therefore life might be defined, though not reduced, to ‘a pattern of chemical processes’ (62) involving the use of oxygen, enzymes and so on. Following Schrödinger and Haldane, Chris McKay’s article, published in 2004 and included in this collection, asks again ‘What is Life – and How Do We Search For It in Other Worlds?’. For him, the still open and unresolved question of life is intrinsically linked to the problem of how to find it (here, or elsewhere) since, he queries, how can we search for something that we cannot adequately define? It should be noted that this dilemma did not deter the founders of Artificial Life, a project that succeeded Artificial Intelligence and that sought to both simulate ‘life-as-we-know-it’ and synthesise ‘life-as-it-could-be’ by reducing life to the informational and therefore computational criteria of self-organisation, self-replication, evolution, autonomy and emergence (Langton, 1996: 40; Kember, 2003). McKay concedes that certain characteristics of life, such as metabolism and motion, can occur without biology, but rather than pursuing contestable (re)definitions of life that could not, for him, constitute the basis for a search, he prefers to ask a more pragmatic question: ‘what does life need?’. The elements that support life – energy, carbon, liquid water, nitrogen, sulphur and phosphorus – are not contested and, barring only liquid water, they are abundant in the Solar System. It seems logical then, McKay argues, to search for life indirectly, by looking at where the water is. The case for liquid water on Mars has, as we will see, a long and argumentative history. In as far as the current case is, as McKay maintains, ‘tight’, then there is justification for his upbeat assessment that, with the correct instruments, it should be possible to find life-as-we-know-it – and even life-as-it-could-be. He writes: ‘while it could be similar at the top (ecological) and bottom (chemical) levels, life on Mars could be quite alien in the middle, in the realm of biochemistry’ (2004: 1261).
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    Unknown
    Rijeka : InTech
    Keywords: soil science
    Description / Table of Contents: Soil erosion affects a large part of the Earth surface, and accelerated soil erosion is recognized as one of the main soil threats, compromising soil productive and protective functions. The land management in areas affected by soil erosion is a relevant issue for landscape and ecosystems preservation. In this book we collected a series of papers on erosion, not focusing on agronomic implications, but on a variety of other relevant aspects of the erosion phenomena. The book is divided into three sections: i) various implications of land management in arid and semiarid ecosystems, ii) erosion modeling and experimental studies; iii) other applications (e.g. geoscience, engineering). The book covers a wide range of erosion-related themes from a variety of points of view (assessment, modeling, mitigation, best practices etc.).
    Pages: Online-Ressource (320 Seiten)
    ISBN: 9789533077109
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
    Unknown
    Rijeka : InTech
    Keywords: environmental engineering ; water management
    Description / Table of Contents: There is an estimated 1.4 billion km3 of water in the world but only approximately three percent (39 million km3) of it is available as fresh water. Moreover, most of this fresh water is found as ice in the arctic regions, deep groundwater or atmospheric water. Since water is the source of life and essential for all life on the planet, the use of this resource is a highly important issue. "Water management" is the general term used to describe all the activities that manage the optimum use of the world's water resources. However, only a few percent of the fresh water available can be subjected to water management. It is still an enormous amount, but what's unique about water is that unlike other resources, it is irreplaceable. This book provides a general overview of various topics within water management from all over the world. The topics range from politics, current models for water resource management of rivers and reservoirs to issues related to agriculture. Water quality problems, the development of water demand and water pricing are also addressed. The collection of contributions from outstanding scientists and experts provides detailed information about different topics and gives a general overview of the current issues in water management. The book covers a wide range of current issues, reflecting on current problems and demonstrating the complexity of water management.
    Pages: Online-Ressource (340 Seiten)
    ISBN: 9789533074139
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 80
    Keywords: energy engineering ; renewable resources
    Description / Table of Contents: Worldwide attention to environmental issues combined with the energy crisis force us to reduce greenhouse emissions and increase the usage of renewable energy sources as a solution to providing an efficient environment. This book addresses the current issues of sustainable growth and applications in renewable energy sources. The fifteen chapters of the book have been divided into two sections to organize the information accessible to readers. The book provides a variety of material, for instance on policies aiming at the promotion of sustainable development and implementation aspects of RES.
    Pages: Online-Ressource (338 Seiten)
    ISBN: 9789533074085
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Keywords: oceanography ; atmospheric sciences ; hurricane research ; meteorology
    Description / Table of Contents: This book represents recent research on tropical cyclones and their impact, and a wide range of topics are covered. An updated global climatology is presented, including the global occurrence of tropical cyclones and the terrestrial factors that may contribute to the variability and long-term trends in their occurrence. Research also examines long term trends in tropical cyclone occurrences and intensity as related to solar activity, while other research discusses the impact climate change may have on these storms. The dynamics and structure of tropical cyclones are studied, with traditional diagnostics employed to examine these as well as more modern approaches in examining their thermodynamics. The book aptly demonstrates how new research into short-range forecasting of tropical cyclone tracks and intensities using satellite information has led to significant improvements. In looking at societal and ecological risks, and damage assessment, authors investigate the use of technology for anticipating, and later evaluating, the amount of damage that is done to human society, watersheds, and forests by land-falling storms. The economic and ecological vulnerability of coastal regions are also studied and are supported by case studies which examine the potential hazards related to the evacuation of populated areas, including medical facilities. These studies provide decision makers with a potential basis for developing improved evacuation techniques.
    Pages: Online-Ressource (616 Seiten)
    ISBN: 9789533072388
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Keywords: environmental engineering ; climate change ; global warming
    Description / Table of Contents: The failure of the UN climate change summit in Copenhagen in December 2009 to effectively reach a global agreement on emission reduction targets, led many within the developing world to view this as a reversal of the Kyoto Protocol and an attempt by the developed nations to shirk out of their responsibility for climate change. The issue of global warming has been at the top of the political agenda for a number of years and has become even more pressing with the rapid industrialization taking place in China and India. This book looks at the effects of climate change throughout different regions of the world and discusses to what extent cleantech and environmental initiatives such as the destruction of fluorinated greenhouse gases, biofuels, and the role of plant breeding and biotechnology. The book concludes with an insight into the socio-religious impact that global warming has, citing Christianity and Islam.
    Pages: Online-Ressource (646 Seiten)
    ISBN: 9789533077338
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Description / Table of Contents: Professor Richard (Rick) Sibson revolutionized structural geology by illustrating that fault rocks contain an integrated record of earthquakes. Fault-rock textures develop in response to geological and physical variables such as composition, environmental conditions (e.g. temperature and pressure), fluid presence and strain rate. These parameters also determine the rate- and state-variable frictional stability of a fault, the dominant mineral deformation mechanism and shear strength, and ultimately control the partitioning between seismic and aseismic deformation. This volume contains a collection of papers that address the geological record of earthquake faulting from field-based or theoretical perspectives. The papers cover observations in active fault zones, the relationships between fault rocks and fault-slip styles, interpretation of fault-rock textures from the base of the seismogenic zone, consideration of the effects of fluids on faulting, discussion of fault reactivation v. initiation, and a review of future directions in geological earthquake research by Professor Sibson.
    Pages: Online-Ressource (VIII, 341 Seiten)
    ISBN: 9781862393370
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Keywords: energy engineering
    Description / Table of Contents: The utilization of renewable energy sources such as wind energy, or solar energy, among others, is currently of greater interest. Nevertheless, since their availability is arbitrary and unstable this can lead to frequency variation, to grid instability and to a total or partial loss of load power supply, being not appropriate sources to be directly connected to the main utility grid. Additionally, the presence of a static converter as output interface of the generating plants introduces voltage and current harmonics into the electrical system that negatively affect system power quality. By integrating distributed power generation systems closed to the loads in the electric grid, we can eliminate the need to transfer energy over long distances through the electric grid. In this book the reader will be introduced to different power generation and distribution systems with an analysis of some types of existing disturbances and a study of different industrial applications such as battery charges.
    Pages: Online-Ressource (304 Seiten)
    ISBN: 9789533073293
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Unknown
    Rijeka : InTech
    Keywords: energy engineering ; renewable resources
    Description / Table of Contents: The third book of four-volume edition of 'Solar Cells' is devoted to solar cells based on silicon wafers, i.e., the main material used in today's photovoltaics. The volume includes the chapters that present new results of research aimed to improve efficiency, to reduce consumption of materials and to lower cost of wafer-based silicon solar cells as well as new methods of research and testing of the devices. Light trapping design in c-Si and mc-Si solar cells, solar-energy conversion as a function of the geometric-concentration factor, design criteria for spacecraft solar arrays are considered in several chapters. A system for the micrometric characterization of solar cells, for identifying the electrical parameters of PV solar generators, a new model for extracting the physical parameters of solar cells, LBIC method for characterization of solar cells, non-idealities in the I-V characteristic of the PV generators are discussed in other chapters of the volume.
    Pages: Online-Ressource (364 Seiten)
    ISBN: 9789533077475
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    Keywords: biodiversity ; environmental sciences
    Description / Table of Contents: Driven by the increasing necessity to define the biological diversity frame of widespread, endemic and threatened species, as well as by the stimulating chance to describe new species, the study of the evolutive and spatial dynamics is in constant execution. Systematic overviews, biogeographic and phylogenic backgrounds, species composition and distribution in restricted areas are focal topics of the 15 interesting independent chapters collected in this book, chosen to offer to the reader an overall view of the present condition in which our planet is.
    Pages: Online-Ressource (366 Seiten)
    ISBN: 9789533077727
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Unknown
    Rijeka : InTech
    Keywords: tsunami ; environmental sciences
    Description / Table of Contents: Submarine earthquakes, submarine slides and impacts may set large water volumes in motion characterized by very long wavelengths and a very high speed of lateral displacement, when reaching shallower water the wave breaks in over land – often with disastrous effects. This natural phenomenon is known as a tsunami event. By December 26, 2004, an event in the Indian Ocean, this word suddenly became known to the public. The effects were indeed disastrous and 227,898 people were killed. Tsunami events are a natural part of the Earth’s geophysical system. There have been numerous events in the past and they will continue to be a threat to humanity; even more so today, when the coastal zone is occupied by so much more human activity and many more people. Therefore, tsunamis pose a very serious threat to humanity. The only way for us to face this threat is by increased knowledge so that we can meet future events by efficient warning systems and aid organizations. This book offers extensive and new information on tsunamis; their origin, history, effects, monitoring, hazards assessment and proposed handling with respect to precaution. Only through knowledge do we know how to behave in a wise manner. This book should be a well of tsunami knowledge for a long time, we hope.
    Pages: Online-Ressource (714 Seiten)
    ISBN: 9789533075525
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Keywords: energy engineering
    Description / Table of Contents: In the early 21st century, research and development of sustainable energy harvesting (EH) technologies have started. Since then, many EH technologies have evolved, advanced and even been successfully developed into hardware prototypes for sustaining the operational lifetime of low?power electronic devices like mobile gadgets, smart wireless sensor networks, etc. Energy harvesting is a technology that harvests freely available renewable energy from the ambient environment to recharge or put used energy back into the energy storage devices without the hassle of disrupting or even discontinuing the normal operation of the specific application. With the prior knowledge and experience developed over a decade ago, progress of sustainable EH technologies research is still intact and ongoing. EH technologies are starting to mature and strong synergies are formulating with dedicate application areas. To move forward, now would be a good time to setup a review and brainstorm session to evaluate the past, investigate and think through the present and understand and plan for the future sustainable energy harvesting technologies.
    Pages: Online-Ressource (256 Seiten)
    ISBN: 9789533074382
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Unknown
    Rijeka : InTech
    Keywords: globalization ; business ; management ; economics
    Description / Table of Contents: Today science is moving in the direction of synthesis of the achievements of various academic disciplines. The idea to prepare and present to the international academic milieu, a multidimensional approach to globalization phenomenon is an ambitious undertaking. The book The Systemic Dimension of Globalization consists of 14 chapters divided into three sections: Globalization and Complex Systems; Globalization and Social Systems; Globalization and Natural Systems. The Authors of respective chapters represent a great diversity of disciplines and methodological approaches as well as a variety of academic culture. This is the value of this book and this merit will be appreciated by a global community of scholars.
    Pages: Online-Ressource (288 Seiten)
    ISBN: 9789533073842
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Unknown
    Rijeka : InTech
    Keywords: globalization ; business ; management ; economics
    Description / Table of Contents: To better understand the contemporary world, the world of innovation and technology, science should try to synthesize and assimilate social science in the development of our civilization. Does the new era require new knowledge? Does the age of globalization demand new education, new human attitudes? This books tries to clarify these questions. The book New Knowledge in a New Era of Globalization consists of 16 chapters divided into three sections: Globalization and Education; Globalization and Human Being; Globalization and Space. The Authors of respective chapters represent a great diversity of disciplines and methodological approaches as well as a variety of academic culture. This book is a valuable contribution and it will certainly be appreciated by a global community of scholars.
    Pages: Online-Ressource (354 Seiten)
    ISBN: 9789533075013
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Unknown
    Rijeka : InTech
    Keywords: biodiversity ; environmental sciences
    Description / Table of Contents: Every ecosystem is a complex organization of carefully mixed life forms; a dynamic and particularly sensible system. Consequently, their progressive decline may accelerate climate change and vice versa, influencing flora and fauna composition and distribution, resulting in the loss of biodiversity. Climate changes effects are the principal topics of this volume. Written by internationally renowned contributors, Biodiversity loss in a changing planet offers attractive study cases focused on biodiversity evaluations and provisions in several different ecosystems, analysing the current life condition of many life forms, and covering very different biogeographic zones of the planet.
    Pages: Online-Ressource (318 Seiten)
    ISBN: 9789533077079
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    Keywords: hydrodynamics ; hydrology ; mechanical engineering
    Description / Table of Contents: The phenomena related to the flow of fluids are generally complex, and difficult to quantify. New approaches - considering points of view still not explored - may introduce useful tools in the study of Hydrodynamics and the related transport phenomena. The details of the flows and the properties of the fluids must be considered on a very small scale perspective. Consequently, new concepts and tools are generated to better describe the fluids and their properties. This volume presents conclusions about advanced topics of calculated and observed flows. It contains eighteen chapters, organized in five sections: 1) Mathematical Models in Fluid Mechanics, 2) Biological Applications and Biohydrodynamics, 3) Detailed Experimental Analyses of Fluids and Flows, 4) Radiation-, Electro-, Magnetohydrodynamics, and Magnetorheology, 5) Special Topics on Simulations and Experimental Data. These chapters present new points of view about methods and tools used in Hydrodynamics.
    Pages: Online-Ressource (442 Seiten)
    ISBN: 9789533075969
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Keywords: geology ; geophysics
    Description / Table of Contents: With growing attention on global environmental and climate change, geoscience has experienced rapid change and development in the last three decades. Many new data, methods and modeling techniques have been developed and applied in various aspects of geoscience. The chapters collected in this book present an excellent profile of the current state of various data, analysis methods and modeling techniques, and demonstrate their applications from hydrology, geology and paleogeomorphology, to geophysics, environmental and climate change. The wide range methods and techniques covered in the book include information systems and technology, global position system (GPS), digital sediment core image analysis, fuzzy set theory for hydrology, spatial interpolation, spectral analysis of geophysical data, GIS-based hydrological models, high resolution geological models, 3D sedimentology, change detection from remote sensing, etc. Besides two comprehensive review articles, most chapters focus on in-depth studies of a particular method or technique.
    Pages: Online-Ressource (336 Seiten)
    ISBN: 9789533077376
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Unknown
    Rijeka : InTech
    Keywords: mineralogy ; physical sciences ; engineering ; technology
    Description / Table of Contents: An Introduction to the Study of Mineralogy is a collection of papers that can be easily understood by a wide variety of readers, whether they wish to use it in their work, or simply to extend their knowledge. It is unique in that it presents a broad view of the mineralogy field. The book is intended for chemists, physicists, engineers, and the students of geology, geophysics, and soil science, but it will also be invaluable to the more advanced students of mineralogy who are looking for a concise revision guide.
    Pages: Online-Ressource (154 Seiten)
    ISBN: 9789533078960
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    Keywords: cities ; climate change ; distaster risk management ; environmental buffers ; flooding ; urban development
    Description / Table of Contents: Urban flooding is a significant challenge which today increasingly confronts the residents of the expanding cities and towns of developing countries, as well as policymakers and national, regional and local government officials. The Global Handbook presents the state-of-the art in urban flood risk management in a thorough and user-friendly way. It serves as a primer in integrated urban flood risk management for technical specialists, decision-makers and other concerned stakeholders in the private and community sectors. It covers the causes, probability and impacts of floods; the measures that can be used to manage flood risk, balancing structural and non-structural solutions in an integrated fashion; and the means by which these measures can be financed and implemented, and their progress monitored and evaluated. The Handbook provides an operational guide on how most effectively to manage the risk of floods in rapidly urbanizing settings – and within the context of a changing climate.
    Pages: Online-Ressource (631 Seiten)
    ISBN: 9780821394779
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Keywords: Visual Basic 2010 ; .NET
    Description / Table of Contents: Sie möchten Visual Basic oder ganz allgemein programmieren lernen? Dann führt Sie dieses Buch schnell und sicher zum Ziel. Angefangen bei den absoluten Grundlagen zu Variablen, Operatoren, Schleifen und Co. über objektorientierte Programmierung und Fehlerbehandlung bis hin zu Datenbankanwendungen mit ADO.NET und Internetanwendungen mit ASP.NET werden alle wichtigen Themen anhand anschaulicher Beispiele gut verständlich erläutert. Ausführliche Schritt-für-Schritt-Anleitungen und regelmäßige Zusammenfassungen sichern dabei Ihren Lernerfolg. Ihr neu gewonnenes Wissen können Sie zudem an einer Vielzahl von Übungsaufgaben unter Beweis stellen und an Musterlösungen überprüfen, so dass Sie schon bald in der Lage sein werden, selbstständig eigene Windows-Programme zu entwickeln.
    Pages: Online-Ressource (467 Seiten)
    Edition: 2., akt. und erw. Aufl.
    ISBN: 9783836215411
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    Description / Table of Contents: In this timely volume, geoscientists from both industry and academia present a contemporary view of salt at a global scale. The studies examine the influence of salt on synkinematic sedimentation, its role in basin evolution and tectonics, and ultimately in hydrocarbon prospectivity. Recent improvements in seismic reflection, acquisition and processing techniques have led to significant advances in the understanding of salt and sediment interactions, both along the flanks of vertical or overturned salt margins, and in subsalt plays such as offshore Brazil. The book is broadly separated into five major themes covering a variety of geographical and process-linked topics. These are: halokinetic sequence stratigraphy, salt in passive margin settings, Central European salt basins, deformation within and adjacent to salt, and salt in contractional settings and salt glaciers.
    Pages: Online-Ressource (VII, 624 Seiten)
    ISBN: 9781862393417
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Description / Table of Contents: This book, generated under the auspices of the Geological Society of London's History of Geology and Hydrogeological Groups, contains 20 papers from authors in the UK, USA, Germany and Austria. Historically, it gives examples of the influence of groundwater on battlefield tactics and fortress construction; describes how groundwater was developed for water supply and overcome as an obstacle to military engineering and cross-country vehicular movement by both sides in World Wars I and II; and culminates with examples of the application of hydrogeology to site boreholes in recent conflicts, notably in Afghanistan. Examples of current research described include hydrological model development; the impact of variations in soil moisture on explosive threat detection and cross-country vehicle mobility; contamination arising from defence sites and its remediation; privatization of water supplies; and the equitable allocation of resources derived from an international transboundary aquifer.
    Pages: Online-Ressource (VIII, 374 Seiten)
    ISBN: 9781862393400
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Keywords: stratosphere ; ozone ; chemistry ; climate models
    Description / Table of Contents: Three-dimensional climate models with a fully interactive representation of stratospheric ozone chemistry — otherwise known as stratosphere-resolving chemistry-climate models (CCMs) — are key tools for the attribution and prediction of stratospheric ozone changes arising from the combined effects of changes in the amounts of greenhouse gases (GHG) and ozone-depleting substances (ODS). These models can also be used to infer potential effects of stratospheric changes on the climate of the troposphere. In order to know how much confi dence can be placed in the results from the CCMs, both individually and collectively, it is necessary to assess their performance by comparison with observations and known physical constraints. The Stratospheric Processes And their Role in Climate (SPARC) core project of the World Climate Research Programme (WCRP) initiated the CCM Validation (CCMVal) activity in 2003 to coordinate exactly such an evaluation. The CCMVal concept (see Chapter 1) takes as a starting point the premise that model performance is most accurately assessed by examining the representation of key processes, rather than just the model’s ability to reproduce long-term ozone trends, as the latter can be more easily tuned and can include compensating errors. Thus a premium is placed on high-quality observations that can be used to assess the representation of key processes in the models. This Report does not provide a detailed assessment of the quality of the observational databases; the compilation and assessment of data sets suitable for model evaluation is the focus of a future SPARC activity, which has been motivated by this Report. The fi rst round of CCMVal (CCMVal-1) evaluated only a limited set of key processes in the CCMs, focusing mainly on dynamics and transport. This Report, which describes the second round of CCMVal (CCMVal-2), represents a more complete effort by CCMVal to assess CCM performance. As with CCMVal-1, it also includes an assessment of the extent to which CCMs are able to reproduce past observations in the stratosphere, and the future evolution of stratospheric ozone and climate under one particular scenario. A key aspect of the model evaluation within this Report is the application of observationally-based performance metrics to quantify the ability of models to reproduce key processes for stratospheric ozone and its impact on climate. The Report is targeted at a variety of users, including: (1) international climate science assessments, including the WMO/ UNEP Ozone Assessments and the IPCC Assessment Reports; (2) the CCM groups themselves; (3) users of CCM simulations; (4) measurement and process scientists who wish to help improve CCM evaluation; (5) space agencies and other bodies involved in the Global Climate Observing System. The Report was prepared by dozens of scientists and underwent several revisions and extensive peer review, culminating in a Final Review Meeting in Toledo, Spain on November 9-11, 2009.
    Pages: Online-Ressource (XXXVIII, 426 Seiten)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Keywords: distribution of snow, ice and glaciers ; glaciation ; ice ages ; glacier dynamics ; mass balance ; snowfall and snow cover
    Description / Table of Contents: The earth’s cryosphere, which includes snow, glaciers and ice caps, ice sheets, ice shelves, sea ice, river and lake ice, and frozen ground, contains about 75% of the earth’s fresh water. It exists at almost all latitudes, from the tropics to the poles, and plays a vital role in controlling the global climate system. It also provides direct visible evidence of the effect of climate change, and, therefore, requires proper understanding of the complex dynamics. This encyclopedia mainly focuses on the various aspects of snow, ice and glaciers, but also covers other cryospheric branches, and provides an up-to-date information and basic concepts on relevant topics. It includes alphabetically arranged and professionally written, comprehensive and authoritative academic articles by well-known international experts in individual fields. The encyclopedia contains a broad spectrum of topics, ranging from the atmospheric processes responsible for snow formation; transformation of snow to ice and changes in their properties; classification of ice and glaciers and their worldwide distribution; glaciation and ice ages; glacier dynamics; glacier surface and subsurface characteristics; geomorphic processes and landscape formation; hydrology and sedimentary systems; permafrost degradation; hazards caused by cryospheric changes; and trends of glacier retreat on the global scale along with the impact of climate change. This book can serve as a source of reference at the undergraduate and graduate level and help better understand snow, ice and glaciers. This will also be an indispensable tool containing specialized literature for geologists, geographers, climatologists, hydrologists, and water resources engineers; as well as to those who are engaged in the practice of agricultural and civil engineering, earth sciences, environmental sciences and engineering, ecosystem management, and other relevant subjects.
    Pages: Online-Ressource (XLVI, 1253 Seiten)
    ISBN: 9789048126422
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...