ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • Books  (919)
  • Online Books  (919)
  • 2010-2014  (901)
  • 1950-1954  (19)
Collection
  • Books  (919)
Source
Language
Years
Year
Branch Library
  • 1
    Monograph available for loan
    Monograph available for loan
    Paris : OECD
    Call number: PIK P 113-10-0202
    Description / Table of Contents: This joint IEA/NEA report on electricity generating costs presents the latest data available for a wide variety of fuels and technologies, including coal and gas (with and without carbon capture), nuclear, hydro, onshore and offshore wind, biomass, solar, wave and tidal as well as combined heat and power (CHP).  It provides levelised costs of electricity (LCOE) per MWh for almost 200 plants, based on data covering 21 countries (including four major non-OECD countries), and several industrial companies and organisations.  For the first time, the report contains an extensive sensitivit
    Type of Medium: Monograph available for loan
    Pages: 215 S. : graph. Darst.
    ISBN: 9789264084308
    Language: English
    Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    Journal available for loan
    Journal available for loan
    Tübingen : Mohr Siebeck ; 1.1884 - 48.1931; N.F. 1.1932/33 - 10.1943/44(1945),3; 11.1948/49(1949) -
    Call number: ZS 22.95039
    Type of Medium: Journal available for loan
    Pages: Online-Ressource
    ISSN: 1614-0974 , 0015-2218 , 0015-2218
    Language: German , English
    Note: N.F. entfällt ab 57.2000. - Volltext auch als Teil einer Datenbank verfügbar , Ersch. ab 2000 in engl. Sprache mit dt. Hauptsacht.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
    Call number: 9783034803960 (e-book)
    Type of Medium: 12
    Pages: 1 Online-Ressource (XI, 220 Seiten) , Illustrationen
    ISBN: 9783034803960 (e-book) , 978-3-0348-0396-0
    Language: English
    Note: Contents 1 High elevation treelines 1.1 The task 1.2 Previous works 2 Definitions and conventions 2.1 The life form ‘tree’ 2.2 Lines and transitions 2.3 Limitation, stress and disturbance 2.4 Altitude-related and other environmental drivers 2.5 Treeline nomenclature 3 Treeline patterns 3.1 Treeline taxa 3.2 The summit syndrome and other treeline depressions 3.3 Mass elevation effect 3.4 Treeline elevation 3.5 Time matters 3.6 Forest structure near treeline 4 Treeline climate 4.1 Specific aspects of treeline climatology 4.2 Criteria to define temperature regimes at treeline 4.3 Treeline temperatures in different bioclimatic regions 4.3.1 Subarctic and boreal zone (45–68° N) 4.3.2 Cool temperate zone (45–47° N, 44° S) 4.3.3 Warm temperate zone (28–42° N, 36° S) 4.3.4 Subtropical zone (19° S, 19° N) 4.3.5 Equatorial tropics (6° N to 3° S) 4.3.6 Mediterranean ‘treelines’ (38–42° N) 4.3.7 The Nothofagus and Metrosideros case 4.3.8 Treeline temperatures across bioclimatic zones 4.4 Seedbed and branch temperatures 4.5 Whole forest temperatures 5 Global mountain statistics based on treeline elevation 5.1 Mountain geostatistics 5.2 Elevational belts 5.3 Global treeline ecotones 6 Structure and stature of treeline trees 6.1 Foliage properties 6.2 Wood properties 6.3 Bark properties 6.4 Root traits 6.5 Tree stature 6.6 Dry matter allocation in treeline trees 7 Growth and development 7.1 Tree growth near the treeline 7.1.1 In situ growth of seedlings 7.1.2 In situ growth of saplings and adult trees 7.2 Xylogenesis at the treeline 7.2.1 In situ cambial activity 7.2.2 Apical growth dynamics 7.3 Root growth 7.4 Phenology at the treeline 8 Evolutionary adjustments to life at the treeline 8.1 Phylogenetic selection 8.2 Genotypic responses of growth and development 8.3 Genotypic responses of physiological traits 9 Reproduction, early life stages and tree demography 9.1 Amount and quality of seeds at high elevation 9.2 Germination, seedling and sapling stage 9.3 Tree demography at the treeline 10 Freezing and other forms of stress 10.1 Stress at the treeline in a fitness context 10.2 Mechanisms and principles of freezing resistance 10.3 Freezing resistance in treeline trees 10.4 Other forms of stress at the treeline 10.4.1 Freeze-thaw cycles and hydraulic failure 10.4.2 Winter desiccation 11 Water, nutrient and carbon relations 11.1 Tree water relations during the growing season 11.2 Nutrient relations 11.3 Carbon relations 12 Treeline formation - currently, in the past and in the future 12.1 Causes of current treelines 12.2 Treelines in the recent past 12.3 Treelines in the distant past (Holocene) 12.4 Treelines in the future References Subject Index Taxonomic Index
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 4
    facet.materialart.12
    facet.materialart.12
    Bremerhaven : Alfred-Wegener-Inst. für Polar- und Meeresforschung
    Associated volumes
    Call number: ZSP-168-631
    In: Berichte zur Polar- und Meeresforschung
    Description / Table of Contents: ANT-XXVI/4: 7 April -17 May 2010 Punta Arenas -Mindelo - Las Palmas - Bremerhaven
    Type of Medium: 12
    Pages: Online-Ressource
    Series Statement: Berichte zur Polar- und Meeresforschung 631
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    facet.materialart.12
    Cambridge : Cambridge University Press
    Call number: 9781107306189 (e-book)
    Description / Table of Contents: "The Earth is a dynamic system. Internal processes, together with external gravitational forces of the Sun, Moon and planets, displace the Earth's mass, impacting on its shape, rotation and gravitational field. Doug Smylie provides a rigorous overview of the dynamical behaviour of the solid Earth, explaining the theory and presenting methods for numerical implementation. Topics include advanced digital analysis, earthquake displacement fields, Free Core Nutations observed by the Very Long Baseline Interferometric technique, translational modes of the solid inner core observed by the superconducting gravimeters, and dynamics of the outer fluid core. This book is supported by freeware computer code, available online for students to implement the theory. Online materials also include a suite of graphics generated from the numerical analysis, combined with 100 graphic examples in the book to make this an ideal tool for researchers and graduate students in the fields of geodesy, seismology and solid earth geophysics"--
    Type of Medium: 12
    Pages: 1 Online-Ressource (XII, 543 Seiten) , Illustrationen
    Edition: Electronic reproduction. Ann Arbor, MI : ProQuest, 2015. Available via World Wide Web. Access may be limited to ProQuest affiliated libraries.
    ISBN: 9781107306189
    Language: English
    Note: Contents Preface and acknowledgments The book website www.cambridge.org/smylie 1 Introduction and theoretical background 1.1 Scalar, vector and tensor analysis 1.2 Separation of vector fields 1.3 Vector spherical harmonics 1.4 Elasticity theory 1.5 Linear algebraic systems 1.6 Interpolation and approximation 2 Time sequence and spectral analysis 2.1 Time domain analysis 2.2 Linear optimum Wiener filters 2.3 Frequency domain analysis 2.4 Fourier series and transforms 2.5 Power spectral density estimation 2.6 Maximum entropy spectral analysis 3 Earth deformations 3.1 Equilibrium equations 3.2 The reciprocal theorem of Betti 3.3 Radial equations: spheroidal and torsional 3.4 Dynamical equations 3.5 Solutions near the geocentre 3.6 Numerical integration of the radial equations 3.7 Fundamental, regular solutions in the inner core 4 Earth's rotation: observations and theory 4.1 Reference frames 4.2 Polar motion and wobble 4.3 The dynamics of polar motion and wobble 4.4 Nutation and motion of the celestial pole 5 Earth's figure and gravitation 5.1 Historical development 5.2 External gravity and figure 5.3 Equilibrium theory of the internal figure 5.4 Gravity coupling 6 Rotating fluids and the outer core 6.1 The inertial wave equation 6.2 Dynamics of the fluid outer core 6.3 Scaling of the core equations 6.4 Compressibility and density stratification 7 The subseisniic equation and boundary conditions 7.1 The subseismic wave equation 7.2 Deformation of the shell and inner core 8 Variational methods and core modes 8.1 A subseismic variational principle 8.2 Representation of the functional 8.3 Finite element support functions 8.4 Boundary conditions and constraints 8.5 Numerical implementation and results 8.6 Rotational splitting and viscosity 8.7 A viscosity profile for the outer core 9 Static deformations and dislocation theory 9.1 The elasticity theory of dislocations 9.2 The theory for realistic Earth models 9.3 Changes in the inertia tensor and the secular polar shift Appendix A Elementary results from vector analysis A.1 Vector identities A.2 Vector calculus identities A.3 Integral theorems Appendix B Properties of Legendre functions B.1 Recurrence relations B.2 Evaluation of Legendre functions Appendix C Numerical Earth models C.1 The Earth models References Fortran index Subject index
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    facet.materialart.12
    facet.materialart.12
    Berlin : De Gruyter Saur
    Call number: 9783110269550 (e-book)
    Description / Table of Contents: Das Buch bietet umfassende Hilfestellung für die verschiedensten Kommunikationssituationen zwischen Mitarbeitern und Kunden einer Bibliothek: Erstgespräch, Auskunftsinterview, Schulungs- und Konfliktsituationen, Beschwerden sowie Kundenorientierung. Jedes Kapitel beginnt mit einem konkreten Beispiel, an dem die Problematik der Situation analysiert wird. Zahlreiche Übungsaufgaben dienen dem Selbststudium. Tipps, Formulierungshilfen, Leitsätze und ein Gesprächsleitfaden machen das Buch zu einem einzigartigen Praxisratgeber für den bibliothekarischen Alltag. (Verlagstext)
    Type of Medium: 12
    Pages: 1 Online-Ressource (VII, 155 Seiten) , Illustrationen
    Edition: Electronic reproduction. Ann Arbor, MI : ProQuest, 2015. Available via World Wide Web. Access may be limited to ProQuest affiliated libraries.
    Series Statement: Praxiswissen
    Language: German
    Note: Inhalt 1 Einleitung 2 Der erste Eindruck - Das Anmeldegespräch 2.1 Ein Beispiel 2.2 Die Raumsituation 2.3 Die Kommunikationssituation mit Kunden 2.3.1 Gast und Gastgeber 2.3.2 Wir kommunizieren ständig 2.3.3 Wie wirke ich auf andere? 2.3.4 Beziehungs- und Sachaspekt der Kommunikation 2.3.5 Rolleneinnahme und Gesamthaltung der Bibliothek 2.4 Die Gesprächssituation 2.4.1 Augenhöhe und Respekt 2.4.2 Einstellen auf verschiedene Gesprächspartner 2.4.3 Der Gesprächsverlauf 2.4.4 Verständlichkeit und Anschaulichkeit 2.4.5 Schwierige Situationen im Anmeldegespräch 2.5 Vertiefung 3 Professionell beraten - Das Auskunftsgespräch 3.1 Ein Beispiel 3.2 Verantwortung im Gespräch übernehmen - Rollenklarheit 3.3 Reden wir über das Gleiche? 3.4 Durch die Phasen des Gesprächs steuern 3.4.1 Kontakt aufnehmen 3.4.2 Die Ausgangsfrage stellen 3.4.3 Nachfragen 3.4.4 Absichern 3.4.5 Lösungen entwickeln und anbieten 3.4.6 Vereinbarung treffen 3.4.7 Verabschieden 3.5 Die richtigen Fragen stellen 3.6 Störungen in der Auskunftssituation und die Etablierung von Standards 3.7 Tipps im Auskunftsgespräch 3.8 Vertiefung 4 Schulungen und Führungen entwickeln 4.1 Ein Beispiel 4.2 Lerntheoretische Hintergründe 4.2.1 Das Gedächtnis: Wie merken wir uns etwas? 4.2.2 Lerntypen: Wer lernt wie? 4.2.3 Lernpyramide: Mit welchen Lernmethoden lernen wir am effektivsten? 4.2.4 Die Hirnforschung: Wie lernt unser Gehirn am besten? 4.3 Modelle der Didaktik 4.3.1 Instruktionsorientierte Didaktik 4.3.2 Kompetenzorientierte Didaktik 4.4 Die Rolle der Lehrenden 4.5 Auftragsklärung 4.6 Die Konzeptentwicklung in sechs Schritten 4.6.1 Mit der Zielgruppe beschäftigen 4.6.2 Lernziele entwickeln 4.6.3 Themen sammeln und sortieren 4.6.4 Methodik festlegen 4.6.5 Lernkreislauf entwickeln 4.6.6 Dramaturgie und Zeitplan festlegen 4.7 Methodenpool 4.8 Schwierige Situationen in Schulungen 4.9 Wir lernen weiter: Eine Methode für das Schulungsteam 4.10 Vertiefung 5 Schwierige Situationen mit Kunden bewältigen 5.1 Ein Beispiel 5.2 Der Hintergrund 5.2.1 Ebenen der Kommunikation 5.2.2 Vier Reaktionsmöglichkeiten 5.2.3 Der Teufelskreis in der Kommunikation 5.3 Was lässt manche Menschen schwierig werden? 5.3.1 Ein Beispiel 5.3.2 Menschliche Bedürfnisse und Aggressionen 5.3.3 Wie wir den Konflikt betrachten - verschiedene Konfliktebenen 5.4 Das Dilemma der guten Mitarbeiterin 5.5 Die Entschärfung der Situation 5.6 Formulierungstipps - kleines Glossar der hilfreichen Worte 5.7 Kommunikative Basics für schwierige Situationen 5.7.1 So tun als ob 5.7.2 Distanz wahren 5.7.3 Die Flucht nach vornantreten 5.7.4 Verlierer und Schein-Sieger 5.7.5 Eigene Irrtümer vermeiden 5.8 Fallbeispiele 5.8.1 Typologie nach Fritz Riemann 5.8.2 Fünf Fälle und Handlungsmöglichkeiten 5.9 Deeskalationsstrategien - wenn es ganz schwierig wird 5.10 Vertiefung 6 Beschwerdemanagement in Bibliotheken 6.1 Ein Beispiel 6.2 Was ist Beschwerdemanagement? 6.3 Die Komponenten eines Beschwerdemanagement-Systems 6.3.1 Beschwerdestimulierung 6.3.2 Beschwerdekanäle 6.3.3 Beschwerdeannahme 6.3.4 Beschwerdebearbeitung 6.3.5 Beschwerdereaktion 6.3.6 Beschwerdeauswertung 6.3.7 Beschwerdereporting (öffentlich) 6.4 Die Kommunikationssituation der Beschwerde 6.4.1 Worüber beschweren sich Kunden der Bibliothek? 6.4.2 Beschwerdeschreiben verstehen und beantworten 6.4.3 Unzufriedenheit und Schweregrad der Beschwerde 6.4.4 Die Entschärfung der Situation 6.4.5 Ein Gesprächsleitfaden für Beschwerdegespräche 6.4.6 Deeskalieren 6.4.7 Tipps für die Gesprächssituation 6.4.8 Mitarbeiter einbeziehen und schulen 6.5 Vertiefung 7 Kundenorientierung in der Bibliothek 7.1 Ein Beispiel 7.2 Was heißt Kundenorientierung in der Bibliothek? 7.3 Vom Nutzer zum Kunden 7.4 Von der Produkt- zur Kundenorientierung 7.5 Ein Gesamtkonzept zur Einführung von Kundenorientierung 7.6 Eins greift ins andere - Kundenzentrierung und Mitarbeiterorientierung 7.7 Gemeinsame Verhaltensstandards einführen 7.7.1 Was sind Leistungsstandards 7.7.2 Kontaktsituationen mit Kunden und mögliche Verhaltensstandards 7.8 Damit alle an einem Strang ziehen 7.9 Vertiefung 8 Sicher und gewandt auftreten 8.1 Ein Beispiel 8.2 Die eigene Einstellung 8.2.1 Persönliche Denkmuster 8.2.2 Innere Dialoge 8.3 Woran wir arbeiten können - das rhetorische Handwerkszeug 8.4 Sicheres Auftreten braucht Übung 8.5 Erklären und überzeugen 8.6 Anschaulich und lebendig sprechen 8.7 Präsenz zeigen 8.8 Stimmlich überzeugen 8.9 Lampenfieber - die Spannung nutzen 8.10 Vertiefung Literatur und Internet-Links Sachregister Über die Autorin
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Call number: 9781630810504 (e-book)
    Type of Medium: 12
    Pages: 1 Online-Ressource (1.014 Seiten) , Illustrationen
    ISBN: 9781630810504 (e-book)
    Language: English
    Note: CONTENTS Preface Photo Credits Computer Codes 1 Introduction 1-1 Why Microwaves for Remote Sensing? 1-2 A Brief Overview of Microwave Sensors 1-3 A Short History of Microwave Remote Sensing 1-3.1 Radar 1-3.2 Radiometers 1-4 The Electromagnetic Spectrum 1-5 Basic Operation and Applications of Radar 1-5.1 Operation of Remote-Sensing Radars 1-5.2 Applications of Remote-Sensing Radars 1-6 Basic Operation and Applications of Radiometers 1-6.1 Radiometer Operation 1-6.2 Applications of Microwave Radiometry 1-7 Image Examples 2 Electromagnetic Wave Propagation 2-1 EM Plane Waves 2-1.1 Constitutive Parameters 2-1.2 Maxwell's Equations 2-1.3 Complex Permittivity 2-1.4 Wave Equations 2-2 Plane-Wave Propagation in Lossless Media 2-2.1 Uniform Plane Waves 2-2.2 General Relation between E and H 2-3 Wave Polarization in a Lossless Medium 2-3.1 Linear Polarization 2-3.2 Circular Polarization 2-3.3 Elliptical Polarization 2-4 Plane Wave Propagation in Lossy Media 2-4.1 Low Loss Dielectric 2-4.2 Good Conductor 2-5 Electromagnetic Power Density 2-5.1 Plane Wave in a Lossless Medium 2-5.2 Plane Wave in a Lossy Medium 2-5.3 Decibel Scale tor Power Ratios 2-6 Wave Reflection and Transmission at Normal Incidence 2-6.1 Boundary between Lossless Media 2-6.2 Boundary between Lossy Media 2-7 Wave Reflection and Transmission at Oblique Incidence 2-7.1 Horizontal Polarization—Lossless Media 2-7.2 Vertical Polarization 2-8 Reflectivity and Transmissivity 2-9 Oblique Incidence onto a Lossy Medium 2- 10 Oblique Incidence onto a Two-Layer Composite 2-10.1 Input Parameters 2-10.2 Propagation Matrix Method 2-10.3 Multiple Reflection Method 3 Remote-Sensing Antennas 3-1 The Hertzian Dipole 3-2 Antenna Radiation Characteristics 3-2.1 Antenna Pattern 3-2.2 Beam Dimensions 3-2.3 Antenna Directivity 3-2.4 Antenna Gain 3-2.5 Radiation Efficiency 3-2.6 Effective Area of a Receiving Antenna 3-3 Friis Transmission Formula 3-4 Radiation by Large-Aperture Antennas 3-5 Rectangular Aperture with Uniform Field Distribution 3-5.1 Antenna Pattern in x-y Plane 3-5.2 Beamwidth 3-5.3 Directivity and Effective Area 3-6 Circular Aperture with Uniform Field Illumination 3-7 Nonuniform-Amplitude Illumination 3-8 Beam Efficiency 3-9 Antenna Arrays 3-10 N-Element Array with Uniform Phase Distribution 3-10.1 Uniform Amplitude Distribution 3-10.2 Grating Lobes 3-10.3 Binomial Distribution 3-11 Electronic Scanning of Arrays 3-12 Antenna Types 3-12.1 Horn Antennas 3-12.2 Slot Antennas 3-12.3 Microstrip Antennas 3-13 Active Antennas 3-13.1 Advantages of Active Antennas 3-13.2 Digital Beamforming with Active Antennas 4 Microwave Dielectric Properties of Natural Earth Materials 4-1 Pure-Water Single-Debye Dielectric Model (f 〈 50 GHz) 4-2 Saline-Water Double-Debye Dielectric Model (f〈 1000 GHz) 4-3 Dielectric Constant of Pure Ice 4-4 Dielectric Mixing Models for Heterogeneous Materials 4-4.1 Randomly Oriented Ellipsoidal Inclusions 4-4.2 Polder-van Santen/de Loor Formulas 4-4.3 Tinga-Voss-Blossey (TVB) Formulas 4-4.4 Other Dielectric Mixing Formulas 4-5 Sea Ice 4-5.1 Dielectric Constant of Brine 4-5.2 Brine Volume Fraction 4-5.3 Dielectric Properties 4-6 Dielectric Constant of Snow 4-6.1 Dry Snow 4-6.2 Wet Snow 4-7 Dielectric Constant of Dry Rocks 4-7.1 Powdered Rocks 4-7.2 Solid Rocks 4-8 Dielectric Constant of Soils 4-8.1 Dry Soil 4-8.2 Wet Soil 4-8.3 εsoil in 0.3-1.5 GHz Band 4-9 Dielectric Constant of Vegetation 4-9.1 Dielectric Constant of Canopy Constituents 4-9.2 Dielectric Model 5 Radar Scattering 5-1 Wave Polarization in a Spherical Coordinate System 5-2 Scattering Coordinate Systems 5-2.1 Forward Scattering Alignment (FSA) Convention 5-2.2 Backscatter Alignment (BSA) Convention 5-3 Scattering Matrix 5-3.1 FSA Convention 5-3.2 BSA Convention 5-3.3 Stokes Parameters and Mueller Matrix 5-4 Radar Equation 5-5 Scattering from Distributed Targets 5-5.1 Narrow-Beam Scatterometer 5-5.2 Imaging Radar 5-5.3 Specific Intensities for Distributed Target 5-6 RCS Statistics 5-7 Rayleigh Fading Model 5-7.1 Underlying Assumptions 5-7.2 Linear Detection 5-7.3 Square-Law Detection 5-7.4 Interpretation 5-8 Multiple Independent Samples 5-8.1 N-Look Amplitude Image 5-8.2 N-Look Intensity Image 5-8.3 N-Look Square-Root Intensity Image 5-8.4 Spatial Resolution vs. Radiometric Resolution 5-8.5 Applicability of the Rayleigh Fading Model 5-9 Image Texture and Despeckle Filtering . 5-9.1 Image Texture 5-9.2 Despeckling Filters 5-10 Coherent and Noncoherent Scattering 5-10.1 Surface Roughness 5-10.2 Bistatic Scattering 5-10.3 Specular Reflectivity 5-10.4 Bistatic-Scattering Coefficient 5-10.5 Backscattering Response of a Smooth Surface 5-11 Polarization Synthesis 5-11.1 RCS Polarization Response 5-11.2 Distributed Targets 5-11.3 Mueller Matrix Approach 5-12 Polarimetric Scattering Statistics 5-13 Polarimetric Analysis Tools 5-13.1 Scattering Covariance Matrix 5-13.2 Eigenvector Decomposition 5-13.3 Useful Polarimetric Parameters 5-13.4 Image Examples 5-13.5 Freeman-Durden Decomposition 6 Microwave Radiometry and Radiative Transfer 6-1 Radiometric Quantities 6-2 Thermal Radiation 6-2.1 Quantum Theory of Radiation 6-2.2 Planck's Blackbody Radiation Law 6-2.3 The Rayleigh-Jeans Law 6-3 Power-Temperature Correspondence 6-4 Radiation by Natural Materials 6-4.1 Brightness Temperature 6-4.2 Brightness Temperature Distribution 6-4.3 Antenna Temperature 6-5 Antenna Efficiency Considerations 6-5.1 Beam Efficiency 6-5.2 Radiation Efficiency 6-5.3 Radiometer Measurement Ambiguity 6-6 Theory of Radiative Transfer 6-6.1 Equation of Radiative Transfer 6-6.2 Brightness-Temperature Equation 6-6.3 Brightness Temperature of a Stratified Medium 6-6.4 Brightness Temperature of a Scatter-Free Medium 6-6.5 Upwelling and Downwelling Atmospheric Brightness Temperatures 6-7 Terrain Brightness Temperature 6-7.1 Brightness Transmission Across a Specular Boundary 6-7.2 Emission by a Specular Surface 6-7.3 Emissivity of a Rough Surface 6-7.4 Extreme Surface Conditions 6-7.5 Emissivity of a Two-Layer Composite 6-8 Downward-Looking Satellite Radiometer 6-9 Polarimetric Radiometry 6-10 Stokes Parameters and Periodic Structures 7 Microwave Radiometric Systems 7-1 Equivalent Noise Temperature 7-2 Characterization of Noise 7-2.1 Noise Figure 7-2.2 Equivalent Input Noise Temperature 7-2.3 Noise Temperature of a Cascaded System 7-2.4 Noise Temperature of a Lossy Two-Port Device 7-3 Receiver and System Noise Temperatures 7-3.1 Receiver Alone 7-3.2 Total System Including Antenna 7-4 Radiometer Operation 7-4.1 Measurement Accuracy 7-4.2 Total-Power Radiometer 7-4.3 Radiometric Resolution 7-5 Effects of Receiver Gain Variations 7-6 Dicke Radiometer 7-7 Balancing Techniques 7-7.1 Reference-Channel Control Method 7-7.2 Antenna-Channel Noise-Injection Method 7-7.3 Pulsed Noise-Injection Method 7-7.4 Gain-Modulation Method 7-8 Automatic-Gain-Control (AGC) Techniques 7-9 Noise-Adding Radiometer 7-10 Summary of Radiometer Properties 7-11 Radiometer Calibration Techniques 7-11.1 Receiver Calibration 7-11.2 Calibration Sources 7-11.3 Effects of Impedance Mismatches 7-11.4 Antenna Calibration 7-11.5 Cryoload Technique 7-11.6 Bucket Technique 7-12 Imaging Considerations 7-12.1 Scanning Configurations 7-12.2 Radiometer Uncertainty Principle 7-13 Interferometric Aperture Synthesis 7-13.1 Image Reconstruction 7-13.2 MIR Radiometric Sensitivity 7-14 Polarimetric Radiometer 7-14.1 Coherent Detection 7-14.2 Incoherent Detection 7-15 Calibration of Polarimetric Radiometers 7-15.1 Forward Model for a Fully Polarimetric Radiometer 7-15.2 Forward Model for the Polarimetric Calibration Source 7-15.3 Calibration by Inversion of the Forward Models 7-16 Digital Radiometers 8 Microwave Interaction with Atmospheric Constituents 8-1 Standard Atmosphere 8-1.1 Atmospheric Composition 8-1.2 Temperature Profile 8-1.3 Density Profile 8-1.4 Pressure Profi
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Call number: M 20.94085
    Type of Medium: Monograph available for loan
    Pages: v, 146 Seiten , Graphiken
    Language: English
    Note: Dissertation
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    facet.materialart.12
    Oxford [u.a.] : Oxford Univ. Press
    Call number: 9780191758317 (e-book)
    Description / Table of Contents: This invaluable dictionary covers all aspects of statistics, including terms used in computing, mathematics, and probability, presented in a clear and practical way. It also provides biographical entries on over 200 key figures in the field, plus coverage of statistical journals and societies. The new edition features expanded coverage of applied statistics. Entries are complemented by over 120 figures and diagrams, and many provide worked examples. Wide-ranging appendices include a historical calendar of important statistical events, lists of statistical and mathematical notation, and statistical tables. It also features recommended web links for many entries, which provide valuable extra information. It is an invaluable dictionary for statistics students and professionals from a wide range of disciplines, including economics, politics, market research, medicine, psychology, pharmaceuticals, and mathematics, and provides a clear introduction to the subject for the general reader.
    Type of Medium: 12
    Pages: Online-Ressource , 488 S. , graph. Darst.
    Edition: 3. ed.
    ISBN: 9780191758317 (Online) , 9780199679188 (Print)
    Series Statement: Oxford paperback reference
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Monograph available for loan
    Monograph available for loan
    Dordrecht : Springer
    Call number: PIK B 020-22-94723
    Description / Table of Contents: The book focusses on questions of individual and collective action, the emergence and dynamics of social norms and the feedback between individual behaviour and social phenomena. It discusses traditional modelling approaches to social norms and shows the usefulness of agent-based modelling for the study of these micro-macro interactions. Existing agent-based models of social norms are discussed and it is shown that so far too much priority has been given to parsimonious models and questions of the emergence of norms, with many aspects of social norms, such as norm-change, not being modelled.  Juvenile delinquency, group radicalisation and moral decision making are used as case studies for agent-based models of collective action extending existing models by providing an embedding into social networks, social influence via argumentation and a causal action theory of moral decision making. The major contribution of the book is to highlight the multifaceted nature of the dynamics of social norms, consisting not only of emergence, and the importance of embedding of agent-based models into existing theory. 
    Type of Medium: Monograph available for loan
    Pages: 215 Seiten
    Edition: Online edition Springer eBook Collection. Humanities, Social Sciences and Law
    ISBN: 978-94-017-8514-3
    Language: English
    Note: IntroductionTheorising Norms -- Theorising Crime -- Agent-based Modelling -- The Environment and Social Norms -- Punishment and Social Norms -- Imitation and Social Norms -- Socially Situated Social Norms -- Internalisation and Social Norms -- Modelling Norms -- Delinquent Networks -- Social Construction of Knowledge -- Morality -- We-Intentionality -- Conclusion -- Index..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    Call number: 9781629487991 (e-book)
    Description / Table of Contents: This book described the current status and possible future changes of the thermokarst (thaw) lakes of western Siberia as dominant forms of landscape and regulators of greenhouse gas exchange within the atmosphere. Thawing permafrost and resulting microbial decomposition of previously frozen organic carbon is one of the most significant terrestrial ecosystem positive feedbacks to a warming climate. Ongoing processes of the permafrost thawing in Western Siberia are likely to increase the surface of water bodies via forming so-called thermokarst lakes, mobilizing the organic carbon (OC) from the soil pool to the rivers and, finally, to the ocean, and thus modifying the fluxes of methane (CH4) and CO2 to the atmosphere. Despite their tremendous importance for green house gazes regulation and hydrological regime control, very little is known about hydrochemistry of western Siberia thaw lakes. This book assesses the variation of major and trace elements (TE) and organic carbon (OC) concentration along the chronosequence of lake development and the latitude profile of variable permafrost abundance; characterizes the colloidal status of TE and distinguishes between the relative proportion of organic and organo-mineral colloids; describes the particularity of microbiological composition of thermokarst lake waters and production/mineralization processes in the water column; and presents the perspective of water chemical composition evolution under the climate change scenario. Each of these aforementioned objectives present a scientific challenge given mainly the paucity of existing information on these important but still very poorly studied ecosystems. Taken together, understanding of these issues and identification and quantification of controlling environmental parameters should produce conceptually new knowledge of biogeochemical processes operating within the Western Siberia Plain with the possibility of extrapolation of generated knowledge to much larger territories of arctic and subarctic permafrost-affected areas. (Imprint: Nova)
    Type of Medium: 12
    Pages: 1 Online-Ressource (179 Seiten) , Illustrationen
    ISBN: 9781629487991 (e-book)
    Series Statement: Biochemistry research trends
    Language: English
    Note: Table of Contents Introduction: Thermokarst Lakes of Western Siberia as Dominant Forms of Landscape and Regulators of Greenhouse Gas Exchange with the Atmosphere Chapter 1. Thermokarst Lakes: Distribution, Cycle of Development, Surface Coverage and Evolution Chapter 2. Sources of Dissolved Components in Thermokarst Lakes Chapter 3. Temperature and Gas Regime Chapter 4. Dissolved Organic Carbon Chapter 5. Microbiology of Thermokarst Lake Systems Chapter 6. Trace Elements in Thermokarst Lakes Chapter 7. Colloids in Thermokarst Lakes Chapter 8. Latitude Profile Gradients of Lakes: Substituting Space for Time Chapter 9. Possible Impact of Climate Warming on Stocks and Fluxes of Carbon and Related Elements in Western Siberian Lakes Conclusions: Thaw Lakes as Indicators of Climate Change References Index
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
    facet.materialart.12
    Chichester, [England] : Wiley
    Call number: 9781444328479 (e-book)
    Type of Medium: 12
    Pages: 1 Online-Ressource (XIII, 768 Seiten) , Illustrationen
    Edition: Second edition
    ISBN: 9781444328479 (e-book) , 978-1-4443-2847-9
    Language: English
    Note: Contents Contents Preface Acknowledgements Part 1: Making Sediment Introduction Clastic sediment as a chemical and physical breakdown product 1.1 Introduction: clastic sediments—'accidents' of weathering 1.2 Silicate minerals and chemical weathering 1.3 Solute flux: rates and mechanisms of silicate chemical weathering 1.4 Physical weathering 1.5 Soils as valves and filters for the natural landscape 1.6 Links between soil age, chemical weathering and weathered-rock removal 1.7 Provenance: siliciclastic sediment-sourcing Further reading 2 Carbonate, siliceous, iron-rich and evaporite sediments 2.1 Marine vs. freshwater chemical composition and fluxes 2.2 The calcium carbonate system in the oceans 2.3 Ooid carbonate grains 2.4 Carbonate grains from marine plants and animals 2.5 Carbonate muds, oozes and chalks 2.6 Other carbonate grains of biological origins 2.7 Organic productivity, sea-level and atmospheric controls of biogenic CaCO3 deposition rates 2.8 CaCO3 dissolution in the deep ocean and the oceanic CaCO3 compensation mechanism 2.9 The carbonate system on land 2.10 Evaporite salts and their inorganic precipitation as sediment 2.11 Silica and pelagic plankton 2.12 Iron minerals and biomineralizers 2.13 Desert varnish 2.14 Phosphates 2.15 Primary microbial-induced sediments: algal mats and stromatolites Further reading 3 Sediment grain properties 3.1 General 3.2 Grain size 3.3 Grain-size distributions 3.4 Grain shape and form 3.5 Bulk properties of grain aggregates Further reading Part 2: Moving Fluid Introduction 4 Fluid basics 4.1 Material properties of fluids 4.2 Fluid kinematics 4.3 Fluid continuity with constant density 4.4 Fluid dynamics 4.5 Energy, mechanical work and power Further reading 5 Types of fluid motion 5.1 Osborne Reynolds and flow types 5.2 The distribution of velocity in viscous flows: the boundary layer 5.3 Turbulent flows 5.4 The structure of turbulent shear flows 5.5 Shear flow instabilities, flow separation and secondary currents 5.6 Subcritical and supercritical flows: the Froude number and hydraulic jumps 5.7 Stratified flow generally 5.8 Water waves 5.9 Tidal flow—long-period waves Further reading Part 3: Transporting Sediment Introduction 6 Sediment in fluid and fluid flow—general 6.1 Fall of grains through stationary fluids 6.2 Natural flows carrying particulate material are complex 6.3 Fluids as transporting machines 6.4 Initiation of grain motion 6.5 Paths of grain motion 6.6 Categories of transported sediment 6.7 Some contrasts between wind and water flows 6.8 Cohesive sediment transport and erosion 6.9 A warning: nonequilibrium effects dominate natural sediment transport systems 6.10 Steady state, deposition or erosion: the sediment continuity equation and competence vs. capacity Further reading 7 Bedforms and sedimentary structures in flows and under waves 7.1 Trinity of interaction: turbulent flow, sediment transport and bedform development 7.2 Water-flow bedforms 7.3 Bedform phase diagrams for water flows 7.4 Water flow erosional bedforms on cohesive beds 7.5 Water wave bedforms 7.6 Combined flows: wave-current ripples and hummocky cross-stratification 7.7 Bedforms and structures formed by atmospheric flows Further reading 8 Sediment gravity flows and their deposits 8.1 Introduction 8.2 Granular flows 8.3 Debris flows 8.4 Turbidity flows 8.5 Turbidite evidence for downslope transformation from turbidity to debris flows Further reading 9 Liquefaction, fluidization and sliding sediment deformation 9.1 Liquefaction 9.2 Sedimentary structures formed by and during liquefaction 9.3 Submarine landslides, growth faults and slumps 9.4 Desiccation and synaeresis shrinkage structures Further reading Part 4: Major External Controls on Sedimentation and Sedimentary Environments Introduction 10 Major external controls on sedimentation 10.1 Climate 10.2 Global climates: a summary 10.3 Sea-level changes 10.4 Tectonics 10.5 Sediment yield, denudation rate and the sedimentary record Further reading Part 5: Continental Sedimentary Environments Introduction 11 Rivers 11.1 Introduction 11.2 River networks, hydrographs,patterns and long profiles 11.3 Channel form 11.4 Channel sediment transport processes, bedforms and internal structures 11.5 The floodplain 11.6 Channel belts, alluvial ridges and avulsion 11.7 River channel changes, adjustable variables and equilibrium 11.8 Alluvial architecture: product of complex responses 11.9 Alluvial architecture: scale, controls and time Further reading 12 Subaerial Fans: Alluvial and Colluvial 12.1 Introduction 12.2 Controls on the size (area) and gradient of fans 12.3 Physical processes on alluvial fans 12.4 Debris-flow-dominated alluvial fans 12.5 Stream-flow-dominated alluvial fans 12.6 Recognition of ancient alluvial fans and talus cones Further reading 13 Aeolian Sediments in Low-Latitude Deserts 13.1 Introduction 13.2 Aeolian system state 13.3 Physical processes and erg formation 13.4 Erg margins and interbedform areas 13.5 Erg and draa evolution and sedimentary architecture 13.6 Erg construction, stasis and destruction: climate and sea-level controls 13.7 Ancient desert facies Further reading 14 Lakes 14.1 Introduction 14.2 Lake stratification 14.3 Clastic input by rivers and the effect of turbidity currents 14.4 Wind-forced physical processes 14.5 Temperate lake chemical processes and cycles 14.6 Saline lake chemical processes and cycles 14.7 Biological processes and cycles 14.8 Modern temperate lakes and their sedimentary facies 14.9 Lakes in the East African rifts 14.10 Lake Baikal 14.11 The succession of facies as lakes evolve 14.12 Ancient lake facies Further reading 15 Ice 15.1 Introduction 15.2 Physical processes of ice flow 15.3 Glacier flow, basal lubrication and surges 15.4 Sediment transport, erosion and deposition by flowing ice 15.5 Glacigenic sediment: nomenclature and classification 15.6 Quaternary and modern glacial environments and facies 15.7 Ice-produced glacigenic erosion and depositional facies on land and in the periglacial realm 15.8 Glaciofluvial processes on land at and within the ice-front 15.9 Glacimarine environments 15.10 Glacilacustrine environments 15.11 Glacial facies in the pre-Quaternary geological record: case of Cenozoic Antarctica Further reading Part 6: Marine Sedimentary Environments Introduction 16. Estuaries 16.1 Introduction 16.2 Estuarine dynamics 16.3 Modern estuarine morphology and sedimentary environments 16.4 Estuaries and sequence stratigraphy Further reading 17. River and Fan Deltas 17.1 Introduction to river deltas 17.2 Basic physical processes and sedimentation at the river delta front 17.3 Mass movements and slope failure on the subaqueous delta 17.4 Organic deposition in river deltas 17.5 River delta case histories 17.6 River deltas and sea-level change 17.7 Ancient river delta deposits 17.8 Fan deltas Further reading 18. Linear Siliciclastic Shorelines 18.1 Introduction 18.2 Beach processes and sedimentation 18.3 Barrier-inlet-spit systems and their deposits 18.4 Tidal flats, salt marsh and chenier ridges 18.5 Ancient clastic shoreline facies Further reading 19 Siliciclastic Shelves 19.1 Introduction: shelf sinks and lowstand bypass 19.2 Shelf water dynamics 19.3 Holocene highstand shelf sediments: general 19.4 Tide-dominated, low river input, highstand shelves 19.5 Tide-dominated, high river input, highstand shelves 19.6 Weather-dominated highstand shelves Further reading 20 Calcium-carbonate-evaporite Shorelines, Shelves and Basins 20.1 Introduction: calcium carbonate 'nurseries' and their consequences 20.2 Arid carbonate tidal flats, lagoons and evaporite sabkhas 20.3 Humid carbonate tidal flats and marshes 20.4 Lagoons and bays 20.5 Tidal delta and margin-spillover carbonate tidal sands 20.6 Open-shelf carbonate ramps 20.7 Platform margin reefs and carbonate build-ups 20.8 Platform margin slopes and basins 20.9 Carbonate sediments, cycles and sea-level change 20.10 Displacement and destruction of carbonate environments: silicicl
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 13
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 14
    Monograph available for loan
    Monograph available for loan
    Princeton : Princeton University Press
    Call number: PIK E 713-15-0146
    Description / Table of Contents: As countless love songs, movies, and self-help books attest, men and women have long sought different things. The result? Seemingly inevitable conflict. Yet we belong to the most cooperative species on the planet. Isn't there a way we can use this capacity to achieve greater harmony and equality between the sexes? In The War of the Sexes, Paul Seabright argues that there is--but first we must understand how the tension between conflict and cooperation developed in our remote evolutionary past, how it shaped the modern world, and how it still holds us back, both at home and at work. 〈
    Type of Medium: Monograph available for loan
    Pages: XI, 241 S. : Ill.
    ISBN: 9780691159720
    Language: English
    Note: Cover; Title Page; Copyright Page; Dedication Page; Table of Contents; Acknowledgments; Part One: Prehistory; 1. Introduction; 2. Sex and Salesmanship; 3. Seduction and the Emotions; 4. Social Primates; Part Two: Today; 5. Testing for Talent; 6. What Do Women Want?; 7. Coalitions of the Willing; 8. The Scarcity of Charm; 9. The Tender War; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Monograph available for loan
    Monograph available for loan
    Princeton : Princeton University Press
    Call number: PIK D 020-15-0143 ; IASS 15.89713
    Description / Table of Contents: Complexity science-made possible by modern analytical and computational advances-is changing the way we think about social systems and social theory. Unfortunately, economists' policy models have not kept up and are stuck in either a market fundamentalist or government control narrative. While these standard narratives are useful in some cases, they are damaging in others, directing thinking away from creative, innovative policy solutions. Complexity and the Art of Public Policy outlines a new, more flexible policy narrative, which envisions society as a complex evolving system that is uncont
    Type of Medium: Monograph available for loan
    Pages: VIII, 310 S.
    ISBN: 9780691152097
    Language: English
    Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; PART I. THE COMPLEXITY FRAME FOR POLICY; Chapter 1. Twin Peaks; Chapter 2. Government With, Not Versus, the Market; Chapter 3. I Pencil Revisited: Beyond Market Fundamentalism; Chapter 4. The Complexity Policy Frame; PART II. EXPLORING THE FOUNDATIONS; Chapter 5. How Economics Lost the Complexity Vision; Chapter 6. How Macroeconomics Lost the Complexity Vision; Chapter 7. Complexity: A New Kind of Science?; Chapter 8: A New Kind of Complexity Economics?; Chapter 9. Nudging toward a Complexity Policy Frame. , PART III. LAISSEZ-FAIRE ACTIVISM IN PRACTICEChapter 10. The Economics of Influence; Chapter 11. Implementing Influence Policy; Chapter 12. Laissez-Faire Activism; Chapter 13. Getting the Ecostructure of Government Right; PART IV. THE LOST AGENDA; Chapter 14. Getting the Ecostructure of Social Science Education Right; Chapter 15. The Lost Agenda; Notes; Bibliography; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    Monograph available for loan
    Monograph available for loan
    Cambridge : Green Books
    Call number: IASS 15.89662
    Description / Table of Contents: 〈div〉Is flying an irreplaceable part of 21st-century life? Flying is never zero-carbon, so can we reduce it, or even do without it? Can businesses succeed in a globalized world without international air travel? What about ?love miles' ? visiting friends and family overseas? Fourteen authors from around the world ? lawyers, journalists, scientists, architects ? share their travel stories about life and work ?beyond flying', offering us an inspiring catalogue of reasons to fly less, some great ways of switching to sustainable choices, and the delights of richer travel experiences.〈/div〉
    Type of Medium: Monograph available for loan
    Pages: 204 p.
    ISBN: 9780857842091
    Parallel Title: Print version: Beyond Flying : Rethinking air travel in a globally connected world
    Language: English
    Note: Front cover; Title page; Copyright page; Contents; Dedication; Friends of the Earth: rethinking travel; Foreword; Preface; Introduction; PART 1: THINKING BEYOND FLYING; Chapter 1: To fly or not to fly?; Chapter 2: Deciding never to fly again; Chapter 3: Young people and climate change; Chapter 4: Waking up to the downsides of flying; Chapter 5: Slow and low - the way to go: a systems view of travel emissions; PART 2: BUSINESS BEYOND FLYING; Chapter 6: A green travel experiment; Chapter 7: Trains versus planes: building a low-carbon travel agency. , Chapter 8: Going cold turkey: a law practice without any flightsChapter 9: The no-flying conference: Signs of Change; Chapter 10: Slowlier than thou: why flight-free travel is about better, not less; PART 3: SAVOURING THE JOURNEY; Chapter 11: The human engine: bicycling to Beijing; Chapter 12: Walking distance; Chapter 13: bike2oz: the world going through you instead of around you; Chapter 14: A small matter of distance: trying not to fly to climate talks; Chapter 15: Travel on a hot planet: exploring the global tourist industry overland; How to fly less; Index; Other Green Books titles. , About Green Books.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
    Unknown
    Chicago : Precision Wordage Press
    Call number: 22/M 15.89567 (1. Ex.) ; 22/M 15.89567 (2. Ex.) ; 22/M 15.89567 (3. Ex.) ; 22/M 15.89567 (4. Ex.) ; 22/M 15.89567 (5. Ex.) ; 22/M 15.89567 (6. Ex.) ; 22/M 15.89567 (7. Ex.) ; 22/M 15.89567 (8. Ex.) ; 22/M 15.89567 (9. Ex.) ; 22/M 15.89567 (10. Ex.)
    Description / Table of Contents: Drawing from his own experience with corporations both large and small and as a business owner, Jack Molisani has seen every mistake the professional (or not-so-professional) can make in today's highly competitive job market. This book provides the tools for navigating these choppy waters. Starting with how to escape a dead-end job or an overbearing boss, to advancing one's career, and finally to achieving a higher standard of living, the book is divided into sections on finding new directions, making things happen, and optimizing the results. While most business guides focus on either job hun
    Pages: Online-Ressource (111 p)
    Edition: Online-Ausg.
    ISBN: 9780962709029
    Parallel Title: Print version: Be the Captain of Your Career : A New Approach to Career Planning and Advancement
    Language: English
    Note: Cover; Copyright; Praise; Introduction; Contents; Section 1: THINK IT; The First Thing to Do When You Find Yourself in a Hole: Stop Digging; Stay Positive; Never Lose Faith; Seven Career Lessons I Learned from Selling Ginsu Knives; A Turning Point; Stop. Breathe. Think. Then Act.; Overcoming Inertia; Overcoming Fear; Keep Swimming; Section 2: DO IT; What Is a Resume?; What Are Managers Looking For?; Dirty Little Resume Secrets; The T-Bomb; Current Experience; What You Do Is More Important than What You're Called; The Top Ten Mistakes Professionals Make When Looking for Work. , Resumes: A SummaryCover Your Letter; Following Up; Getting Interviews; Be Proactive; Be Visible; Social Networking; Four Critical Steps to Getting a Job Offer; Send Out Ships; Gold Calling; Section 3: HAVE IT; Creating the Path; Recession-Proof Your Career; Creating a PR Campaign; Taking the Initiative; Increase Your Ability to Find Work; Advancing Your Career through Personal Branding; Advancing Your Career through Progressive Information Disclosure; Honing Your Workplace Negotiation Skills; The Sky's the Limit; What Are You Waiting For?; About Making Money; Creating the Life You Want. , Recommended ReadingAbout the Author.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 18
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: M 16.89855
    Description / Table of Contents: The first global overview of intraplate earthquakes, their mechanical models and investigative geophysical techniques, for academic researchers, professionals and engineers
    Type of Medium: Monograph available for loan
    ISBN: 9781107040380
    Parallel Title: Print version: Intraplate Earthquakes
    Language: English
    Note: Cover; Half title; Title; Copyright; Contents; Contributors; Preface; 1 Introduction; 2 Intraplate earthquakes in Australia; 2.1 Introduction; 2.2 Two centuries of earthquake observations in Australia; 2.2.1 Mechanism, geographic distribution, and strain rate; 2.2.2 Seismogenic depth; 2.2.3 Attenuation and scaling relations; 2.3 A long-term landscape record of large (morphogenic) earthquakes; 2.3.1 Variation in fault scarp length and vertical displacement; 2.3.2 The influence of crustal type and character on seismic activity rates; 2.4 Patterns in earthquake occurrence. , 2.5 Maximum magnitude earthquake2.5.1 Scarp length as a proxy for paleo-earthquake magnitude; 2.6 Implications for SCR analogue studies: factors important in earthquake localisation; 2.6.1 Mechanical and thermal influences; 2.6.2 Structural architectural influences; 2.7 Conclusions; Acknowledgements; 3 Intraplate seismicity in Brazil; 3.1 Introduction; 3.2 Earthquake catalogue; 3.3 Seismicity map; 3.4 Seismotectonic correlations; 3.4.1 Lower seismicity in Precambrian cratonic provinces; 3.4.2 Intraplate seismicity and cratonic roots; 3.4.3 Passive margin seismicity. , 3.4.4 Influence of neotectonic faults3.4.5 Flexural stresses; 3.5 Discussion and conclusions; Acknowledgments; 4 Earthquakes and geological structures of the St. Lawrence Rift System; 4.1 Introduction; 4.2 Historical earthquakes and their impact; 4.3 Seismic zones of the SLRS; 4.3.1 Charlevoix; 4.3.2 Lower St. Lawrence; 4.3.3 Western Quebec; 4.3.4 Background seismicity; 4.4 The St. Lawrence Rift System; 4.5 The rift hypothesis and the SLRS: discussion and conclusions; Acknowledgments; 5 Intraplate earthquakes in North China; 5.1 Introduction; 5.2 Tectonic background; 5.2.1 Geological history. , 5.2.2 Lithospheric structure5.2.3 Major seismogenic faults; 5.3 Active tectonics and crustal kinematics; 5.4 Strain rates and seismicity; 5.5 Seismicity; 5.5.1 Paleoseismicity; 5.5.2 Large historic events; 1303 Hongdong earthquake (M 8.0); 1556 Huaxian earthquake (M 8.3); 1668 Tancheng earthquake (M 8.5); 1679 Sanhe earthquake (M 8.0); 1695 Linfen earthquake (M 7.5-8.0); 5.5.3 Large instrumentally recorded earthquake; The 1966 Xingtai earthquake (Ms 7.2); The 1975 Haicheng earthquake (Ms 7.3); The 1976 Tangshan earthquake (Ms 7.8); 5.6 Spatiotemporal patterns of large earthquakes. , 5.6.1 Long-distance roaming of large earthquakes5.6.2 Fault coupling and interaction; 5.6.3 A conceptual model for mid-continental earthquakes; 5.7 Implications for earthquake hazards; Acknowledgements; 6 Seismogenesis of earthquakes occurring in the ancient rift basin of Kachchh, Western India; 6.1 Introduction; 6.2 Tectonic framework, structure, and tectonic evolution of Kachchh Rift basin; 6.2.1 Structure and tectonics; 6.2.2 Tectono-volcanic events; 6.2.3 Tectonic evolution and existing earthquake generation models of the Kachchh Rift zone. , 6.2.4 Identification of magmatic intrusive bodies.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 19
    Monograph available for loan
    Monograph available for loan
    New York, NY : Springer
    Call number: PIK N 531-16-90092
    Description / Table of Contents: Ecotones are dynamic over-lapping boundary areas where major terrestrial biomes meet.  As past studies have shown, and as the chapters in this book will illustrate, their structure, size, and scope have changed considerably over the millennia, expanding and shrinking as climate and/or other driving conditions, also changed.  Today, however, many of them are changing at a rate not seen for a long time, perhaps largely due to climate change and other human-induced factors.  Indeed ecotones are more sensitive to climate change than the biomes on either side, and thus may serve as critical early indicators of future climate change.  As ecotones change, they also redefine the limits of the biomes on either side by altering their distributions of species because, in addition to their own endemic species, any ecotone will also have species from both adjoining biomes.  Consequently, they may also be places of high levels of species interaction, serving as active evolutionary laboratories, which generate new species that then migrate back into adjacent biomes.Ecotones Between Forest and Grassland explores how these ecotones have changed in the past, how they are changing today, and how they are likely to change in the future. The book includes chapters from around the world with a special focus on South American and Neotropical ecotones. 
    Type of Medium: Monograph available for loan
    Pages: XIII, 327 Seiten , Ill., graph. Darst.
    ISBN: 9781461437963 (print)
    Language: English
    Note: Ecotones Between Forest and Grassland; Preface; Contents; Contributors; Chapter 1: Introduction; 1.1 Rationale; 1.2 Case Study: The Cross Timbers; 1.3 About This Book; References; Part I: Temperate Forest-Grassland Ecotones: Prairies, Steppes, and Pampas; Chapter 2: Woodland-Grassland Ecotonal Shifts in Environmental Mosaics: Lessons Learnt from the Environmental History of the Carpathian Basin (Central Europe) During the Holocene and the Last Ice Age Based on Investigation of Paleobotanical and Mollusk Remains; 2.1 Introduction. , 2.2 Modern Woodland-Grassland Ecotone in the Carpathian Basin and Controversies Around Definitions2.3 Profiles Selected and Methods Applied in Modeling Woodland-Grassland Ecotone Shifts in the Carpathian Basin; 2.3.1 The Climate-Zonal Hypothesis Put to the Test; 2.3.2 Testing the Model of Edaphic Ecological Factors; 2.3.3 Testing the Idea of Human-Induced Ecotone Development; 2.4 The Vegetation History of the Great Hungarian Plains as Inferred from the Evaluation of Quaternary Paleoecological and Environmental Historical Data; 2.4.1 Vegetation Development During Last Ice Age. , 2.4.2 Vegetation Development During the Terminal Part of the Last Ice Age2.4.3 Vegetation Development During the Pleistocene/Holocene Transition; 2.4.4 Vegetation History of the Carpathian Basin from the Settlement of the First Farmers; 2.5 Summary; References; Chapter 3: Ecotones as Complex Arenas of Disturbance, Climate, and Human Impacts: The Trans-Andean Forest-Steppe Ecotone of Northern Patagonia; 3.1 Introduction; 3.2 Physical and Biological Setting of Forest-Steppe Ecotone of Northern Patagonia; 3.2.1 Abiotic Transition; 3.2.2 Ecosystem Properties Across the Transition. , 3.2.3 Plant Communities and Plant Diversity Across the Transition3.3 Disturbance Variation and Forest Dynamics Across the Transition; 3.3.1 Fine-Scale Disturbances; 3.3.2 Coarse-Scale Disturbances; 3.4 Direct and Disturbances-Mediated In fl uences of Climate Variability Across the Transition; 3.5 Climate, Fire, Land Use, and Long-Term Vegetation Changes Across the Transition; 3.5.1 Xeric Steppe-Woodland Belt; 3.5.2 The Nothofagus Forest-Shrubland Belt; 3.5.3 The Wet Rainforest Belt; 3.6 Conclusions; References; Chapter 4: Woody-Herbaceous-Livestock Species Interaction; 4.1 Introduction. , 4.2 Woody-Herbaceous Species Interactions and Associated Models4.3 Woodland and Grassland Stable States and Conceptual Models; 4.4 Woody-Herbaceous Ecotones; 4.5 Rates and Patterns of Woody-Herbaceous Ecotone Shift; 4.6 Woody-Herbaceous-Livestock Species Dynamics; 4.7 Other Potential Factors In fl uencing Woody-Herbaceous Species Dynamics; 4.8 Current and Future Research on Woody-Herbaceous-Livestock Species Interaction; References; Chapter 5: Woody Plant Invasions in Pampa Grasslands: A Biogeographical and Community Assembly Perspective; 5.1 Introduction. , 5.2 Woody Invasions as Hierarchical Assembly Processes.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 20
    Call number: PIK A 190-16-89749
    Description / Table of Contents: Modern science is a model-building activity. But how are models contructed? How are they related to theories and data? How do they explain complex scientific phenomena, and which role do computer simulations play? To address these questions which are highly relevant to scientists as well as to philosophers of science, 8 leading natural, engineering and social scientists reflect upon their modeling work, and 8 philosophers provide a commentary
    Description / Table of Contents: Modern science is a model-building activity. But how are models contructed? How are they related to theories and data? How do they explain complex scientific phenomena, and which role do computer simulations play? To address these questions which are highly relevant to scientists as well as to philosophers of science, 8 leading natural, engineering and social scientists reflect upon their modeling work, and 8 philosophers provide a commentary. U. Gähde and J. H. Wolf, University of Hamburg; S. Hartmann, Ludwig-Maximilians-Universität Munich.
    Type of Medium: Monograph available for loan
    Pages: VIII, 274 Seiten , graph. Darst.
    ISBN: 9783110313680 , 9783110313604
    Series Statement: Abhandlungen der Akademie der Wissenschaften in Hamburg 4
    Language: English
    Note: Preface; Contributors; Content; Introduction; Cosmology - The Largest Possible Model?; The Standard Model of Cosmology as a Tool for Interpretation and Discovery; Patterns in Physical and Biological Systems; Symmetry and the Explanation of Organismal Form; Pluralistic Modeling of Complex Systems; The Methodological Challenges of Complex Systems; Contested Modeling: The Case of Economics; A Unifying Approach to High- and Low-Level Cognition; High-vs Low-Level Cognition and the Neuro- Emulative Theory of Mental Representation. , Evaluating a Computational Model of Eye-Movement Control in ReadingConsidering Criteria for Model Modification and Theory Change in Psychology; Identification of Kinetic Models by Incremental Refinement; Kinetics, Models, and Mechanism; Modeling Complexity: The Case of Climate Science; Chaos, Plurality, and Model Metrics in Climate Science; Subject Index; Author Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 21
    Call number: PIK E 713-17-90095
    Description / Table of Contents: Die Herausgeberinnen: Prof. Dr.-Ing. Sabine Hofmeister, Dr. rer. nat. Christine Katz, Dr. rer. soc. Tanja Mölders, alle: Lehr- und Forschungsgebiet Umweltplanung, Fakultät Nachhaltigkeit, Leuphana Universität Lüneburg
    Description / Table of Contents: Zwischen Geschlechter- und Nachhaltigkeitsforschung sind zahlreiche Synergien möglich. Die AutorInnen zeigen, warum die Umweltwissenschaften nicht auf die Kategorie Geschlecht verzichten dürfen. Den LeserInnen wird ein Überblick über das komplexe und vielfältig verwobene Forschungsfeld gegeben.
    Type of Medium: Monograph available for loan
    Pages: 403 Seiten
    ISBN: 9783847400103
    Language: German
    Note: Contents: I Grundlegungen und Orientierungen ; 1. Grundlegungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; 2. Orientierungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; II Forschungs- und Handlungsfelder der Nachhaltigkeitswissenschaften und -politik ; 1. Einführung ; 2. Wissenschaft und Forschung ; 3. Wirtschaften und Arbeiten ; 4. Raumentwicklung ; 5. Mobilität ; 6. Klimawandel und -politik ; 7. Ressourcenpolitik und Infrastruktur ; 8. Natur und Landschaft ; 9. Konsum- und Lebensstile ; 10. Zeit(en) ; 11. Governance, Partizipation, Empowerment ; III Fazit - Die Kategorie Geschlecht: Neue Perspektiven für die Nachhaltigkeitswissenschaften
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    facet.materialart.12
    New York, Basingstoke : Freeman
    Call number: 9781464138744
    Type of Medium: 12
    Pages: 1 Online-Ressource (755 Seiten) , Illustrationen, Diagramme, Karten
    Edition: 7th edition
    ISBN: 978-1-4641-3874-4 , 1-4641-3874-5
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
    Monograph available for loan
    Monograph available for loan
    Berkeley : University of California Press
    Call number: IASS 16.89932
    Description / Table of Contents: Charles C. Ragin's "The Comparative Method" proposes a synthetic strategy, based on an application of Boolean algebra, that combines the strengths of both qualitative and quantitative sociology. Elegantly accessible and germane to the work of all the social sciences, and now updated with a new introduction, this book will continue to garner interest, debate, and praise
    Type of Medium: Monograph available for loan
    Pages: xxx, 185 S.
    ISBN: 9780520280038
    Language: English
    Note: Cover; Contents; Preface and Overview; Acknowledgments; Introduction to the 2014 Edition; 1. The Distinctiveness of Comparative Social Science; 2. Heterogeneity and Causal Complexity; 3. Case-Oriented Comparative Methods; 4. The Variable-Oriented Approach; 5. Combined Versus Synthetic Comparative Strategies; 6. A Boolean Approach to Qualitative Comparison: Basic Concepts; 7. Extensions of Boolean Methods of Qualitative Comparison; 8. Applications of Boolean Methods of Qualitative Comparison; 9. The Dialogue of Ideas and Evidence in Social Research; Bibliography; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 24
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: M 16.89755
    Description / Table of Contents: Provides a deeper understanding of earthquake processes, based on laboratory-derived physical laws and formulae, for researchers, professionals and graduate students
    Type of Medium: Monograph available for loan
    Pages: x, 270 S.
    Edition: Online-Ausg. 2013
    ISBN: 9781107030060
    Classification:
    Seismology
    Parallel Title: Print version: The Physics of Rock Failure and Earthquakes
    Language: English
    Note: Contents; Preface; 1 Introduction; 2 Fundamentals of rock failure physics; 2.1 Mechanical properties and constitutive relations; 2.1.1 Elastic deformation; 2.1.2 Ductile deformation; 2.1.3 Fracture; 2.1.4 Friction; 2.2 Basics of rock fracture mechanics; 2.2.1 Energy release rate and resistance to rupture growth; 2.2.2 Stress concentration and cohesive zone model; 2.2.3 Breakdown zone model for shear failure; 2.2.4 j-integral and energy criterion for shear failure; 2.2.5 Relation between resistance to rupture growth and constitutive relation parameters. , 3 Laboratory-derived constitutive relations for shear failure3.1 Shear failure of intact rock; 3.1.1 Method and apparatus used; 3.1.2 Constitutive relations derived from data on the shear failure of intact rock; 3.1.3 Geometric irregularity of shear-fractured surfaces and characteristic length; 3.2 Frictional slip failure on precut rock interface; 3.2.1 Method and apparatus used; 3.2.2 Geometric irregularity of precut fault surfaces and characteristic length; 3.2.3 Constitutive relations derived from data on frictional stick-slip failure. , 3.2.4 Laboratory-derived relationships between physical quantities observed during dynamic slip rupture propagation3.3 Unifying constitutive formulation and a constitutive scaling law; 3.3.1 Unification of constitutive relations for shear fracture and for frictional slip failure; 3.3.2 A constitutive scaling law; 3.3.3 Critical energy required for shear fracture and for frictional stick-slip failure; 3.3.4 Stabilityinstability of the breakdown process; 3.3.5 Breakdown zone size; 3.4 Dependence of constitutive law parameters on environmental factors; 3.4.1 Introduction. , 3.4.2 Dependence of shear failure strength on environmental factors3.4.3 Dependence of breakdown stress drop on environmental factors; 3.4.4 Dependence of breakdown displacement on environmental factors; 4 Constitutive laws for earthquake ruptures; 4.1 Basic foundations for constitutive formulations; 4.2 Rate-dependent constitutive formulations; 4.3 Slip-dependent constitutive formulations; 4.4 Depth dependence of constitutive law parameters; 5 Earthquake generation processes; 5.1 Shear failure nucleation processes observed in the laboratory; 5.1.1 Introduction; 5.1.2 Experimental method. , 5.1.3 Nucleation phases observed on faults with different surface roughnessesRough fault; Smooth fault; Extremely smooth fault; 5.1.4 Scaling of the nucleation zone size; 5.2 Earthquake rupture nucleation; 5.2.1 Seismogenic background; 5.2.2 Physical modeling and theoretical derivation of the nucleation zone size; 5.2.3 Comparison of theoretical relations with seismological data; 5.2.4 Foreshock activity associated with the nucleation process; 5.3 Dynamic propagation and generation of strong motion seismic waves; 5.3.1 Slip velocity and slip acceleration in the breakdown zone. , 5.3.2 The cutoff frequency fs max of the power spectral density of slip acceleration at the source.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: IASS 16.89972
    Description / Table of Contents: "The scale, effectiveness and legitimacy of global governance lag far behind the world's needs. This path-breaking book examines how far civil society involvement provides an answer to these problems. Does civil society make global governance more democratic? Have citizen action groups raised the accountability of global bodies that deal with challenges such as climate change, financial crises, conflict, disease and inequality? What circumstances have promoted (or blocked) civil society efforts to make global governance institutions more democratically accountable? What could improve these outcomes in the future? The authors base their argument on studies of thirteen global institutions, including the UN, G8, WTO, ICANN and IMF. Specialists from around the world critically assess what has and has not worked in efforts to make global bodies answer to publics as well as states. Combining intellectual depth and political relevance, Building Global Democracy? will appeal to students, researchers, activists and policymakers"--
    Type of Medium: Monograph available for loan
    Pages: xxv, 397 S.
    ISBN: 9780521140553
    Language: English
    Note: Machine generated contents note: Introduction Jan Aart Scholte; 1. Global governance, accountability and civil society Jan Aart Scholte; 2. Civil society and accountability of the United Nations Kerstin Martens; 3. The World Bank and democratic accountability: the role of civil society Alnoor Ebrahim and Steven Herz; 4. Civil society and IMF accountability Jan Aart Scholte; 5. Civil society and the WTO: contesting accountability Marc Williams; 6. Civil society and accountability in the Commonwealth Timothy M. Shaw and Pamela K. Mbabazi; 7. The organisation of the Islamic conference, accountability and civil society Saied Reza Ameli; 8. Civil society and patterns of accountability in the OECD Morten Ougaard; 9. Civil society and G8 accountability Peter I. Hajnal; 10. Structuring accountability: the Asia-Europe meeting Julie Gilson; 11. Civil society and accountability in global governance of climate change Peter Newell; 12. Civil society and accountability promotion in the global fund Carolyn Long and Nata Duvvury; 13. Accountability in private global governance: ICANN and civil society Mawaki Chango; 14. Civil society and the World Fair Trade Organisation: developing responsive accountability Heidi Ullrich; Conclusion Jan Aart Scholte..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    Monograph available for loan
    Monograph available for loan
    Princeton [u.a.] : Princeton University Press
    Call number: PIK O 071-16-89977
    Description / Table of Contents: For epidemiologists, evolutionary biologists, and health-care professionals, real-time and predictive modeling of infectious disease is of growing importance. This book provides a timely and comprehensive introduction to the modeling of infectious diseases in humans and animals, focusing on recent developments as well as more traditional approaches. Matt Keeling and Pejman Rohani move from modeling with simple differential equations to more recent, complex models, where spatial structure, seasonal ""forcing,"" or stochasticity influence the dynamics, and where computer simulation needs to
    Type of Medium: Monograph available for loan
    Pages: XI, 366 Seiten , graph. Darst.
    ISBN: 9780691116174
    Language: English
    Note: ""Cover""; ""Contents""; ""Acknowledgments""; ""Chapter 1 Introduction""; ""1.1 Types of Disease""; ""1.2 Characterization of Diseases""; ""1.3 Control of Infectious Diseases""; ""1.4 What Are Mathematical Models?""; ""1.5 What Models Can Do""; ""1.6 What Models Cannot Do""; ""1.7 What Is a Good Model?""; ""1.8 Layout of This Book""; ""1.9 What Else Should You Know?""; ""Chapter 2 Introduction to Simple Epidemic Models""; ""2.1 Formulating the Deterministic SIR Model""; ""2.1.1 The SIR Model Without Demography""; ""2.1.1.1 The Threshold Phenomenon""; ""2.1.1.2 Epidemic Burnout"". , ""2.1.1.3 Worked Example: Influenza in a Boarding School""""2.1.2 The SIR Model With Demography""; ""2.1.2.1 The Equilibrium State""; ""2.1.2.2 Stability Properties""; ""2.1.2.3 Oscillatory Dynamics""; ""2.1.2.4 Mean Age at Infection""; ""2.2 Infection-Induced Mortality and SI Models""; ""2.2.1 Mortality Throughout Infection""; ""2.2.1.1 Density-Dependent Transmission""; ""2.2.1.2 Frequency Dependent Transmission""; ""2.2.2 Mortality Late in Infection""; ""2.2.3 Fatal Infections""; ""2.3 Without Immunity: The SIS Model""; ""2.4 Waning Immunity: The SIRS Model"". , ""2.5 Adding a Latent Period: The SEIR Model""""2.6 Infections with a Carrier State""; ""2.7 Discrete-Time Models""; ""2.8 Parameterization""; ""2.8.1 Estimating R[sub(0)] from Reported Cases""; ""2.8.2 Estimating R[sub(0)] from Seroprevalence Data""; ""2.8.3 Estimating Parameters in General""; ""2.9 Summary""; ""Chapter 3 Host Heterogeneities""; ""3.1 Risk-Structure: Sexually Transmitted Infections""; ""3.1.1 Modeling Risk Structure""; ""3.1.1.1 High-Risk and Low-Risk Groups""; ""3.1.1.2 Initial Dynamics""; ""3.1.1.3 Equilibrium Prevalence""; ""3.1.1.4 Targeted Control"". , ""3.1.1.5 Generalizing the Model""""3.1.1.6 Parameterization""; ""3.1.2 Two Applications of Risk Structure""; ""3.1.2.1 Early Dynamics of HIV""; ""3.1.2.2 Chlamydia Infections in Koalas""; ""3.1.3 Other Types of Risk Structure""; ""3.2 Age-Structure: Childhood Infections""; ""3.2.1 Basic Methodology""; ""3.2.1.1 Initial Dynamics""; ""3.2.1.2 Equilibrium Prevalence""; ""3.2.1.3 Control by Vaccination""; ""3.2.1.3 Parameterization""; ""3.2.2 Applications of Age Structure""; ""3.2.2.1 Dynamics of Measles""; ""3.2.2.2 Spread and Control of BSE""; ""3.3 Dependence on Time Since Infection"". , ""3.3.1 SEIR and Multi-Compartment Models""""3.3.2 Models with Memory""; ""3.3.3 Application: SARS""; ""3.4 Future Directions""; ""3.5 Summary""; ""Chapter 4 Multi-Pathogen/Multi-Host Models""; ""4.1 Multiple Pathogens""; ""4.1.1 Complete Cross-Immunity""; ""4.1.1.1 Evolutionary Implications""; ""4.1.2 No Cross-Immunity""; ""4.1.2.1 Application: The Interaction of Measles and Whooping Cough""; ""4.1.2.2 Application: Multiple Malaria Strains""; ""4.1.3 Enhanced Susceptibility""; ""4.1.4 Partial Cross-Immunity""; ""4.1.4.1 Evolutionary Implications"". , ""4.1.4.2 Oscillations Driven by Cross-Immunity"".
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Call number: IASS 16.90013
    Description / Table of Contents: The 2008-10 financial crisis and the global recession it created is a complex phenomenon that warrants detailed examination. The various essays in this book utilise several alternative paradigms to provide a plausible explanation and a credible cure. Great detail is given to this important analysis from different theoretical perspectives, presenting a clearer understanding of what went wrong and expounding misinterpretations of current theories and practices. Fourteen insightful chapters by eminent scholars investigate the background of the crisis and draw lessons for economic theory and polic
    Type of Medium: Monograph available for loan
    Pages: ix, 260 Seiten
    ISBN: 9781849807456 , 1283072130 (ebk) , 9781283072137 (MyiLibrary) , 9781849807463 (electronic) , 1855754827 (print)
    Language: English
    Note: CONTENTS; List of Figures; List of Tables; List of Contributors; Introduction; PART I: ECONOMISTS ON TRIAL; 1. Who predicted the crisis and what can we learn from them? ; 2 A brief note on economic recessions, banking reform and the future of capitalism; 3 Understanding crisis: on the meaning of uncertainty and probability; 4 Financial crisis and risk measurement: the historical perspective and a new methodology; 5 Did economic analysis fail in the current financial crisis?; PART II: WHAT DOES HISTORY TELL US? ; 6 Does the current global crisis remind us of the Great Depression?. , 7 Innovation, growth, cycles and finance: three (or four or more) stories from the 1930s and their lessons8 Epic Recession and economic theory; 9 Did asset prices cause the current crisis?; 10 The role of the history of economic thought in the development of economic theory and policy; PART III: COUNTRY CASES IN A GLOBAL CRISIS; 11. Testimony to the Financial Crisis Inquiry Commission by Alan Greenspan; 12 Long-term depression and new markets: economists and the 2008 recession; 13 Manifestations of the global crisis in a small open economy. , 14 The aftermath of a long decade of real nil interest rates (Spain 1996-2008)Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    Monograph available for loan
    Monograph available for loan
    Basingstoke, England : Palgrave Macmillan
    Call number: PIK B 160-16-90200
    Description / Table of Contents: This updated and revised edition outlines strategies and models for how to use technology and knowledge to improve performance, create jobs and increase income. It shows what skills will be required to produce, sell and manage performance over time, and how manual jobs can contribute to reduce the consumption of non-renewable resources
    Type of Medium: Monograph available for loan
    Pages: XXIII, 349 Seiten , graph. Darst.
    Edition: 2nd edition
    ISBN: 0230584667 (hbk.) , 9781349369195 (pbk.) , 9780230584662 (hbk.)
    Language: English
    Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
    Monograph available for loan
    Monograph available for loan
    Dordrecht : Springer Netherlands
    Call number: M 17.90938
    Description / Table of Contents: Over the last 30 years, Dr. Nikita V. Chukanov has collected IR spectra of about 2000 mineral species, including 247 holotype samples. In this book, he presents 3309 spectra of these minerals with detailed  description and analytical data for reference samples. In the course of this work, about 150 new mineral species have been discovered. This book presents spectra of each mineral together with a description and comments on standard samples used (occurrence, appearance, associated minerals, empirical formula etc.). Sections are organized according to different classes of compounds (silicates, phosphates, arsenates, oxides etc.)
    Type of Medium: Monograph available for loan
    Pages: IX, 1726 p. 3547 illus., 1 illus. in color
    Edition: Online edition Springer eBook Collection. Earth and Environmental Science
    ISBN: 9789400771284 , 9789400771277 (print)
    Series Statement: Springer Geochemistry / Mineralogy
    Parallel Title: Print version Infrared spectra of mineral species : Extended library
    Language: English
    Note: The Application of IR Spectroscopy to the Investigation of MineralsThe Discrete Approach -- The Full-Profile Analysis -- Polymerization of coordination polyhedra and structure topology -- Hydrogen-bearing groups and hydrogen bonding -- Solid-solution series -- Force parameters of cations in silicates -- IR spectra of minerals and reference samples data -- Borates, including sulfato-borates and arsenato-borates -- Carbides and carbonates -- Organic compounds and salts of organic acids -- Ammino-complexes, nitrates and sulfato-nitrates -- Oxides and hydroxides -- Fluorides -- Silicates -- Phosphates -- Sulfates, carbonato-sulfates, phosphato-sulfates and sulfides -- Chlorides -- Vanadates and vanadium oxides -- Chromates -- Arsenates, arsenites and sulfato-arsenates -- Selenites, molybdates, tellurites, tellurates, iodites, wolframates and wolfram oxides..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 30
    Call number: ISO 50001
    Type of Medium: Non-book medium
    Pages: Online Ressource
    Series Statement: ISO 50001:2011
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 31
    Monograph available for loan
    Monograph available for loan
    Berlin : Springer
    Call number: 6/M 16.89656
    Description / Table of Contents: Geodetic datum (including coordinate datum, height datum, depth datum, gravimetry datum) and geodetic systems (including geodetic coordinate system, plane coordinate system, height system, gravimetry system) are the common foundations for every aspect of geomatics. This course book focuses on geodetic datum and geodetic systems, and describes the basic theories, techniques, methods of geodesy. The main themes include: the various techniques of geodetic data acquisition, geodetic datum and geodetic control networks, geoid and height systems, reference ellipsoid and geodetic coordinate systems, Gaussian projection and Gaussian plan coordinates and the establishment of geodetic coordinate systems. The framework of this book is based on several decades of lecture noted and the contents are developed systematically for a complete introduction to the geodetic foundations of geomatics.
    Description / Table of Contents: REVIEW: "The present work integrates both classical materials and modern developments in geodesy, it describes pure theoretical approaches and recent practical applications. The book can be used as a general textbook for undergraduates studying geomatics and survejing and mapping in higher education institutions. For technicians who are engaged in geomatic and surveying engineering, the book is strongly recommended as a basic and useful reference guide."
    Type of Medium: Monograph available for loan
    Pages: XXI, 401 S.
    ISBN: 9783642412455 , 9783642412448
    Classification:
    Geodesy
    Language: English
    Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: PIK P 120-16-89806
    Description / Table of Contents: Deutschland wird seine bisher weitgehend auf fossilen Brennstoffen basierende Energieversorgung bis zum Jahr 2050 auf großtenteils regenerative Energien umstellen. Die Burgerinnen und Burger dieses Landes kennen dieses weltweit einzigartige Projekt unter dem Namen Energiewende. Von ihren gesellschaftlichen Wurzeln, dem Beginn ihrer Umsetzung und ihrer rasanten Entwicklung in den letzten Jahren berichtet Klaus-Dieter Maubach. Er beschreibt, wie das deutsche Energiesystem der Zukunft aussehen muss, und schlagt einen kurzfristigen Aktionsplan vor, der die volkswirtschaftlichen Kosten eindammt und
    Type of Medium: Monograph available for loan
    Pages: XX, 293 Seiten
    Edition: 2. Auflage
    ISBN: 3658054735 , 9783658054731
    Language: German
    Note: Vorwort zur zweiten Auflage; Vorwort; Inhalt; Abkürzungen; Einführung; Teil I; Eine kurze Geschichte der Energiewende; Fukushima und Ausstieg (2011); Fundamente der Energiewende (1980 - 1998); EnWG und EEG (1998 - 2003); Emissionshandel und Energiepreise (2003 - 2008); Netzregulierung und EEG (2004 - 2008); Krise in Europa (2009 - 2012); Teil II; Die Zukunft der Energiewende; Standortbestimmung (2013); 2050: Energiewende; Fossile Primärenergien; Die Regenerativen; Energiesystem der Zukunft; Politik für die Energiewende; 1 Braunkohle und Erdgas; 2 Auslaufbetrieb der Kernenergie ; 3 Energieeffizienz ; 4 Emissionshandel ; 5 EEG Reform ; 6 Regulierung der Stromnetze ; 7 Strommarktgestaltung ; 8 Koordinierung der Energiewende ; Zusammenfassung.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS Verlag für Sozialwissenschaften
    Call number: IASS 16.90103
    Description / Table of Contents: Ob in Medien, in der Wissenschaft, in der Politik oder in der Alltagskommuni­kation - wir sind stets mit einer Fülle an schriftlichen und mündlichen Erzäh­lungen konfrontiert. Sie schaffen gemeinsame Wirklichkeiten und Identitäten, auf die wir uns als soziale Akteure in unseren Handlungen bewusst oder unbewusst beziehen. Erzählungen im öffentlichen Raum prägen Normen und Moralvorstellungen, helfen beim Aufbau sozialer und kultureller Ordnungen und festigen oder verschieben damit bestehende Normen. Es sind Erzählungen, die in öffentlichen Diskursen bestimmen, was in einer Gesellschaft als wahr
    Type of Medium: Monograph available for loan
    Pages: 394 Seiten
    ISBN: 9783531932569 , 9783531173993 (print)
    Series Statement: Theorie und Praxis der Diskursforschung
    Language: German
    Note: Inhalt; Über dieses Buch; Teil I Einführungen: Theorien der Erzählungen; Erzählen. Die ethisch-politische Funktion narrativer Diskurse; 1 Narrative Diskurse: Eigenschaften und Funktionen; 1.1 Die narrative Kunst der Begründung; 1.2 Ein semantisches Modell der Erzählung: Algirdas J. Greimas' Aktantentheorie; 1.3 Narrative Begründungen: Eine semantische Typologie; 1.4 Die Schuld und die Vergebung: Zum Verantwortungsmanagement narrativer Diskurse; 1.5 In medias res: Warum Erzählungen oft mit dem Ende beginnen; 1.6 Die doppelte Referenz: Das Allgemeine und das Einzigartige. , 2 Die Erzähler und ihr Publikum: Zur Öffentlichkeit narrativer Diskurse2.1 Öffentliche Urteile: Die Erzähler und ihr Publikum; 2.2 Die zwei Stimmen des Erzählers; 2.3 Die Präsenz des Erzählers in der Erzählung; 2.4 Die Öffentlichkeiten des Erzählers; 2.5 Autobiografisches Erzählen: Der innere Dialog und das Denken; 2.6 Ausblick: Die Öffentlichkeitsregime narrativer Diskurse; Literatur; »Menschen lesbarer machen«1: Narration, Diskurs,Referenz; 1 Narrationen als sozialwissenschaftliches Konzept; 1.1 Erzählungen zwischen Text und Handlung; 1.2 Typen der Erzählung. , 1.3 Zur lebensweltlichen Einbettung von Narrativen2 Zum Verhältnis von Narration und Diskurs; 2.1 Brauchen Diskurse Erzählungen?; 2.2 Narrationen als Sprech-Handlungen (über Satzniveau); 3 Erzählungen: Strukturen, Ereignisse und dieKomposition der Fabel; 3.1 Narration und Fabelkomposition; 3.2 Ebenen der Erzählung; 3.3 Kollektiv-Symbole und ihre Erzählungen; 3.4 Narrative und ihre Bedeutung für die kulturelle Reproduktion und Innovation; 4 Referenz und Erzählung: Jenseits der Innenwelt von Texten; 4.1 Öffentliche Erzählungen als Mimesis von Handlungen?. , 5 ConclusioLiteratur; Öffentliche Erzählungen und der globale Wandel des Klimas; 1 Einleitung; 2 Der Mensch als Klimageschichtenerzähler; 2.1 Was heißt Narrativisierung des Klimas?; 2.2 Narrationen als Geburtshelfer möglicher Welten; 2.3 Klimageschichten sind lebende Geschichten; 3 Globaler Klimawandel: Geburt eines Konzepts; 4 Sechs Varianten der Narrativisierung des globalenKlimawandels; 4.1 Das »globale Treibhaus« als anthropogene Katastrophe; 4.2 Anthropogene Eiszeiten: die Katastrophe des; 4.3 Die Geschichte vom »nuklearen Winter«; 4.4 »Paradiesische Warmzeiten«. , 4.5 Die ewige Wiederkehr der »Sonnenflecken«: Normalität statt Katastrophe. , 4.2 Die Konfiguration von Charakteren in öffentlichen Erzählungen4.3 Re-figuration und die Rolle des Lesers; Teil II Erzählungen in den Medien; Kollektivsymbolik und die deutsche Krise seit dem Jahr 2000; Heimat, Natur und die gute alte Zeit. Erzählungenüber Nachhaltige Entwicklung im Spannungsfeldöffentlicher und wissenschaftlicher Diskurse1; 1 Einleitung; 2 Wissenschaftliche Diskurse über Nachhaltige Entwicklung; 3 Nachhaltige Ernährung und Ernährungskommunikation; 4 Erzählungen über Ernährung in den Medien; 4.1 Polarisierende Rhetorik; 4.2 Affirmative Rhetorik; 4.3 Reflektierende Rhetorik.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Ulmer
    Call number: IASS 16.90047
    Type of Medium: Monograph available for loan
    Pages: 413 S. , Ill., graph. Darst.
    ISBN: 9783825236762 (print)
    Series Statement: UTB 3676
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Call number: M 17.90543
    Description / Table of Contents: This book is a new edition of Roederer’s classic Dynamics of Geomagnetically Trapped Radiation, updated and considerably expanded. The main objective is to describe the dynamic properties of magnetically trapped particles in planetary radiation belts and plasmas and explain the physical processes involved from the theoretical point of view. The approach is to examine in detail the orbital and adiabatic motion of individual particles in typical configurations of magnetic and electric fields in the magnetosphere and, from there, derive basic features of the particles’ collective “macroscopic” behavior in general planetary environments. Emphasis is not on the “what” but on the “why” of particle phenomena in near-earth space, providing a solid and clear understanding of the principal basic physical mechanisms and dynamic processes involved. The book will also serve as an introduction to general space plasma physics, with abundant basic examples to illustrate and explain the physical origin of different types of plasma current systems and their self-organizing character via the magnetic field. The ultimate aim is to help both graduate students and interested scientists to successfully face the theoretical and experimental challenges lying ahead in space physics in view of recent and upcoming satellite missions and an expected wealth of data on radiation belts and plasmas
    Type of Medium: Monograph available for loan
    Pages: xviii, 192 Seiten
    Edition: Second edition
    ISBN: 9783642415296
    Series Statement: Astrophysics and Space Science Library 403
    Classification:
    Geomagnetism, Geoelectromagnetism
    Language: English
    Note: Particle Drifts and the First Adiabatic InvariantParticle Trapping, Drift Shells and the Second Adiabatic Invariant -- Periodic Drift Motion and the Third Adiabatic Invariant -- Trapped Particle Distributions and Flux Mapping -- Violation of the Adiabatic Invariants and Trapped Particle Diffusion -- Introduction to Plasma Physics..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Monograph available for loan
    Monograph available for loan
    Princeton and Oxford : Princeton University Press,
    Call number: M 17.90645
    Description / Table of Contents: Cover; Title; Copyright; Contents; List of Illustrations; Preface; PART ONE: What Has Controlled Earth's Climate?; CHAPTER ONE: Climate and Human History; PART TWO: Nature in Control; CHAPTER TWO: Slow Going for a Few Million Years; CHAPTER THREE: Linking Earth's Orbit to Its Climate; CHAPTER FOUR: Orbital Changes Control Ice-Age Cycles; CHAPTER FIVE: Orbital Changes Control Monsoon Cycles; CHAPTER SIX: Stirrings of Change; PART THREE: Humans Begin to Take Control; CHAPTER SEVEN: Early Agriculture and Civilization; CHAPTER EIGHT: Taking Control of Methane
    Description / Table of Contents: CHAPTER NINE: Taking Control of CO[sub(2)]CHAPTER TEN: Have We Delayed a Glaciation?; CHAPTER ELEVEN: Challenges and Responses; PART FOUR: Disease Enters the Picture; CHAPTER TWELVE: But What about Those CO[sub(2)] "Wiggles"?; CHAPTER THIRTEEN: The Horsemen of the Apocalypse: Which One?; CHAPTER FOURTEEN: Pandemics, CO[sub(2)], and Climate; PART FIVE: Humans in Control; CHAPTER FIFTEEN: Greenhouse Warming: Tortoise and Hare; CHAPTER SIXTEEN: Future Warming: Large or Small?; CHAPTER SEVENTEEN: From the Past into the Distant Future; EPILOGUE; CHAPTER EIGHTEEN: Global-Change Science and Politics
    Description / Table of Contents: CHAPTER NINETEEN: Consuming Earth's GiftsAfterword to the Princeton Science Library Edition; Bibliography; Figure Sources; Index; A; B; C; D; E; F; G; H; I; K; L; M; N; O; P; R; S; T; U; V; W; Y
    Description / Table of Contents: The impact on climate from 200 years of industrial development is an everyday fact of life, but did humankind''s active involvement in climate change really begin with the industrial revolution, as commonly believed? Plows, Plagues, and Petroleum has sparked lively scientific debate since it was first published--arguing that humans have actually been changing the climate for some 8,000 years--as a result of the earlier discovery of agriculture. The ""Ruddiman Hypothesis"" will spark intense debate. We learn that the impact of farming on greenhouse-gas levels, thousands of years before the i
    Type of Medium: Monograph available for loan
    Pages: xiv, 226 Seiten , Illustrationen
    Edition: New Princeton Science Library edition
    ISBN: 9780691173214
    Series Statement: Princeton Science Library
    Classification:
    Meteorology and Climatology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    facet.materialart.12
    Berlin, New York : De Gruyter Saur
    Call number: 9783110232103 (e-book)
    Description / Table of Contents: With the term "Library 2.0" the editors mean an institution which applies the principles of the Web 2.0 such as openness, re-use, collaboration and interaction in the entire organization. Libraries are extending their service offerings and work processes to include the potential of Web 2.0 technologies. This changes the job description and self-image of librarians. The collective volume offers a complete overview of the topic Library 2.0 and the current state of developments from a technological, sociological, information theoretical and practice-oriented perspective
    Type of Medium: 12
    Pages: 1 Online-Ressource (1 electronic resource (xii, 392 p.))
    Edition: Online-Ausg.
    ISBN: 9783110232103 , 9783110232097
    Series Statement: Bibliotheks- und Informationspraxis 41
    Language: Undetermined
    Note: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
    Monograph available for loan
    Monograph available for loan
    New York : Routledge
    Call number: IASS 16.89933
    Description / Table of Contents: Bringing together papers written by Norman Fairclough over a 25 year period, Critical Discourse Analysis represents a comprehensive and important contribution to the development of this popular field.  The book is divided into seven sections covering the following themes:  language in relation to ideology and powerdiscourse in processes of social and cultural change dialectics of discourse, dialectical relations between discourse and other moments of social lifemethodology of critical discourse analysis research analysis of political discourse discourse in globalisation and ?transition' critic
    Type of Medium: Monograph available for loan
    Pages: xi, 591 S.
    Edition: Second edition
    Edition: Online-Ausg.
    ISBN: 9781405858229 (pbk.)
    Language: English
    Note: section A. Language, ideology and powersection B. Discourse and sociocultural change -- section C. Dialectics of discourse: theoretical developments -- section D. Methodology in CDA research -- section E. Political discourse -- F. Globalisation and 'transition' -- section G. Language and education..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 39
    Monograph available for loan
    Monograph available for loan
    Cambridge, Mass. [u.a.] : MIT Press
    Call number: PIK B 020-16-89772
    Type of Medium: Monograph available for loan
    Pages: XXVII, 1064 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 0262232588 (hbk.) , 9780262232586
    Language: English
    Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
    Call number: PIK 16-89825
    Type of Medium: Monograph available for loan
    Pages: Getr. Zählung , Ill., graph. Darst.
    Edition: Online-Ausg. Berlin Humboldt-Universität zu Berlin, Universitätsbibliothek 2011 〈〈Nach einem Exemplar der Humboldt-Universität zu Berlin, Universitätsbibliothek mit der Signatur: 〉〉Diss Geo11 P134
    Language: German
    Note: Berlin, Humboldt-Univ., Diss., 2011
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 41
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: IASS 16.90372 ; PIK D 022-19-89867
    Description / Table of Contents: Wir leben auf Kosten der Zukunft. Warum? Kurzfristige Interessen der Bürger (sichere Arbeit) ergänzen sich mit kurzfristigen Interessen der Politiker (Wiederwahl). Das politische System trägt Mitschuld. Wie kann man es ändern, um  diese Schwächen zu vermeiden? Lässt es sich demokratisch rechtfertigen, wenn Anwälte zukünftiger Generationen heute schon mitentscheiden? Diese Fragen werden  von Wissenschaftlern, Schriftstellern, Politikern und Unternehmern behandelt, um methodische Analyse, politischen und ökonomischen Sachverstand und kreative Ideen zu kombinieren. Das Buch enthält Beiträge von H. Geißler, H. J. Schellnhuber, I. Trojanow u.a. „Die Demokratie hat viele große Vorzüge und Stärken. Langfristigkeit und Nachhaltigkeit gehören bislang nicht dazu. Dem kann man institutionell abhelfen. Das Buch zeigt, wie.“ (Ernst Ulrich von Weizsäcker, MdB a.D.)   Der Inhalt ·         Problemanalyse und Überblick ·         Neue Institutionen: Zukunftsräte ·         Neue Institutionen: Ombudspersonen ·         Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten ·         Ombudspersonen in Unternehmen?   Die Zielgruppen   ·         PolitikwissenschaftlerInnen ·         PhilosophInnen ·         politisch interessierte Bürger     Der Herausgeber Prof. Dr. Bernward Gesang lehrt Philosophie an der Universität Mannheim
    Type of Medium: Monograph available for loan
    Pages: XII, 150 S.
    ISBN: 9783658048952 , 9783658048945
    Parallel Title: Print version: Kann Demokratie Nachhaltigkeit
    Language: German
    Note: Problemanalyse und ÜberblickNeue Institutionen: Zukunftsräte -- Neue Institutionen: Ombudspersonen -- Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten -- Ombudspersonen in Unternehmen?..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    Monograph available for loan
    Monograph available for loan
    Oldenbourg : De Gruyter
    Call number: 18/M 16.90219
    Description / Table of Contents: 〈!doctype html public ""-//w3c//dtd html 4.0 transitional//en""〉 〈html〉〈head〉 〈meta content=""text/html; charset=iso-8859-1"" http-equiv=content-type〉 〈meta name=generator content=""mshtml 8.00.6001.23619""〉〈/head〉 〈body〉 〈P〉This book systematically describes important aspects when planning secure IT systems, as well as the different approaches that may be used. It presents procedures and protocols in detail and explains them with case examples. This book is a must-read for anyone involved in IT security.〈/P〉〈/body〉〈/html〉
    Type of Medium: Monograph available for loan
    Pages: XIV, 990 Seiten
    Edition: 9. Aufl.
    ISBN: 9783486778489
    Language: German
    Note: Vorwort; Inhaltsverzeichnis; 1 Einführung; 1.1 Grundlegende Begriffe; 1.2 Schutzziele; 1.3 Schwachstellen, Bedrohungen, Angriffe; 1.3.1 Bedrohungen; 1.3.2 Angriffs- undAngreifer-Typen; 1.3.3 Rechtliche Rahmenbedingungen; 1.4 ComputerForensik; 1.5 Sicherheitsrichtlinie; 1.6 Sicherheitsinfrastruktur; 2 Spezielle Bedrohungen; 2.1 Einführung; 2.2 Buffer-Overflow; 2.2.1 Einführung; 2.2.2 Angriffe; 2.2.3 Gegenmaßnahmen; 2.3 Computerviren; 2.3.1 Eigenschaften; 2.3.2 Viren-Typen; 2.3.3 Gegenmaßnahmen; 2.4 Würmer; 2.5 Trojanisches Pferd; 2.5.1 Eigenschaften; 2.5.2 Gegenmaßnahmen; 2.6 Bot-Netze undSpam. , 2.6.1 Bot-Netze2.6.2 Spam; 2.7 MobilerCode; 2.7.1 Eigenschaften; 2.7.2 Sicherheitsbedrohungen; 2.7.3 Gegenmaßnahmen; 2.7.4 MobileApps; 3 Internet-(Un-)Sicherheit; 3.1 Einführung; 3.2 Internet-Protokollfamilie; 3.2.1 ISO/OSI-Referenzmodell; 3.2.2 DasTCP/IP-Referenzmodell; 3.2.3 Das Internet-Protokoll IP; 3.2.4 DasTransmissionControlProtokoll TCP; 3.2.5 DasUserDatagramProtocolUDP; 3.2.6 DHCP und NAT; 3.3 Sicherheitsprobleme; 3.3.1 Sicherheitsprobleme von IP; 3.3.2 Sicherheitsprobleme von ICMP; 3.3.3 Sicherheitsprobleme vonARP; 3.3.4 Sicherheitsprobleme vonUDPundTCP. , 3.4 Sicherheitsprobleme vonNetzdiensten3.4.1 DomainNameService (DNS); 3.4.2 NetworkFileSystem(NFS); 3.4.3 WeitereDienste; 3.5 Web-Anwendungen; 3.5.1 World Wide Web (WWW); 3.5.2 Sicherheitsprobleme; 3.5.3 OWASPTop-TenSicherheitsprobleme; 3.6 Analysetools undSystemhärtung; 4 Security Engineering; 4.1 Entwicklungsprozess; 4.1.1 AllgemeineKonstruktionsprinzipien; 4.1.2 Phasen; 4.1.3 BSI-Sicherheitsprozess; 4.2 Strukturanalyse; 4.3 Schutzbedarfsermittlung; 4.3.1 Schadensszenarien; 4.3.2 Schutzbedarf; 4.4 Bedrohungsanalyse; 4.4.1 Bedrohungsmatrix; 4.4.2 Bedrohungsbaum; 4.5 Risikoanalyse. , 4.5.1 Attributierung4.5.2 Penetrationstests; 4.6 Sicherheitsarchitektur und Betrieb; 4.6.1 Sicherheitsstrategie undSicherheitsmodell; 4.6.2 Systemarchitektur undValidierung; 4.6.3 Aufrechterhaltung im laufenden Betrieb; 4.7 Sicherheitsgrundfunktionen; 4.8 Realisierung der Grundfunktionen; 4.9 Security Development Lifecycle (SDL); 4.9.1 Die Entwicklungsphasen; 4.9.2 Bedrohungs- und Risikoanalyse; 5 Bewertungskriterien; 5.1 TCSEC-Kriterien; 5.1.1 Sicherheitsstufen; 5.1.2 Kritik am Orange Book; 5.2 IT-Kriterien; 5.2.1 Mechanismen; 5.2.2 Funktionsklassen; 5.2.3 Qualität; 5.3 ITSEC-Kriterien. , 5.3.1 Evaluationsstufen5.3.2 Qualität und Bewertung; 5.4 Common Criteria; 5.4.1 Überblick über dieCC; 5.4.2 CC-Funktionsklassen; 5.4.3 Schutzprofile; 5.4.4 Vertrauenswürdigkeitsklassen; 5.5 Zertifizierung; 6 Sicherheitsmodelle; 6.1 Modell-Klassifikation; 6.1.1 Objekte undSubjekte; 6.1.2 Zugriffsrechte; 6.1.3 Zugriffsbeschränkungen; 6.1.4 Sicherheitsstrategien; 6.2 Zugriffskontrollmodelle; 6.2.1 Zugriffsmatrix-Modell; 6.2.2 RollenbasierteModelle; 6.2.3 Chinese-Wall Modell; 6.2.4 Bell-LaPadula Modell; 6.3 Informationsflussmodelle; 6.3.1 Verbands-Modell; 6.4 Fazit undAusblick. , 7 Kryptografische Verfahren.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
    Monograph available for loan
    Monograph available for loan
    Hoboken : Taylor and Francis
    Call number: IASS 16.90022
    Description / Table of Contents: Today, the risks associated with global environmental change and the dangers of extreme climatic and geological events remind us of humanity's dependence on favourable environmental conditions. Our relationships with the landscapes and ecologies that we are a part of, the plants and animals that we share them with, and the natural resources that we extract, lie at the heart of contemporary social and political debates. It is no longer possible to understand key social scientific concerns without at the same time also understanding contemporary patterns of ecosystem change.The Routledge Interna
    Type of Medium: Monograph available for loan
    Pages: xv, 338 Seiten
    ISBN: 9781138645332
    Series Statement: Routledge International Handbooks
    Language: English
    Note: Cover; Title Page; Copyright Page; Table of Contents; List of illustrations; Notes on contributors; Acknowledgements; 1 Socio-ecological transformations and the social sciences; PART I Challenges, contradictions and consequences of global socio-ecological change; 2 Ecological modernization theory: taking stock, moving forward; 3 The emergence of new world-systems perspectives on global environmental change; 4 China's economic growth and environmental protection: approaching a 'win-win' situation? A discussion of ecological modernization theory; 5 Eco-imperialism and environmental justice. , 6 Neoliberalism by design: changing modalities of market-based environmental governance7 Dilemmas for standardizers of sustainable consumption; PART II Climate change, energy and adaptation; 8 Climate, scenario-building and governance: comprehending the temporalities of social-ecological change; 9 From Rio to Copenhagen: multilateral agreements, disagreements and situated actions; 10 Marriage on the rocks: sociology's counsel for our struggling energy-society relationships; 11 Sustainability as social practice: new perspectives on the theory and policies of reducing energy consumption. , 12 Environmental migration: nature, society and population movementPART III Urban environmental change, governance and adaptation; 13 Climate change and urban governance: a new politics?; 14 Recovering the city level in the global environmental struggle: going beyond carbon trading; 15 Hybrid arrangements within the environmental state; 16 The new mobilities paradigm and sustainable transport: finding synergies and creating new methods; PART IV Risk, uncertainty and social learning; 17 Towards a socio-ecological foundation for environmental risk research. , 18 Uncertainty and claims of uncertainty as impediments to risk management19 Transboundary risk governance: co-constructing environmental issues and political solutions; 20 The role of professionals in managing technological hazards: the Montara blowout; 21 Social learning to cope with global environmental change and unsustainability; PART V (Re)assembling social-ecological systems; 22 The social-ecological co-constitution of nature through ecological restoration: experimentally coping with inevitable ignorance and surprise. , 23 Biological invasions as cause and consequence of 'our' changing world: social and environmental paradoxes24 Biological resources, knowledge and property; 25 Disassembling and reassembling socionatural networks: integrated natural resource management in the Great Bear Rainforest; 26 Land use tensions for the development of renewable sources of energy; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 44
    Monograph available for loan
    Monograph available for loan
    University Park, Pa : Pennsylvania State University Press
    Call number: IASS 16.90520
    Description / Table of Contents: "An interdisciplinary study of democratic theory, empirical political science, psychology, and philosophy. Proposes a multidimensional process model of empathy that incorporates both affective and cognitive features to demonstrate the importance of empathy in fulfilling democracy's promise of giving equal consideration to all citizens in collective decisions"--Provided by publisher
    Type of Medium: Monograph available for loan
    Pages: viii, 221 S. , graph. Darst.
    ISBN: 9780271036595 (cloth) , 9780271036601 (pbk)
    Language: English
    Note: The democratic promiseThe deliberative turn in democratic theory -- The elusive concept of empathy -- Empathy in deliberative theory -- Empathy's importance : the empirical evidence -- Deliberative democracy and its critics -- Empathy and democracy..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
    Monograph available for loan
    Monograph available for loan
    Waterloo, Ontario :CIGI,
    Call number: IASS 16.90382
    Description / Table of Contents: Acronyms -- Acknowledgments -- Introduction -- Kimie Hara and Ken Coates -- Forces for Change in the Arctic: Reflections on a Region in Transition -- Ken Coates -- The Process of Formulating Japan's Arctic Policy: From Involvement to Engagement -- Fujio Ohnishi -- China and the Arctic: China's Interests and Participation in the Region -- Kai Sun -- Arctic Prospects and Challenges from a Korean Perspective -- Young Kil Park -- East Asia and the Arctic: Alaskan and American Perspectives -- Jerry McBeath -- Canada's Northern Strategy and East Asian Interests in the Arctic
    Description / Table of Contents: P. Whitney Lackenbauer and James Manicom -- The Cooperation of Russia and Northeast Asian Countries in the Arctic: Challenges and Opportunities -- Tamara Troyakova -- From Cold War Thaws to the Arctic Thaw: The Changing Arctic and Its Security Implications to East Asia -- Kimie Hara -- The Business of Arctic Development: East Asian Economic Interests in the Far North -- Carin Holroyd -- Border Dynamics in Eurasia: Implications for the Arctic Thaw -- Akihiro Iwashita -- The Arctic and Geopolitics -- David A. Welch -- East Asian States and the Pursuit of Arctic Council Observer Status
    Description / Table of Contents: James Manicom and P. Whitney Lackenbauer -- Contributors
    Description / Table of Contents: The Arctic's profile as a region for engagement and opportunity is rising among both circumpolar and non-circumpolar states
    Type of Medium: Monograph available for loan
    Pages: viii, 217 Seiten , Illustrationen, Karten
    ISBN: 9781928096023 (print) , 9781928096030
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 46
    Call number: IASS 16.90380
    Description / Table of Contents: Chapter 2 Governance of marine fisheries and biodiversity conservation: Convergence or coevolution?Introduction; Selected strands in fishery governance; Selected strands in conservation governance; Parallel strands in conservation and fishery governance; Discussion and conclusion; Notes; References; Chapter 3 Governance of marine fisheries and biodiversity conservation: The integration challenge; Introduction; Sustainable development backdrop; Integration process; Integration factors; Integration through interaction; Concluding thoughts; Notes; References; Part 2 Governance dimensions
    Description / Table of Contents: Chapter 4 Bio-ecological dimensions of fisheries management, biodiversity and governanceIntroduction and background; Fisheries management up to the 1990s; The ecological categories of impacts of fishing and their management; Areas of overlap and potential for inconsistencies between fisheries and conservation of biodiversity approaches; Venues for change; Conclusions; References; Chapter 5 The economic dimension: Addressing behaviour, incentives and context for effective governance; Introduction; Economic foundations of governance; The economic context of governance
    Description / Table of Contents: Evolving economic scope of governanceEconomic instruments in fisheries and marine conservation; Discussion: Economic instruments and prospects for governance integration; References; Chapter 6 The social dimension: The challenge of dealing with equity; Introduction: The two cultures; Fisheries management: creating wealth, forgetting about distribution; Conservation: creating values with unequal distribution of costs; Reconciling fisheries management and conservation; Consultation and co-management; Fisheries management and conservation within larger frameworks; Lessons learnt; Notes
    Description / Table of Contents: Governance of Marine Fisheries and Biodiversity Conservation; Copyright; Contents; Notes on contributors; Foreword Bonnie J. McCay; Foreword Árni M. Mathiesen; Foreword Braulio Ferreira de Souza Dias; Preface Serge M. Garcia, Jake Rice and Anthony Charles; Acknowledgements; List of selected acronyms; Glossary; Part 1 Governance trends and challenges; Chapter 1 Governance of marine fisheries and biodiversity conservation: A history; Introduction; Historical developments in fishery governance; Historical developments in biodiversity conservation; Conclusions; Notes; References
    Description / Table of Contents: Part 4. Regional governance. Regional governance for fisheries and biodiversity / R. Warner, K.M. Gjerde and D. Freestone ; Regional governance: The case of NEAFC and OSPAR / K. Hoydal, D. Johnson and A.H. Hoel ; Regional governance: The Mediterranean cradle / F. Simard, M. Camilleri and L. Sbai ; CCAMLR and Antarctic conservation: The leader to follow? / D. Miller and N.M. Slicer ; Implementation of the Ecosystem Approach to Fisheries in the Benguela Current LME area / J. Augustyn, S. Petersen, L. Shannon and H. Hamukuaya ; Governance of marine fisheries and conservation in the context of the European Union / S. Beslier and B. Drobenko -- Part 5. National governance. The use of national frameworks for sustainable development of marine fisheries and conservation, ecosystem-based management and integrated ocean management / K. Sainsbury, P. Gullestad and J. Rice ; Small-scale fisheries: Importance, vulnerability and deficient knowledge / J. Kolding, C. Béné and M. Bavinck ; Stewardship in tropical small-scale fisheries: Community and national perspectives / P. Christie, L.M. Campbell and N. Armada ; Making space for small-scale fishing communities: Use and misuse of spatial management instruments / M.R. Sowman, R. Rajagopalan, C. Sharma and J. Sunde ; ENGOs and SIDS: Environmental interventions in small island developing states / P. McConney, R. Pomeroy and Z. Khan ; The role of capacity building for improving governance of fisheries and conservation of marine ecosystems / J.C. Seijo and S. Salas ; Fishers' organizations: Their role in decision-making for fisheries and conservation / M. Makino, A.S. Cabanban and S. Jentoft ; The role of courts in fisheries management and marine biodiversity protection: US and EU systems / P. Shelley and T. van Rijn --
    Description / Table of Contents: Part 5. Conclusion. A tale of two streams: Synthesizing governance of marine fisheries and biodiversity conservation / A. Charles, S.M. Garcia and J. Rice -- Annexes. Annex 1: History of fisheries and biodiversity conservation: A timeline of key events (1850-2012) ; Annex 2: Key global institutions, bodies and processes: Roles, participation and main focus
    Description / Table of Contents: Part 1. Governance trends and challenges. Governance of marine fisheries and biodiversity conservation: A history / S.M. Garcia, J. Rice and A. Charles ; Governance of marine fisheries and biodiversity conservation: Convergence or coevolution? / S.M. Garcia, J. Rice and A. Charles ; Governance of marine fisheries and biodiversity conservation: The integration challenge / S.M. Garcia, J. Rice and A. Charles -- Part 2. Governance dimensions. Bio-ecological dimensions of fisheries management, biodiversity and governance / J. Rice and P. Mace ; The economic dimension: Addressing behaviour, incentives and context for effective governance / S. Hanna ; The social dimension: The challenge of dealing with equity / B. Hersoug ; The global legal dimension: Navigating the legal currents of rights and responsibilities / A.H. Hoel and D. VanderZwaag ; Spatial dimensions of fisheries and biodiversity governance / R. Kenchington, O. Vestergaard and S.M. Garcia ; Scientific foundation: Towards integration / J. Rice, S. Jennings and A. Charles -- Part 3. Global governance. Global level institutions and processes: Frameworks for understanding critical roles and foundations of cooperation and integration / L. Ridgeway ; Global level institutions and processes: Assessment of critical roles, foundations of cooperation and integration and their contribution to integrated marine governance / L. Ridgeway ; Integrative policy and legal instruments, approaches and tools: Fisheries and biodiversity conservation / B. Kuemlangan, J. Sanders, P. Deupmann and C. De Young ; Conservation and risk of extinction of marine species / P. Mace, C. O'Criodain, J. Rice and G. Sant ; Parallel initiatives: CBD's Ecologically or Biologically Significant Areas (EBSAs) and FAO's Vulnerable Marine Ecosystems (VMEs) criteria and processes / J. Rice, J. Lee and M. Tandstad --
    Description / Table of Contents: Governance of Marine Fisheries and Biodiversity Conservation explores governance of the world's oceans with a focus on the impacts of two inter-connected but historically separate streams of governance: one for fisheries, the other for biodiversity conservation. Chapters, most co-authored by leading experts from both streams, investigate the interaction of these governance streams from ecological, economic, social and legal perspectives, with emphasis on policies, institutions processes, and outcomes on scales from the global to the local community, and with coverage of a range of them
    Type of Medium: Monograph available for loan
    Pages: XXXVIII, 511 Seiten , Illustrationen, Karten
    ISBN: 9781118392645 (cloth)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 47
    facet.materialart.12
    Wiesbaden, Germany : Springer Gabler
    Call number: 9783658065287 (e-book)
    Description / Table of Contents: Die zügige und ganzheitliche Einarbeitung und Integration eines neuen Mitarbeiters (Onboarding) ist ein zentraler Prozess, um die Leistungsfähigkeit einer Organisation dauerhaft sicherstellen zu können. Diese Investitionsleistung zahlt sich mehrfach aus, denn nur auf dieser Grundlage wird der neue Mitarbeiter seine volle Leistungsfähigkeit und Leistungsbereitschaft zum Nutzen der Organisation entwickeln. Dieses Essential bietet konkrete Hilfestellungen, um den Onboarding-Prozess für alle Beteiligten - den neuen Mitarbeiter, die Führungskraft und den HR Bereich - erfolgreich gestalten zu können.
    Type of Medium: 12
    Pages: 1 online resource (39 pages)
    ISBN: 9783658065287 (e-book)
    ISSN: 2197-6716
    Series Statement: Essentials
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    Call number: 3/S 07.0034(2016)
    In: Annual report
    Type of Medium: Monograph available for loan
    Pages: 51 Seiten
    ISSN: 1865-6439 , 1865-6447
    Parallel Title: Erscheint auch als Annual report ... / Helmholtz Association of German Research Centres
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    facet.materialart.12
    Berlin : De Gruyter Saur
    Call number: 9783110278736 (e-book)
    Description / Table of Contents: Das Buch ist sowohl eine Einführung in die Themen Linked Data, Open Data und Open Linked Data als es auch den konkreten Bezug auf Bibliotheken behandelt. Hierzu werden konkrete Anwendungsprojekte beschrieben. Der Band wendet sich dabei sowohl an Personen aus der Bibliothekspraxis als auch an Personen aus dem Bibliotheksmanagement, die noch nicht mit dem Thema vertraut sind. Das Buch ist eine Einführung in die Themen Data. | This book is an introduction to the subjects of linked data, open data and open linked data, and to their specific relevance for libraries. It illustrates these concepts through detailed descriptions of actual data projects. The volume will be useful to individuals involved in library practice and those in library management who have not yet become familiarized with these important contemporary fields.
    Type of Medium: 12
    Pages: 1 Online-Ressource (1 electronic resource (vi, 244 p.))
    Edition: Online-Ausg.
    ISBN: 9783110278736 , 9783110276343
    Series Statement: Bibliotheks- und Informationspraxis 50
    Language: Undetermined
    Note: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    Monograph available for loan
    Monograph available for loan
    Hoboken : Taylor and Francis
    Call number: M.19 92130
    Description / Table of Contents: Learn How to Design Effective Visualization SystemsVisualization Analysis and Design provides a systematic, comprehensive framework for thinking about visualization in terms of principles and design choices. The book features a unified approach encompassing information visualization techniques for abstract data, scientific visualization techniques for spatial data, and visual analytics techniques for interweaving data transformation and analysis with interactive visual exploration. It emphasizes the careful validation of effectiveness and the consideration of function before form. The book bre
    Type of Medium: Monograph available for loan
    ISBN: 9781466508910
    Series Statement: AK Peters Visualization Series
    Classification:
    Informatics
    Language: English
    Note: Front Cover; Contents; Preface; 1. What's Vis, and Why Do It?; 2. What: Data Abstraction; 3. Why: Task Abstraction; 4. Analysis: Four Levels for Validation; 5. Marks and Channels; 6. Rules of Thumb; 7. Arrange Tables; 8. Arrange Spatial Data; 9. Arrange Networks and Trees; 10. Map Color and Other Channels; 11. Manipulate View; 12. Facet into Multiple Views; 13. Reduce Items and Attributes; 14. Embed: Focus+Context; 15. Analysis Case Studies; Figure Credits; Bibliography.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
  • 52
  • 53
    Non-book medium
    Non-book medium
    Heidelberg : Spektrum der Wissenschaft Verlagsgesellschaft
    Call number: (OCoLC)838497963
    Type of Medium: Non-book medium
    Pages: Online-Ressource (114 Seiten) , Illustrationen
    Series Statement: Sterne und Weltraum 50.2011,5
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
    Unknown
    Bonn : Galileo Press
    Keywords: iPad ; iPhone ; XCode ; Apps
    Description / Table of Contents: Klaus M. Rodewig und Clemens Wagner geben Ihnen einen Einblick in die Architektur des iPhone und des iPad und eine Anleitung zum Programmieren eigener Applikationen. Dabei werden alle wichtigen Themen in der gebotenen Tiefe mit Hintergrundwissen beschrieben. Praktische Beispiele unterstützen Sie von Anfang an, so dass Sie direkt loslegen können. Erste Ergebnisse können Sie im iPhone Simulator direkt testen. Sie erhalten einen Überblick über die verschiedenen iPhone- und iPod Touch-Modelle, erfahren, wie Sie in der Apple Developer Connection Mitglied werden können und Applikationen für das iPhone im Appstore anbieten können. Natürlich kommt in diesem Buch auch der Hintergrund nicht zu kurz. Eine kurze Einführung in Objective-C und Cocoa vermittelt Ihnen alles, was Sie wissen müssen. Inkl. Schnittstellen zum Datenaustausch, Events, Alerts, Datenverwaltung mit Core Data und die verschiedenen Möglichkeiten der Netzwerkprogrammierung. Profis werden von den Tipps und Tricks zur Konfiguration und Verwendung von Xcode, Debugging und der Arbeit mit einem Versionierungssystem profitieren.
    Pages: Online-Ressource (515 Seiten)
    Edition: 1. Aufl.
    ISBN: 9783836214636
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 55
    Unknown
    Basel, Boston, Berlin : Birkhäuser
    Keywords: engineering ; geophysics ; mining ; monitoring technology ; seismic monitoring ; seismic tomography ; seismology ; stress re-distribution
    Description / Table of Contents: Stress re-distribution as a result of exploitation of mineral, hydrocarbon, geothermal, and water resources cannot be eliminated. The effort must be directed to a better understanding of the underlying processes for the management of the hazard and risk associated with these operations. The study of induced seismicity has continually evolved over the past couple of decades, as underlined by both the number and complexity of applied studies required to satisfy the increased economic demands, assure the safety of the workforce and equipment, and protect the environment. A considerable effort has been put into the development of passive monitoring technology, specialized products and services being available for a wide range of applications. The recording of substantial high quality seismic data has stimulated the work on theoretical and practical aspects related to these applications, involving not only seismological knowledge, but also elements of rock mechanics, and an understanding of mining, geotechnical, and petroleum engineering. Pure and Applied Geophysics has largely contributed to raising the profile of induced seismicity research and its credibility. The range of specific analyses included in the present collection of studies expresses how powerful and resourceful passive seismic monitoring has become to so many applications. Seismic data are routinely evaluated for a series of development activities specific to each application. Engineering practice is continually improved based on trials and analyses of the ground response and stress levels, confirmed through the monitoring of seismicity. We are better equipped than ever to provide management decisions based on formalized, quantitative, and thus objective assessment.
    Pages: Online-Ressource (213 Seiten)
    ISBN: 9783034603058
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 56
    Unknown
    Washington, D. C. : The World Bank
    Keywords: alternative energy ; sustainable forest management ; carbon finance ; carbon ; forests ; climate change ; biodiversity conservation ; emissions ; oceans ; silver ; colors ; carbon sinks ; carbon offsets ; climate ; ecosystem ; emissions from deforestation ; coral reefs ; carbon stores ; forest ; sustainable forest
    Description / Table of Contents: Global warming and changes in climate will have severe and lasting impacts on national efforts to alleviate poverty and promote sustainable development. Some of the world s poorest countries and communities are the most vulnerable and are already suffering the consequences. Yet often these countries are rich in natural capital, ecosystems, and biodiversity that can contribute to solutions as they can to climate change. Biodiversity is the foundation and mainstay of agriculture, forests, and fisheries. Biological resources provide the raw materials for livelihoods, agriculture, medicines, trade, tourism, and industry. Forests, grasslands, freshwater, and marine and other natural ecosystems provide a range of services, often not recognized in national economic accounts but vital to human welfare: regulating water flows and water quality, flood control, pollination, decontamination, carbon sequestration, soil conservation, and nutrient and hydrological cycling. Current efforts to address climate change focus mainly on reducing emissions of greenhouse gases, mainly through cleaner energy strategies, and on attempting to reduce vulnerability of the communities at risk by improving infrastructure to meet new energy and water needs. This book book sets out a compelling argument for including ecosystem-based approaches to mitigation and adaptation as a third essential pillar in national strategies to address climate change. Such ecosystem-based strategies can offer cost-effective, proven and sustainable solutions contributing to, and complementing, other national and regional adaptation strategies.
    Pages: Online-Ressource (XII, 114 Seiten)
    ISBN: 9780821381274
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
    Keywords: oil spill ; valuation ; environmental degradation ; deforestation ; demolition and military waste ; air pollution ; middle east and north africa ; water degradation ; forest degradation ; land degradation
    Description / Table of Contents: How much is a cleaner environment worth? For policy makers, that question goes largely unanswered. It's not that the environment is seen as unimportant. It's simply much easier to compare the costs and benefits of tangible projects such as airports and electrical grids, than it is to weigh the merits of a landfill cleanup. Over the past decades, the World Bank has undertaken a systematic effort to put a monetary value on environmental degradation, which results sparked policy changes. This book brings together the best case studies of the Cost of Environmental Degradation undertaken in the Middle East and North Africa region and summarizes the major policy impacts at the national and regional levels. The case studies evaluate in monetary terms the annual damages caused by economic activities to natural resources and environment – water, forests, agricultural land, air quality, waste and coastal zone – and reflects the estimates as percentages of the countries’ gross domestic product. It then captures the estimated values in a holistic picture and illuminates their concrete implications on policy, investments, and institutions for the selected countries and for the region as a whole. In addition to being a multi-nation effort, the book stands out by applying updated methods and techniques to estimate natural resource damages both in times of peace and of conflict. This is particularly relevant for the Middle East and North Africa, a region located at the crossroads of different cultures, continents, and religions. This book is primarily targeted at policy makers at the regional, national and local levels and to decision makers in government agencies, NGOs, and natural resource development institutions. It is suitable for use in training courses of decision makers working in environment, forests and water related fields. The book should also be of interest to advanced undergraduates, master’s level students and undergraduates.
    Pages: Online-Ressource (XVIII, 168 Seiten)
    ISBN: 9780821383964
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 58
    Description / Table of Contents: The Earth's climate varies through geological time as a result of external, orbital processes, as well as the positions of continents, growth of mountains and the opening and closure of oceanic gateways. Climate modelling suggests that the intensity of the Asian monsoon should correlate, at least in part, with the uplift history of the Tibetan Plateau and the Himalaya, as well as the evolution of gateways and the retreat of shallow seas in Central Asia. Long-term reconstructions of both mountain building and monsoon activity are key to testing the proposed links. This collection of papers presents a series of new studies documenting the variations of the Asian monsoon on orbital and tectonic timescales, together with the impact this has had on environmental conditions. The issue of which proxies are best suited to measuring monsoons is addressed, as is the effect that the monsoon has had on erosion and the formation of the stratigraphic record both on and offshore.
    Pages: Online-Ressource (308 Seiten)
    ISBN: 9781862393103
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 59
    Description / Table of Contents: This volume combines original data in various fields from the offshore Levant Basin and adjacent continental slopes and platforms. The first group of papers document the tectonic structures and sedimentological patterns associated with the development of the Levant Basin. They identify the successive rifting events from the Late Palaeozoic to the Early Cretaceous, followed by a moderate tectonic activity. The contribution of external factors like global sea-level and climate changes to the sedimentation processes during the Mid-Cretaceous is discussed in the second set of papers. The final group presents new kinematics and age constraints on the Late Cretaceous to Neogene tectonic phases and discusses the relationship of the structures with the closure of the Neo-Tethys and separation of the Arabia plate. This collection of research papers demonstrates new concepts on the opening and crustal thinning of the Levant Basin and gives updated interpretations of the latter tectonic structures of the Levant.
    Pages: Online-Ressource (VII, 338 Seiten)
    ISBN: 9781862393066
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
    Description / Table of Contents: The discovery of dinosaurs and other large extinct ‘saurians’ - a term under which the Victorians commonly lumped ichthyosaurs, plesiosaurs, pterosaurs and their kin - makes exciting reading and has caught the attention of palaeontologists, historians of science and the general public alike. The papers in this collection go beyond the familiar tales about famous ‘fossil hunters’ and focus on relatively little-known episodes in the discovery and interpretation (from both a scientific and an artistic point of view) of dinosaurs and other inhabitants of the Mesozoic world. They cover a long time span, from the beginnings of ‘modern’ scientific palaeontology in the 1700s to the present, and deal with many parts of the world, from the Yorkshire coast to Central India, from Bavaria to the Sahara. The characters in these stories include professional palaeontologists and geologists (some of them well-known, others quite obscure), explorers, amateur fossil collectors, and artists, linked together by their interest in Mesozoic creatures.
    Pages: Online-Ressource (394 Seiten)
    ISBN: 9781862393110
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 61
    Description / Table of Contents: This wide area of the Alpine–Himalayan belt evolved through a series of tectonic events related to the opening and closure of the Tethys Ocean. In doing so it produced the largest mountain belt of the world, which extends from the Atlantic to the Pacific oceans. The basins associated with this belt contain invaluable information related to mountain building processes and are the locus of rich hydrocarbon accumulations. However, knowledge about the geological evolution of the region is limited compared to what they offer. This has been mainly due to the difficulty and inaccessibility of cross-country studies. This Special Publication is dedicated to the part of the Alpine–Himalayan belt running from Bulgaria to Armenia, and from Ukraine to the Arabian Platform. It includes twenty multidisciplinary studies covering topics in structural geology/tectonics; geophysics; geochemistry; palaeontology; petrography; sedimentology; stratigraphy; and subsidence and lithospheric modelling. This volume reports results obtained during the MEBE (Middle East Basin Evolution) Programme and related projects in the circum Black Sea and peri-Arabian regions.
    Pages: Online-Ressource (VII, 509 Seiten)
    ISBN: 9781862393080
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 62
    Description / Table of Contents: The invasion of the land by plants (‘terrestrialization’) was one of the most significant evolutionary events in the history of life on Earth, and correlates in time with periods of major palaeoenvironmental perturbations. The development of a vegetation cover on the previously barren land surfaces impacted on the global biogeochemical cycles and the geological processes of erosion and sediment transport. The terrestrialization of plants preceded the rise of major new groups of animals, such as insects and tetrapods, the latter numbering some 24 000 living species, including ourselves. Early land-plant evolution also correlates with the most spectacular decline of atmospheric CO2 concentration of Phanerozoic times and with the onset of a protracted period of glacial conditions on Earth. This book includes a selection of papers covering different aspects of the terrestrialization, from palaeobotany to vertebrate palaeontology and geochemistry, promoting a multidisciplinary approach to the understanding of the co-evolution of life and its environments during Early to Mid-Palaeozoic times.
    Pages: Online-Ressource (187 Seiten)
    ISBN: 9781862393097
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Description / Table of Contents: This volume honours the career of Brian F. Windley, who has been hugely influential in helping to achieve our current understanding of the evolution of the continental crust, and who has inspired many students and scientists to pursue studies on the evolution of the continents. Brian has studied processes of continental formation and evolution on most continents and of all ages, and has educated and inspired two generations of geologists to undertake careers in studies of continental evolution. The volume is organized into six sections, including: oceanic and island arc systems and continental growth; tectonics of accretionary orogens and continental growth; growth and stabilization of continental crust; collisions and intraplate processes; Precambrian tectonics and the birth of continents; and active tectonics and geomorphology of continental collision and growth zones.
    Pages: Online-Ressource (VIII, 414 Seiten)
    ISBN: 9781862393035
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
    Description / Table of Contents: The world's mountain ranges are the clearest manifestations of long-term deformation of the continental crust. As such they have attracted geological investigations for centuries. Throughout this long history of research a few keynote publications stand out. One of the most important is the Geological Survey's 1907 Memoir on The Geological Structure of the North-West Highlands of Scotland. The Memoir summarized some of the Geological Survey's finest work, and outlined many of the principles of field-based structural and tectonic analysis that have subsequently guided generations of geologists working in other mountain belts, both ancient and modern. The thematic set of 32 papers in this Special Publication celebrate the 100th anniversary of the 1907 Memoir by placing the original findings in both historical and modern contexts, and juxtaposing them against present-day studies of deformation processes operating not only in the NW Highlands, but also in other mountain belts.
    Pages: Online-Ressource (VII, 872 Seiten)
    ISBN: 9781862393004
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 65
    Keywords: licensing of petroleum exploration, development and production rights ; petroleum licensing rounds ; petroleum exploration ; allocation of petroleum exploration, development and production rights ; maximization of petroleum rent ; fiscal systems for hydrocarbons ; design of petroleum allocation systems ; petroleum policy ; petroleum depletion policy ; auctions of petroleum rights
    Description / Table of Contents: Governments often pursue a variety of economic, social and political objectives through their allocation policies that go beyond the maximization of the net present value of the economic rent. The optimal allocation policy depends on a range of country specific and exogenous factors. Despite the variety of factors influencing optimal design, most countries use similar solutions. In particular, when auctions or administrative procedures are used, most governments opt for simple simultaneous multi-object sealed-bid rounds. While this may appear to be paradoxical, there is a practical explanation. It is true that more complex bidding forms might increase rent capture at bidding. However, the potential marginal gain is often limited, owing to most E&P projects’ high level of uncertainty and risk. In addition market mechanisms, such as joint bidding and secondary markets, and the fiscal regime are widely used in the petroleum sector to correct inefficiency at the time of allocation.
    Pages: Online-Ressource (XIV, 106 Seiten)
    ISBN: 9780821381687
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Description / Table of Contents: Fjords are glacially over-deepened, semi-enclosed marine basins, but are often neglected as a sedimentary realm. They represent the transition from the terrestrial to the marine environment and as such have the potential to preserve evidence of environmental change. Typically most fjords have been glaciated a number of times and some high-latitude fjords still possess a resident glacier. The stratigraphic record in fjords largely preserves a glacial–deglacial cycle of deposition. Sheltered water and high sedimentation rates potentially make fjords ideal depositional environments for preserving continuous records of climate and environmental change with high temporal resolution. Fjords are also referred to as miniature oceans providing the unique opportunity to study marine processes in great detail. With predictions of warming climates, changing ocean circulation and rising sea levels, this volume is a timely look at these environmentally sensitive coastlines.
    Pages: Online-Ressource (VII, 380 Seiten)
    ISBN: 9781862393127
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    Description / Table of Contents: Echinoderms are a vast group of spiny-skinned animals including starfish, brittle-stars, sea urchins, sand dollars, feather stars, sea lilies and sea cucumbers. These relatives of chordates and hemichordates have inhabited the world’s oceans for more than 500 million years. Modern members of the Echinodermata are, with over 7 000 species, an integral part of marine communities from the intertidal to the deep sea. Echinoderms play a major ecological role in marine habitats and are of economic importance in fisheries, aquaculture and biomedicine. The present volume contains the abstracts of lectures and posters presented during the 7th European Conference on Echinoderms (ECE) as well as excursion guides. This year’s conference was held at the northern campus of the Georg-August University in Göttingen, Germany, from October 2-9, 2010. More than 100 biologists, palaeontologists and other scientists from 25 countries participated.
    Pages: Online-Ressource (145 Seiten)
    ISBN: 9783941875685
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Description / Table of Contents: Für alle Regionen, die auf den Tourismus als ökonomisches Standbein setzen, ist ein marktfähiges Alleinstellungsmerkmal wichtig. Die Kulturlandschaft in ihrer jeweils besonderen Eigenart bietet hierfür ein endogenes Potenzial, das es zu erschließen, aber gleichermaßen auch zu schützen gilt. Doch viele kulturlandschaftliche Charakteristika und Besonderheiten eröffnen sich nicht unmittelbar, sondern müssen erst herausgearbeitet und „interpretiert“ werden. Darin liegt die grundlegende Herausforderung. Der vorliegende Band beinhaltet zum einen theoretische Auseinandersetzungen mit dem Thema Kulturlandschaftsforschung aus der Perspektive verschiedener wissenschaftlicher Fachrichtungen, zum anderen praxisbezogene Fallbeispiele, die aufzeigen, wie die Forschungsergebnisse einem Freizeitpublikum auf interessante Art und Weise vermittelt werden können. Denn die Kulturlandschaft ist beides – wissenschaftliches Forschungsobjekt und Vermittlungsraum im Kontext touristischer Freizeitgestaltung.
    Pages: Online-Ressource (179 Seiten)
    ISBN: 9783941875333
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    Description / Table of Contents: Onshore fold–thrust belts are commonly perceived as ‘difficult’ places to explore for hydrocarbons and are therefore often avoided. However, these belts host large oil and gas fields and so these barriers to effective exploration mean that substantial unexploited resources may remain. Over time, evaluation techniques have improved. It is possible in certain circumstances to achieve good 3D seismic data. Structural restoration techniques have moved into the 3D domain and increasingly sophisticated palaeo-thermal indicators allow better modelling of burial and uplift evolution of source and reservoirs. Awareness of the influence of pre-thrust structure and stratigraphy and of hybrid thick and thin-skinned deformation styles is augmenting the simplistic geometric models employed in earlier exploration. But progress is a slow, expensive and iterative process. Industry and academia need to collaborate in order to develop and continually improve the necessary understanding of subsurface geometries, reservoir and charge evolution and timing; this publication offers papers on specific techniques, outcrop and field case studies.
    Pages: Online-Ressource (190 Seiten)
    ISBN: 9781862393172
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Description / Table of Contents: Einen Überblick für Einsteiger, die ihr gedrucktes Kulturgut durch Digitalisierung schützen und zugänglich machen möchten, bietet dieses Handbuch. Es stellt die einzelnen Phasen des Digitalisierungsprozesses vor und liefert weitere, ergänzende Informationen für die detaillierte Beschäftigung mit diesem Thema.
    Pages: Online-Ressource (116 Seiten)
    ISBN: 9783935656408
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Keywords: carbon ; energy ; climate change ; coal emissions ; energy efficiency
    Description / Table of Contents: This study from the Independent Evaluation Group draws lessons for development and climate change mitigation from the World Bank Group’s far-reaching portfolio of projects in energy, forestry, transport, coal power, and technology transfer. Reviewing what has worked, what hasn’t, and why, the evaluation’s key findings include: Energy efficiency can offer countries direct economic returns that dwarf those of most other development projects, while also reducing greenhouse gas emissions. Tropical forest protected areas, on average, significantly reduce tropical deforestation, preserving carbon and biodiversity. Deforestation rates are lower in areas that allowed sustainable use by local populations than in strictly protected areas. Deforestation rates were lowest of all in indigenous forest areas. For renewable energy projects, long-duration loans have been important in making projects financially viable.. But at prevailing carbon prices, carbon offset sales had little impact on most renewable energy projects’ rate of returns, and did not address investors’ need for up-front capital. Technology transfer – broadly understood to include diffusion of technical and financial innovations related to low-carbon development – has worked well when the logic of piloting and demonstration is well thought out, and when grants are used to mitigate the risk of pioneering efforts.
    Pages: Online-Ressource (XXXIX, 128 Seiten)
    ISBN: 9780821386545
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    Description / Table of Contents: Human impact on our environment is not a new phenomenon. For millennia, humans have been coping with – or provoking – environmental change. We have exploited, extracted, over-used, but also in many cases nurtured, the resources that the geosphere offers. Geoarchaeology studies the traces of human interactions with the geosphere and provides the key to recognizing landscape and environmental change, human impacts and the effects of environmental change on human societies. This collection of papers from around the world includes case studies and broader reviews covering the time period since before modern human beings came into existence up until the present day. To understand ourselves, we need to understand that our world is constantly changing, and that change is dynamic and complex. Geoarchaeology provides an inclusive and long-term view of human–geosphere interactions and serves as a valuable aid to those who try to determine sustainable policies for the future.
    Pages: Online-Ressource (VII, 200 Seiten)
    ISBN: 9781862393257
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
    Unknown
    New York : Academic Press
    Keywords: DDC 512.897 ; LC QA3 ; Geometry, Projective ; Transformations (Mathematics)
    Pages: Online-Ressource (318 pages)
    ISBN: 9780120722501
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 74
    Unknown
    New York : Academic Press
    Keywords: DDC 517.38 ; LC QA3 ; Differential equations ; Functions
    Pages: Online-Ressource (xiii, 432 pages)
    ISBN: 9780123745811
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Keywords: china ; climate change ; east asia ; energy and environment ; energy efficiency ; energy financing ; energy policy ; renewable energy ; sustainable energy ; world bank
    Description / Table of Contents: East Asia has experienced the fastest economic growth in the world over the last three decades, accompanied by a 10-fold gross domestic product increase and rapid urbanization. Energy consumption has more than tripled during this period and is expected to double over the next 20 years. This remarkable trend has led to twin energy challenges in the region - environmental sustainability and energy security. Written for an audience of energy policy makers and practitioners, Winds of Change explores the region’s energy future over the next two decades through two energy scenarios. It outlines the strategic direction East Asia’s energy sector must take to meet its growing energy demand in an environmentally sustainable manner, and presents a pathway of policy frameworks and financing mechanisms to get there. The six East Asian countries - China, Indonesia, Malaysia, the Philippines, Thailand, and Vietnam - examined in this book could, with the right policies and financing, stabilize CO2 emissions by 2025, improve their local environment, and enhance energy security without compromising economic growth. They must move their energy sectors toward much higher efficiency and more widespread use of low-carbon technologies, while obtaining substantial financing and low-carbon technologies from developed countries. This clean energy revolution requires major policy and institutional reforms, including energy pricing reforms, regulations such as energy efficiency standards, financial incentives such as feed-in tariffs for renewable energy, and accelerated research and development. Finally, building low-carbon cities will be key to containing the rapid urban energy growth through compact urban design, public transport, clean vehicles, and green buildings. The window of opportunity is closing fast - delaying action would lock the region into a longlasting high-carbon infrastructure. The technical and policy means exist for such transformational changes, but only strong political will and unprecedented international cooperation will make them happen.
    Pages: Online-Ressource (XVII, 154 Seiten)
    ISBN: 978082138502
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    Unknown
    Rijeka : InTech
    Keywords: environmental remote sensing ; biomass
    Description / Table of Contents: Biomass has been an intimate companion of humans from the dawn of civilization to the present. Its use as food, energy source, body cover and as construction material established the key areas of biomass usage that extend to this day. Given the complexities of biomass as a source of multiple end products, this volume sheds new light to the whole spectrum of biomass related topics by highlighting the new and reviewing the existing methods of its detection, production and usage. We hope that the readers will find valuable information and exciting new material in its chapters.
    Pages: Online-Ressource (496 Seiten)
    ISBN: 9789533074924
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Keywords: distribution of snow, ice and glaciers ; glaciation ; ice ages ; glacier dynamics ; mass balance ; snowfall and snow cover
    Description / Table of Contents: The earth’s cryosphere, which includes snow, glaciers and ice caps, ice sheets, ice shelves, sea ice, river and lake ice, and frozen ground, contains about 75% of the earth’s fresh water. It exists at almost all latitudes, from the tropics to the poles, and plays a vital role in controlling the global climate system. It also provides direct visible evidence of the effect of climate change, and, therefore, requires proper understanding of the complex dynamics. This encyclopedia mainly focuses on the various aspects of snow, ice and glaciers, but also covers other cryospheric branches, and provides an up-to-date information and basic concepts on relevant topics. It includes alphabetically arranged and professionally written, comprehensive and authoritative academic articles by well-known international experts in individual fields. The encyclopedia contains a broad spectrum of topics, ranging from the atmospheric processes responsible for snow formation; transformation of snow to ice and changes in their properties; classification of ice and glaciers and their worldwide distribution; glaciation and ice ages; glacier dynamics; glacier surface and subsurface characteristics; geomorphic processes and landscape formation; hydrology and sedimentary systems; permafrost degradation; hazards caused by cryospheric changes; and trends of glacier retreat on the global scale along with the impact of climate change. This book can serve as a source of reference at the undergraduate and graduate level and help better understand snow, ice and glaciers. This will also be an indispensable tool containing specialized literature for geologists, geographers, climatologists, hydrologists, and water resources engineers; as well as to those who are engaged in the practice of agricultural and civil engineering, earth sciences, environmental sciences and engineering, ecosystem management, and other relevant subjects.
    Pages: Online-Ressource (XLVI, 1253 Seiten)
    ISBN: 9789048126422
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    Unknown
    Rijeka : InTech
    Keywords: climate change
    Description / Table of Contents: This book shows some of the socio-economic impacts of climate change according to different estimates of the current or estimated global warming. A series of scientific and experimental research projects explore the impacts of climate change and browse the techniques to evaluate the related impacts. These 23 chapters provide a good overview of the different changes impacts that already have been detected in several regions of the world. They are part of an introduction to the researches being done around the globe in connection with this topic. However, climate change is not just an academic issue important only to scientists and environmentalists; it also has direct implications on various ecosystems and technologies.
    Pages: Online-Ressource (454 Seiten)
    ISBN: 9789533074115
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
    Unknown
    Rijeka : InTech
    Keywords: sedimentology
    Description / Table of Contents: The purpose of this book is to put together recent developments on sediment transport and morphological processes. There are twelve chapters in this book contributed by different authors who are currently involved in relevant research. First three chapters provide information on basic and advanced flow mechanisms including turbulence and movement of particles in water. Examples of computational procedures for sediment transport and morphological changes are given in the next five chapters. These include empirical predictions and numerical computations. Chapters nine and ten present some insights on environmental concerns with sediment transport. Last two contributions deal with two large-scale case studies related to changes in the transport and provenance of glacial marine sediments, and processes involving land slides.
    Pages: Online-Ressource (250 Seiten)
    ISBN: 9789533073743
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 80
    Unknown
    Rijeka : InTech
    Keywords: environmental impact assessment ; biofuel
    Description / Table of Contents: This book aspires to be a comprehensive summary of current biofuels issues and thereby contribute to the understanding of this important topic. Readers will find themes including biofuels development efforts, their implications for the food industry, current and future biofuels crops, the successful Brazilian ethanol program, insights of the first, second, third and fourth biofuel generations, advanced biofuel production techniques, related waste treatment, emissions and environmental impacts, water consumption, produced allergens and toxins. Additionally, the biofuel policy discussion is expected to be continuing in the foreseeable future and the reading of the biofuels features dealt with in this book, are recommended for anyone interested in understanding this diverse and developing theme.
    Pages: Online-Ressource (270 Seiten)
    ISBN: 9789533074795
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Unknown
    Rijeka : InTech
    Keywords: oceanography ; atmospheric sciences
    Description / Table of Contents: Leading air quality professionals describe different aspects of air pollution. The book presents information on four broad areas of interest in the air pollution field; the air pollution monitoring; air quality modeling; the GIS techniques to manage air quality; the new approaches to manage air quality. This book fulfills the need on the latest concepts of air pollution science and provides comprehensive information on all relevant components relating to air pollution issues in urban areas and industries. The book is suitable for a variety of scientists who wish to follow application of the theory in practice in air pollution. Known for its broad case studies, the book emphasizes an insightful of the connection between sources and control of air pollution, rather than being a simple manual on the subject.
    Pages: Online-Ressource (584 Seiten)
    ISBN: 9789533075112
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Keywords: agriculture
    Description / Table of Contents: When Foucault introduced the concept of biopolitics, he referred to a historically specific power agenda involving a particular approach to life. This approach was at the root of the modern sciences of biology and political economy, both of which set out to describe, explain and manage their objects of study as abstract processes of production and reproduction. Agricultural science must be situated in relation to the biopolitical agenda of 'applying' the modern scientific approach to the management of social life. The scientification of agriculture took place in the United States towards the end of the 19th century, through a process that entailed both a delegitimation of farmer-generated knowledges and the production of new, modern subjectivities. While farmers were being reconceptualized as entrepreneurs in need of scientific education and advice, newly trained agronomists devoted themselves to designing fertilizers, pesticides and hybrid seeds with the goal of maximizing yields. Public institutions were created which coordinated agricultural production with both science and trade policy. Agricultural science was thus inseparable from the process which transformed much of US agriculture into transnational agribusiness, and local farming networks all over the world into consumer endpoints of a globalized food industry.
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Description / Table of Contents: Professor Richard (Rick) Sibson revolutionized structural geology by illustrating that fault rocks contain an integrated record of earthquakes. Fault-rock textures develop in response to geological and physical variables such as composition, environmental conditions (e.g. temperature and pressure), fluid presence and strain rate. These parameters also determine the rate- and state-variable frictional stability of a fault, the dominant mineral deformation mechanism and shear strength, and ultimately control the partitioning between seismic and aseismic deformation. This volume contains a collection of papers that address the geological record of earthquake faulting from field-based or theoretical perspectives. The papers cover observations in active fault zones, the relationships between fault rocks and fault-slip styles, interpretation of fault-rock textures from the base of the seismogenic zone, consideration of the effects of fluids on faulting, discussion of fault reactivation v. initiation, and a review of future directions in geological earthquake research by Professor Sibson.
    Pages: Online-Ressource (VIII, 341 Seiten)
    ISBN: 9781862393370
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Keywords: energy forms ; energy matters ; energy flows
    Description / Table of Contents: While I write this Introduction, the meltdown of the three reactors at the Fukushima Daiichi Nuclear Power Plant in March 2011 is apparently still not under control and made new energy-saving technologies the centre of attention at CEATEC, Japan's largest information technology and electronics fair, in October of the same year. Hope rises among environmentally-conscious scientists like Sasaki et al. that better management of the island’s many forests and policy reinforcements will allow the sustainable use of woody biomass or any other natural resource freely available (as documented by the non-profit organization Japan for Sustainability or the German Energy Rich Japan Project) in order to generate the 858.5 billion kWh the Japanese population currently consumes per year. The techno-natural disaster has also recharged the empty batteries of anti-nuclear movements, not only in Japan, and fuelled pronunciamentos by political parties of almost all creeds for an ‚energy turn’ world-wide. In order to write the above paragraph, dozens of google clicks were needed, each spending an amount of energy equivalent to letting a light bulb of 60 watts burn for 18 seconds. And many dozens of clicks more to search for open-access articles and other information to compile this collection. Like all digital practices and social media, the Living Books about Life project depends upon energy-intensive infrastructures, partly coal-powered data centres (see dirty-data report by Greenpeace) and an equally energy-intensive cooling system for servers that never sleep. But this is not a book about renewable energies and how to turn the land of the rising sun into the Kingdom of Solar Energy or joining hands with Cheeky Cloud and making windmills turn round and round while unfriending Facebook’s Dirty Coal as promoted by the Greenpeace compaign and video. An energetic (r)evolution is depending on a climate change on all levels of society (including the microlevel of the individual and his or her life-style) and not just on a technological fix. This book is hence not exclusively about the E(nergy) of scientific equations such as Einstein's famous formula E = mc2. It is, rather, a book about energy as a nomadic concept and material-semiotic agent of transformation. Tapping into energy as both an idea and a substance, I hope to add another atom to Vicki Kirby's recent 'quantum-anthropological' proposition of a 'meta-physis of life at large' (2011). Or call it a modest proposal to embrace a 'cosmopolitics' (Stengers, 2010 and 2011) in order to sustain good vibrations.
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Keywords: soil science ; hydrology
    Description / Table of Contents: There are several books on broad aspects of hydrogeology, groundwater hydrology and geohydrology, which do not discuss in detail on the intrigues of hydraulic conductivity elaborately. However, this book on Hydraulic Conductivity presents comprehensive reviews of new measurements and numerical techniques for estimating hydraulic conductivity. This is achieved by the chapters written by various experts in this field of research into a number of clustered themes covering different aspects of hydraulic conductivity. The sections in the book are: Hydraulic conductivity and its importance, Hydraulic conductivity and plant systems, Determination by mathematical and laboratory methods, Determination by field techniques and Modelling and hydraulic conductivity. Each of these sections of the book includes chapters highlighting the salient aspects and most of these chapters explain the facts with the help of some case studies. Thus this book has a good mix of chapters dealing with various and vital aspects of hydraulic conductivity from various authors of different countries.
    Pages: Online-Ressource (434 Seiten)
    ISBN: 9789533072883
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    Keywords: energy engineering
    Description / Table of Contents: Nowadays, the increasing use of power electronics equipment origins important distortions. The perfect AC power systems are a pure sinusoidal wave, both voltage and current, but the ever-increasing existence of non-linear loads modify the characteristics of voltage and current from the ideal sinusoidal wave. This deviation from the ideal wave is reflected by the harmonics and, although its effects vary depending on the type of load, it affects the efficiency of an electrical system and can cause considerable damage to the systems and infrastructures. Ensuring optimal power quality after a good design and devices means productivity, efficiency, competitiveness and profitability. Nevertheless, nobody can assure the optimal power quality when there is a good design if the correct testing and working process from the obtained data is not properly assured at every instant; this entails processing the real data correctly. In this book the reader will be introduced to the harmonics analysis from the real measurement data and to the study of different industrial environments and electronic devices.
    Pages: Online-Ressource (278 Seiten)
    ISBN: 9789533073354
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Unknown
    Rijeka : InTech
    Keywords: energy engineering ; renewable resources
    Description / Table of Contents: The second book of the four-volume edition of "Solar cells" is devoted to dye-sensitized solar cells (DSSCs), which are considered to be extremely promising because they are made of low-cost materials with simple inexpensive manufacturing procedures and can be engineered into flexible sheets. DSSCs are emerged as a truly new class of energy conversion devices, which are representatives of the third generation solar technology. Mechanism of conversion of solar energy into electricity in these devices is quite peculiar. The achieved energy conversion efficiency in DSSCs is low, however, it has improved quickly in the last years. It is believed that DSSCs are still at the start of their development stage and will take a worthy place in the large-scale production for the future.
    Pages: Online-Ressource (492 Seiten)
    ISBN: 9789533077352
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Unknown
    Open Humanities Press
    Keywords: Invisible Web ; Black Holes ; Invisibility Cloak ; Dark Matter ; Stealth ; Seeing and Unseeing ; Microscopic
    Description / Table of Contents: Given that the essence of the invisible lies in our inability to see it, the large number of cultural attempts to represent and mobilise it as metaphor presents an irony. The use of invisibility as a trope dates back at least to the legend of Gyges, discussed in Plato's Republic, written around 360 BC. Gyges discovers a ring that makes him invisible; the advantage this bestows helps him to win a kingdom. Ancient etymology indicates that the name of Hades, Greek god of the underworld, means ‘invisible’ and in mythology, a helmet, rather than a ring, enables Hades to escape detection (Roman & Roman, 2009: 182). More recently, H.G. Wells warned of its dangers, exploring the suspicion and havoc invisibility can wreak; Queen have sung about its appeal; and Harry Potter dons an invisibility cloak to vanquish dark forces in the first book. In philosophy, at least for Merleau-Ponty and Derrida, albeit in different ways, the possibility of perception relies on the difference between the visible and invisible (see Reynolds, 2004). After Adam Smith, economists refer to the ‘invisible hand’ of the market: indicating a supposedly self-regulating entity. In terms of identity politics the invisible is used as a marker of the marginalised and voiceless – unrecognised by the state or society and without power, they are effectively invisible. Ralph Ellison’s Invisible Man, for example, begins: ‘I am an invisible man. No, I am not a spook like those who haunted Edgar Allan Poe; nor am I one of your Hollywood-movie ectoplasms. I am a man of substance, of flesh and bone, fibre and liquids - and I might even be said to possess a mind. I am invisible, understand, simply because people refuse to see me’ (1952: 1). As a result of all this cultural activity around the invisible, the strangeness, the absence, the alterity that attracts us, and encourages us to find ways to represent invisibility through existing paradigms, is undoubtedly domesticated.
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Unknown
    Open Humanities Press
    Keywords: symbiosis ; evolution ; ecology ; posthumanism ; augmentation
    Description / Table of Contents: Different species, interacting in a symbiotic fashion, living together over a prolonged period of time, eventually co-evolving into new species: this vision of the biological phenomenon of symbiosis has created a strong impression—both of symbiosis as a metaphor and a material reality—of species in an intimate relationship together, cooperating in spite of differences, of becoming something else and transgressing boundaries. This idea has turned the concept of symbiosis, in its many guises and definitions,[1] into a breading ground for a posthuman, biologically and ecologically informed critique. Less focused on the biological process of symbiosis as such, our focus in Symbiosis: Ecologies, Assemblages and Evolution is more on how symbiosis can be used as a means to argue for an alternative worldview and even a better world. Interestingly, Angela Elizabeth Douglas notices a similar effect in her book The Symbiotic Habit (2010), where she talks about the growing importance of ‘applied symbiosis research’. Douglas refers above all to how research into symbiotic processes has the potential to help solve some of the practical problems mankind is facing through anthropogenically induced effects, such as climate change and environmental disasters; and in this way influence and improve (our) ecosystem(s) and make the world in which we live much healthier (Douglas, 2010: viii). This living book consists of a number of examples of how symbiosis has been deployed. For instance, as a critique of the mainstream Darwinian idea of evolution as struggle; of the anthropocentric worldview that operates within the sciences and society at large; and of the idea of organisms or objects as static and isolated entities. Given the way in which symbiotic processes offer seeds for alternative worldviews, research on symbiosis has been taken-up as providing evidence for becoming as an infinite creative process, for the (animal, microbal, machinic, and/or virtual) other as an integral part of the multiple I, and for the integrated cooperation of living and non-living affects as one interconnected mesh.
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Unknown
    Rijeka : InTech
    Keywords: soil science
    Description / Table of Contents: Soil erosion affects a large part of the Earth surface, and accelerated soil erosion is recognized as one of the main soil threats, compromising soil productive and protective functions. The land management in areas affected by soil erosion is a relevant issue for landscape and ecosystems preservation. In this book we collected a series of papers on erosion, not focusing on agronomic implications, but on a variety of other relevant aspects of the erosion phenomena. The book is divided into three sections: i) various implications of land management in arid and semiarid ecosystems, ii) erosion modeling and experimental studies; iii) other applications (e.g. geoscience, engineering). The book covers a wide range of erosion-related themes from a variety of points of view (assessment, modeling, mitigation, best practices etc.).
    Pages: Online-Ressource (320 Seiten)
    ISBN: 9789533077109
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Unknown
    Rijeka : InTech
    Keywords: globalization ; business ; management ; economics
    Description / Table of Contents: To better understand the contemporary world, the world of innovation and technology, science should try to synthesize and assimilate social science in the development of our civilization. Does the new era require new knowledge? Does the age of globalization demand new education, new human attitudes? This books tries to clarify these questions. The book New Knowledge in a New Era of Globalization consists of 16 chapters divided into three sections: Globalization and Education; Globalization and Human Being; Globalization and Space. The Authors of respective chapters represent a great diversity of disciplines and methodological approaches as well as a variety of academic culture. This book is a valuable contribution and it will certainly be appreciated by a global community of scholars.
    Pages: Online-Ressource (354 Seiten)
    ISBN: 9789533075013
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    Unknown
    Rijeka : InTech
    Keywords: crop ; agricultural and biological sciences
    Description / Table of Contents: Crop production depends on the successful implementation of the soil, water, and nutrient management technologies. Food production by the year 2020 needs to be increased by 50 percent more than the present levels to satisfy the needs of around 8 billion people. Much of the increase would have to come from intensification of agricultural production. Importance of wise usage of water, nutrient management, and tillage in the agricultural sector for sustaining agricultural growth and slowing down environmental degradation calls for urgent attention of researchers, planners, and policy makers. Crop models enable researchers to promptly speculate on the long-term consequences of changes in agricultural practices. In addition, cropping systems, under different conditions, are making it possible to identify the adaptations required to respond to changes. This book adopts an interdisciplinary approach and contributes to this new vision. Leading authors analyze topics related to crop production technologies. The efforts have been made to keep the language as simple as possible, keeping in mind the readers of different language origins. The emphasis has been on general descriptions and principles of each topic, technical details, original research work, and modeling aspects. However, the comprehensive journal references in each area should enable the reader to pursue further studies of special interest. The subject has been presented through fifteen chapters to clearly specify different topics for convenience of the readers.
    Pages: Online-Ressource (276 Seiten)
    ISBN: 9789533077871
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Keywords: global change ; environmental change ; environmental sciences
    Description / Table of Contents: Over the years, environmental change has sharpened significant dynamic evolution and knowledge in organizational structures of organisms, from cellular/molecular to macro-organism level including our society. Changes in social and ecological systems due to environmental change will hopefully result in a shift towards sustainability, with legislative and government entities responding to diverse policy and management issues concerning the building, management and restoration of social-ecological systems on a regional and global scale. Solutions are particularly needed at the regional level, where physical features of the landscape, biological systems and human institutions interact. The purpose of this book is to disseminate both theoretical and applied studies on interactions between human and natural systems from multidisciplinary research perspectives on global environmental change. It combines interdisciplinary approaches, long-term research and a practical solution to the increasing intensity of problems related to environmental change, and is intended for a broad target audience ranging from students to specialists.
    Pages: Online-Ressource (154 Seiten)
    ISBN: 9789533077093
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Keywords: biodiversity ; environmental sciences
    Description / Table of Contents: As everybody knows, the dynamic interactions between biotic and abiotic factors, as well as the anthropic ones, considerably affect global climate changes and consequently biology, ecology and distribution of life forms of our planet. These important natural events affect all ecosystems, causing important changes on biodiversity. Systematic and phylogenetic studies, biogeographic distribution analysis and evaluations of diversity richness are focal topics of this book written by international experts, some even considering economical effects and future perspectives on the managing and conservation plans.
    Pages: Online-Ressource (392 Seiten)
    ISBN: 9789533077963
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    Unknown
    Rijeka : InTech
    Keywords: tsunami ; environmental sciences
    Description / Table of Contents: Submarine earthquakes, submarine slides and impacts may set large water volumes in motion characterized by very long wavelengths and a very high speed of lateral displacement, when reaching shallower water the wave breaks in over land – often with disastrous effects. This natural phenomenon is known as a tsunami event. By December 26, 2004, an event in the Indian Ocean, this word suddenly became known to the public. The effects were indeed disastrous and 227,898 people were killed. Tsunami events are a natural part of the Earth’s geophysical system. There have been numerous events in the past and they will continue to be a threat to humanity; even more so today, when the coastal zone is occupied by so much more human activity and many more people. Therefore, tsunamis pose a very serious threat to humanity. The only way for us to face this threat is by increased knowledge so that we can meet future events by efficient warning systems and aid organizations. This book offers extensive and new information on tsunamis; their origin, history, effects, monitoring, hazards assessment and proposed handling with respect to precaution. Only through knowledge do we know how to behave in a wise manner. This book should be a well of tsunami knowledge for a long time, we hope.
    Pages: Online-Ressource (714 Seiten)
    ISBN: 9789533075525
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Keywords: earthquake ; seismology ; geology ; geophysics
    Description / Table of Contents: The study of earthquakes combines science, technology and expertise in infrastructure and engineering in an effort to minimize human and material losses when their occurrence is inevitable. This book is devoted to various aspects of earthquake research and analysis, from theoretical advances to practical applications. Different sections are dedicated to ground motion studies and seismic site characterization, with regard to mitigation of the risk from earthquake and ensuring the safety of the buildings under earthquake loading. The ultimate goal of the book is to encourage discussions and future research to improve hazard assessments, dissemination of earthquake engineering data and, ultimately, the seismic provisions of building codes.
    Pages: Online-Ressource (380 Seiten)
    ISBN: 9789533078403
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    Keywords: geology ; geophysics
    Description / Table of Contents: With growing attention on global environmental and climate change, geoscience has experienced rapid change and development in the last three decades. Many new data, methods and modeling techniques have been developed and applied in various aspects of geoscience. The chapters collected in this book present an excellent profile of the current state of various data, analysis methods and modeling techniques, and demonstrate their applications from hydrology, geology and paleogeomorphology, to geophysics, environmental and climate change. The wide range methods and techniques covered in the book include information systems and technology, global position system (GPS), digital sediment core image analysis, fuzzy set theory for hydrology, spatial interpolation, spectral analysis of geophysical data, GIS-based hydrological models, high resolution geological models, 3D sedimentology, change detection from remote sensing, etc. Besides two comprehensive review articles, most chapters focus on in-depth studies of a particular method or technique.
    Pages: Online-Ressource (336 Seiten)
    ISBN: 9789533077376
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Unknown
    Rijeka : InTech
    Keywords: mineralogy ; physical sciences ; engineering ; technology
    Description / Table of Contents: An Introduction to the Study of Mineralogy is a collection of papers that can be easily understood by a wide variety of readers, whether they wish to use it in their work, or simply to extend their knowledge. It is unique in that it presents a broad view of the mineralogy field. The book is intended for chemists, physicists, engineers, and the students of geology, geophysics, and soil science, but it will also be invaluable to the more advanced students of mineralogy who are looking for a concise revision guide.
    Pages: Online-Ressource (154 Seiten)
    ISBN: 9789533078960
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Unknown
    Rijeka : InTech
    Keywords: x-ray ; spectroscopy ; physical sciences ; engineering ; technology
    Description / Table of Contents: The x-ray is the only invention that became a regular diagnostic tool in hospitals within a week of its first observation by Roentgen in 1895. Even today, x-rays are a great characterization tool at the hands of scientists working in almost every field, such as medicine, physics, material science, space science, chemistry, archeology, and metallurgy. With vast existing applications of x-rays, it is even more surprising that every day people are finding new applications of x-rays or refining the existing techniques. This book consists of selected chapters on the recent applications of x-ray spectroscopy that are of great interest to the scientists and engineers working in the fields of material science, physics, chemistry, astrophysics, astrochemistry, instrumentation, and techniques of x-ray based characterization. The chapters have been grouped into two major sections based upon the techniques and applications. The book covers some basic principles of satellite x-rays as characterization tools for chemical properties and the physics of detectors and x-ray spectrometer. The techniques like EDXRF, WDXRF, EPMA, satellites, micro-beam analysis, particle induced XRF, and matrix effects are discussed. The characterization of thin films and ceramic materials using x-rays is also covered.
    Pages: Online-Ressource (280 Seiten)
    ISBN: 9789533079677
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Keywords: guide ; thin section microscopy
    Description / Table of Contents: Die polarisationsmikroskopische Untersuchung von Materialien (Minerale, Gesteine, Erze, Werkstoffe, Syntheseprodukte) im Durchlicht und Auflicht ist eine der klassischen und bis heute unverzichtbaren mineralogischen Untersuchungsmethoden. Sie ermöglicht es, die festen Substanzen (kristallin, amorph) zerstörungsfrei und mit relativ hoher Ortsauflösung in ihrem Aggregatverband meist sicher zu identifizieren, ihre Zusammensetzungen abzu-schätzenund darüber hinaus aus den Gefügemerkmalen des Materials (Struktur, Textur, Phasenbestand, Phasenbeziehungen, Reaktionstexturen etc.) wichtige Hinweise auf dessen Bildungsgeschichte abzuleiten. Polarisationsmikroskopie ist dadurch den integrierenden Analyseverfahren an Probenpulvern zur Bestimmung des Phasenbestandes (RDA) und der chemischen Zusammensetzung (RFA, AAS) deutlich überlegen. Polarisationsmikroskopie gelangt jedoch an die Grenzen, wenn z.B. die chemische Zusammensetzung komplexer Mischphasen genau bestimmt werden muss oder die Feinkörnigkeit des Materials eine Bestimmung der einzelnen Phasen nicht mehr zulässt. Eine moderne materialwissen-schaftlicheUntersuchung wird daher stets entsprechend der jeweiligen Problemstellung und Materialbeschaffenheit die polarisationsmikroskopische Bearbeitung mit zerstörungsfreier, hoch ortsauflösender Analytik (EMS, REM-EDX, TEM) verbinden. Die polarisationsmikroskopischen Bestimmungsmethoden der durchsichtigen amorphen und kristallinen Phasen (Gläser, Minerale, synthetische Substanzen) und die hierfür notwendigen kristalloptischen Zusammenhänge sind in zahlreichen deutsch-und englischsprachigen Lehrbüchern ausführlich behandelt (siehe Literaturauswahl). Die folgende Einführung in die Mineralbestimmung im Dünnschliff kann daher auf eine breite Darstellung des Stoffes verzichten. Für die praktische Arbeit am Polarisationsmikroskop genügt es, die erforder-lichenSachverhalte in einer prägnanten und auch dem mineralogisch wenig vorgebildeten Mikroskopierenden verständlichen Anleitung zusammenzufassen. Kristalloptische und kristallographische Grundlagen werden nur soweit behandelt, als sie für das Verständnis der beobachteten optischen Phänomene und morphologischen Merkmale notwendig erscheinen. Die polarisationsmikroskopische Bestimmung der Minerale erfolgt anhand ihrer optischen und morphologischen Kennzeichen. Umfangreiche Tabellenwerke stellen die hierfür benötigte Datenbasis für eine außerordentliche Vielzahl von natürlichen Mineralen und synthetischen Phasen bereit (siehe Literaturauswahl). Grundlage dieses Leitfadens bildet das in langjähriger Mikroskopiepraxis bewährte, seit einigen Jahren jedoch vergriffene Clausthaler Heft 14 „Methoden der Dünnschliffmikro-skopie“von G. Müller & M. Raith. Wir haben den Text weitgehend übernommen, das Bildmaterial jedoch graphisch modern überarbeitet, mit weiteren Abbildungen ergänzt sowie die vielfältigen Phänomene mit zahlreichen Mikrofotos veranschaulicht. Wir hoffen, dass dieser Leitfaden dem Studierenden das notwendige Rüstzeug für einen erfolgreichen Einstieg in die Polarisationsmikroskopie bereitstellt. Anregungen und Hinweise zur Darstellung sind jederzeit willkommen!
    Pages: Online-Ressource (IV, 125 Seiten)
    ISBN: 9783000364204
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...