ALBERT

Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.

Note: N.F. entfällt ab 57.2000. - Volltext auch als Teil einer Datenbank verfügbar , Ersch. ab 2000 in engl. Sprache mit dt. Hauptsacht.

Note: Contents 1 High elevation treelines 1.1 The task 1.2 Previous works 2 Definitions and conventions 2.1 The life form ‘tree’ 2.2 Lines and transitions 2.3 Limitation, stress and disturbance 2.4 Altitude-related and other environmental drivers 2.5 Treeline nomenclature 3 Treeline patterns 3.1 Treeline taxa 3.2 The summit syndrome and other treeline depressions 3.3 Mass elevation effect 3.4 Treeline elevation 3.5 Time matters 3.6 Forest structure near treeline 4 Treeline climate 4.1 Specific aspects of treeline climatology 4.2 Criteria to define temperature regimes at treeline 4.3 Treeline temperatures in different bioclimatic regions 4.3.1 Subarctic and boreal zone (45–68° N) 4.3.2 Cool temperate zone (45–47° N, 44° S) 4.3.3 Warm temperate zone (28–42° N, 36° S) 4.3.4 Subtropical zone (19° S, 19° N) 4.3.5 Equatorial tropics (6° N to 3° S) 4.3.6 Mediterranean ‘treelines’ (38–42° N) 4.3.7 The Nothofagus and Metrosideros case 4.3.8 Treeline temperatures across bioclimatic zones 4.4 Seedbed and branch temperatures 4.5 Whole forest temperatures 5 Global mountain statistics based on treeline elevation 5.1 Mountain geostatistics 5.2 Elevational belts 5.3 Global treeline ecotones 6 Structure and stature of treeline trees 6.1 Foliage properties 6.2 Wood properties 6.3 Bark properties 6.4 Root traits 6.5 Tree stature 6.6 Dry matter allocation in treeline trees 7 Growth and development 7.1 Tree growth near the treeline 7.1.1 In situ growth of seedlings 7.1.2 In situ growth of saplings and adult trees 7.2 Xylogenesis at the treeline 7.2.1 In situ cambial activity 7.2.2 Apical growth dynamics 7.3 Root growth 7.4 Phenology at the treeline 8 Evolutionary adjustments to life at the treeline 8.1 Phylogenetic selection 8.2 Genotypic responses of growth and development 8.3 Genotypic responses of physiological traits 9 Reproduction, early life stages and tree demography 9.1 Amount and quality of seeds at high elevation 9.2 Germination, seedling and sapling stage 9.3 Tree demography at the treeline 10 Freezing and other forms of stress 10.1 Stress at the treeline in a fitness context 10.2 Mechanisms and principles of freezing resistance 10.3 Freezing resistance in treeline trees 10.4 Other forms of stress at the treeline 10.4.1 Freeze-thaw cycles and hydraulic failure 10.4.2 Winter desiccation 11 Water, nutrient and carbon relations 11.1 Tree water relations during the growing season 11.2 Nutrient relations 11.3 Carbon relations 12 Treeline formation - currently, in the past and in the future 12.1 Causes of current treelines 12.2 Treelines in the recent past 12.3 Treelines in the distant past (Holocene) 12.4 Treelines in the future References Subject Index Taxonomic Index

Note: Contents Preface and acknowledgments The book website www.cambridge.org/smylie 1 Introduction and theoretical background 1.1 Scalar, vector and tensor analysis 1.2 Separation of vector fields 1.3 Vector spherical harmonics 1.4 Elasticity theory 1.5 Linear algebraic systems 1.6 Interpolation and approximation 2 Time sequence and spectral analysis 2.1 Time domain analysis 2.2 Linear optimum Wiener filters 2.3 Frequency domain analysis 2.4 Fourier series and transforms 2.5 Power spectral density estimation 2.6 Maximum entropy spectral analysis 3 Earth deformations 3.1 Equilibrium equations 3.2 The reciprocal theorem of Betti 3.3 Radial equations: spheroidal and torsional 3.4 Dynamical equations 3.5 Solutions near the geocentre 3.6 Numerical integration of the radial equations 3.7 Fundamental, regular solutions in the inner core 4 Earth's rotation: observations and theory 4.1 Reference frames 4.2 Polar motion and wobble 4.3 The dynamics of polar motion and wobble 4.4 Nutation and motion of the celestial pole 5 Earth's figure and gravitation 5.1 Historical development 5.2 External gravity and figure 5.3 Equilibrium theory of the internal figure 5.4 Gravity coupling 6 Rotating fluids and the outer core 6.1 The inertial wave equation 6.2 Dynamics of the fluid outer core 6.3 Scaling of the core equations 6.4 Compressibility and density stratification 7 The subseisniic equation and boundary conditions 7.1 The subseismic wave equation 7.2 Deformation of the shell and inner core 8 Variational methods and core modes 8.1 A subseismic variational principle 8.2 Representation of the functional 8.3 Finite element support functions 8.4 Boundary conditions and constraints 8.5 Numerical implementation and results 8.6 Rotational splitting and viscosity 8.7 A viscosity profile for the outer core 9 Static deformations and dislocation theory 9.1 The elasticity theory of dislocations 9.2 The theory for realistic Earth models 9.3 Changes in the inertia tensor and the secular polar shift Appendix A Elementary results from vector analysis A.1 Vector identities A.2 Vector calculus identities A.3 Integral theorems Appendix B Properties of Legendre functions B.1 Recurrence relations B.2 Evaluation of Legendre functions Appendix C Numerical Earth models C.1 The Earth models References Fortran index Subject index

Note: Inhalt 1 Einleitung 2 Der erste Eindruck - Das Anmeldegespräch 2.1 Ein Beispiel 2.2 Die Raumsituation 2.3 Die Kommunikationssituation mit Kunden 2.3.1 Gast und Gastgeber 2.3.2 Wir kommunizieren ständig 2.3.3 Wie wirke ich auf andere? 2.3.4 Beziehungs- und Sachaspekt der Kommunikation 2.3.5 Rolleneinnahme und Gesamthaltung der Bibliothek 2.4 Die Gesprächssituation 2.4.1 Augenhöhe und Respekt 2.4.2 Einstellen auf verschiedene Gesprächspartner 2.4.3 Der Gesprächsverlauf 2.4.4 Verständlichkeit und Anschaulichkeit 2.4.5 Schwierige Situationen im Anmeldegespräch 2.5 Vertiefung 3 Professionell beraten - Das Auskunftsgespräch 3.1 Ein Beispiel 3.2 Verantwortung im Gespräch übernehmen - Rollenklarheit 3.3 Reden wir über das Gleiche? 3.4 Durch die Phasen des Gesprächs steuern 3.4.1 Kontakt aufnehmen 3.4.2 Die Ausgangsfrage stellen 3.4.3 Nachfragen 3.4.4 Absichern 3.4.5 Lösungen entwickeln und anbieten 3.4.6 Vereinbarung treffen 3.4.7 Verabschieden 3.5 Die richtigen Fragen stellen 3.6 Störungen in der Auskunftssituation und die Etablierung von Standards 3.7 Tipps im Auskunftsgespräch 3.8 Vertiefung 4 Schulungen und Führungen entwickeln 4.1 Ein Beispiel 4.2 Lerntheoretische Hintergründe 4.2.1 Das Gedächtnis: Wie merken wir uns etwas? 4.2.2 Lerntypen: Wer lernt wie? 4.2.3 Lernpyramide: Mit welchen Lernmethoden lernen wir am effektivsten? 4.2.4 Die Hirnforschung: Wie lernt unser Gehirn am besten? 4.3 Modelle der Didaktik 4.3.1 Instruktionsorientierte Didaktik 4.3.2 Kompetenzorientierte Didaktik 4.4 Die Rolle der Lehrenden 4.5 Auftragsklärung 4.6 Die Konzeptentwicklung in sechs Schritten 4.6.1 Mit der Zielgruppe beschäftigen 4.6.2 Lernziele entwickeln 4.6.3 Themen sammeln und sortieren 4.6.4 Methodik festlegen 4.6.5 Lernkreislauf entwickeln 4.6.6 Dramaturgie und Zeitplan festlegen 4.7 Methodenpool 4.8 Schwierige Situationen in Schulungen 4.9 Wir lernen weiter: Eine Methode für das Schulungsteam 4.10 Vertiefung 5 Schwierige Situationen mit Kunden bewältigen 5.1 Ein Beispiel 5.2 Der Hintergrund 5.2.1 Ebenen der Kommunikation 5.2.2 Vier Reaktionsmöglichkeiten 5.2.3 Der Teufelskreis in der Kommunikation 5.3 Was lässt manche Menschen schwierig werden? 5.3.1 Ein Beispiel 5.3.2 Menschliche Bedürfnisse und Aggressionen 5.3.3 Wie wir den Konflikt betrachten - verschiedene Konfliktebenen 5.4 Das Dilemma der guten Mitarbeiterin 5.5 Die Entschärfung der Situation 5.6 Formulierungstipps - kleines Glossar der hilfreichen Worte 5.7 Kommunikative Basics für schwierige Situationen 5.7.1 So tun als ob 5.7.2 Distanz wahren 5.7.3 Die Flucht nach vornantreten 5.7.4 Verlierer und Schein-Sieger 5.7.5 Eigene Irrtümer vermeiden 5.8 Fallbeispiele 5.8.1 Typologie nach Fritz Riemann 5.8.2 Fünf Fälle und Handlungsmöglichkeiten 5.9 Deeskalationsstrategien - wenn es ganz schwierig wird 5.10 Vertiefung 6 Beschwerdemanagement in Bibliotheken 6.1 Ein Beispiel 6.2 Was ist Beschwerdemanagement? 6.3 Die Komponenten eines Beschwerdemanagement-Systems 6.3.1 Beschwerdestimulierung 6.3.2 Beschwerdekanäle 6.3.3 Beschwerdeannahme 6.3.4 Beschwerdebearbeitung 6.3.5 Beschwerdereaktion 6.3.6 Beschwerdeauswertung 6.3.7 Beschwerdereporting (öffentlich) 6.4 Die Kommunikationssituation der Beschwerde 6.4.1 Worüber beschweren sich Kunden der Bibliothek? 6.4.2 Beschwerdeschreiben verstehen und beantworten 6.4.3 Unzufriedenheit und Schweregrad der Beschwerde 6.4.4 Die Entschärfung der Situation 6.4.5 Ein Gesprächsleitfaden für Beschwerdegespräche 6.4.6 Deeskalieren 6.4.7 Tipps für die Gesprächssituation 6.4.8 Mitarbeiter einbeziehen und schulen 6.5 Vertiefung 7 Kundenorientierung in der Bibliothek 7.1 Ein Beispiel 7.2 Was heißt Kundenorientierung in der Bibliothek? 7.3 Vom Nutzer zum Kunden 7.4 Von der Produkt- zur Kundenorientierung 7.5 Ein Gesamtkonzept zur Einführung von Kundenorientierung 7.6 Eins greift ins andere - Kundenzentrierung und Mitarbeiterorientierung 7.7 Gemeinsame Verhaltensstandards einführen 7.7.1 Was sind Leistungsstandards 7.7.2 Kontaktsituationen mit Kunden und mögliche Verhaltensstandards 7.8 Damit alle an einem Strang ziehen 7.9 Vertiefung 8 Sicher und gewandt auftreten 8.1 Ein Beispiel 8.2 Die eigene Einstellung 8.2.1 Persönliche Denkmuster 8.2.2 Innere Dialoge 8.3 Woran wir arbeiten können - das rhetorische Handwerkszeug 8.4 Sicheres Auftreten braucht Übung 8.5 Erklären und überzeugen 8.6 Anschaulich und lebendig sprechen 8.7 Präsenz zeigen 8.8 Stimmlich überzeugen 8.9 Lampenfieber - die Spannung nutzen 8.10 Vertiefung Literatur und Internet-Links Sachregister Über die Autorin

Note: CONTENTS Preface Photo Credits Computer Codes 1 Introduction 1-1 Why Microwaves for Remote Sensing? 1-2 A Brief Overview of Microwave Sensors 1-3 A Short History of Microwave Remote Sensing 1-3.1 Radar 1-3.2 Radiometers 1-4 The Electromagnetic Spectrum 1-5 Basic Operation and Applications of Radar 1-5.1 Operation of Remote-Sensing Radars 1-5.2 Applications of Remote-Sensing Radars 1-6 Basic Operation and Applications of Radiometers 1-6.1 Radiometer Operation 1-6.2 Applications of Microwave Radiometry 1-7 Image Examples 2 Electromagnetic Wave Propagation 2-1 EM Plane Waves 2-1.1 Constitutive Parameters 2-1.2 Maxwell's Equations 2-1.3 Complex Permittivity 2-1.4 Wave Equations 2-2 Plane-Wave Propagation in Lossless Media 2-2.1 Uniform Plane Waves 2-2.2 General Relation between E and H 2-3 Wave Polarization in a Lossless Medium 2-3.1 Linear Polarization 2-3.2 Circular Polarization 2-3.3 Elliptical Polarization 2-4 Plane Wave Propagation in Lossy Media 2-4.1 Low Loss Dielectric 2-4.2 Good Conductor 2-5 Electromagnetic Power Density 2-5.1 Plane Wave in a Lossless Medium 2-5.2 Plane Wave in a Lossy Medium 2-5.3 Decibel Scale tor Power Ratios 2-6 Wave Reflection and Transmission at Normal Incidence 2-6.1 Boundary between Lossless Media 2-6.2 Boundary between Lossy Media 2-7 Wave Reflection and Transmission at Oblique Incidence 2-7.1 Horizontal Polarization—Lossless Media 2-7.2 Vertical Polarization 2-8 Reflectivity and Transmissivity 2-9 Oblique Incidence onto a Lossy Medium 2- 10 Oblique Incidence onto a Two-Layer Composite 2-10.1 Input Parameters 2-10.2 Propagation Matrix Method 2-10.3 Multiple Reflection Method 3 Remote-Sensing Antennas 3-1 The Hertzian Dipole 3-2 Antenna Radiation Characteristics 3-2.1 Antenna Pattern 3-2.2 Beam Dimensions 3-2.3 Antenna Directivity 3-2.4 Antenna Gain 3-2.5 Radiation Efficiency 3-2.6 Effective Area of a Receiving Antenna 3-3 Friis Transmission Formula 3-4 Radiation by Large-Aperture Antennas 3-5 Rectangular Aperture with Uniform Field Distribution 3-5.1 Antenna Pattern in x-y Plane 3-5.2 Beamwidth 3-5.3 Directivity and Effective Area 3-6 Circular Aperture with Uniform Field Illumination 3-7 Nonuniform-Amplitude Illumination 3-8 Beam Efficiency 3-9 Antenna Arrays 3-10 N-Element Array with Uniform Phase Distribution 3-10.1 Uniform Amplitude Distribution 3-10.2 Grating Lobes 3-10.3 Binomial Distribution 3-11 Electronic Scanning of Arrays 3-12 Antenna Types 3-12.1 Horn Antennas 3-12.2 Slot Antennas 3-12.3 Microstrip Antennas 3-13 Active Antennas 3-13.1 Advantages of Active Antennas 3-13.2 Digital Beamforming with Active Antennas 4 Microwave Dielectric Properties of Natural Earth Materials 4-1 Pure-Water Single-Debye Dielectric Model (f 〈 50 GHz) 4-2 Saline-Water Double-Debye Dielectric Model (f〈 1000 GHz) 4-3 Dielectric Constant of Pure Ice 4-4 Dielectric Mixing Models for Heterogeneous Materials 4-4.1 Randomly Oriented Ellipsoidal Inclusions 4-4.2 Polder-van Santen/de Loor Formulas 4-4.3 Tinga-Voss-Blossey (TVB) Formulas 4-4.4 Other Dielectric Mixing Formulas 4-5 Sea Ice 4-5.1 Dielectric Constant of Brine 4-5.2 Brine Volume Fraction 4-5.3 Dielectric Properties 4-6 Dielectric Constant of Snow 4-6.1 Dry Snow 4-6.2 Wet Snow 4-7 Dielectric Constant of Dry Rocks 4-7.1 Powdered Rocks 4-7.2 Solid Rocks 4-8 Dielectric Constant of Soils 4-8.1 Dry Soil 4-8.2 Wet Soil 4-8.3 εsoil in 0.3-1.5 GHz Band 4-9 Dielectric Constant of Vegetation 4-9.1 Dielectric Constant of Canopy Constituents 4-9.2 Dielectric Model 5 Radar Scattering 5-1 Wave Polarization in a Spherical Coordinate System 5-2 Scattering Coordinate Systems 5-2.1 Forward Scattering Alignment (FSA) Convention 5-2.2 Backscatter Alignment (BSA) Convention 5-3 Scattering Matrix 5-3.1 FSA Convention 5-3.2 BSA Convention 5-3.3 Stokes Parameters and Mueller Matrix 5-4 Radar Equation 5-5 Scattering from Distributed Targets 5-5.1 Narrow-Beam Scatterometer 5-5.2 Imaging Radar 5-5.3 Specific Intensities for Distributed Target 5-6 RCS Statistics 5-7 Rayleigh Fading Model 5-7.1 Underlying Assumptions 5-7.2 Linear Detection 5-7.3 Square-Law Detection 5-7.4 Interpretation 5-8 Multiple Independent Samples 5-8.1 N-Look Amplitude Image 5-8.2 N-Look Intensity Image 5-8.3 N-Look Square-Root Intensity Image 5-8.4 Spatial Resolution vs. Radiometric Resolution 5-8.5 Applicability of the Rayleigh Fading Model 5-9 Image Texture and Despeckle Filtering . 5-9.1 Image Texture 5-9.2 Despeckling Filters 5-10 Coherent and Noncoherent Scattering 5-10.1 Surface Roughness 5-10.2 Bistatic Scattering 5-10.3 Specular Reflectivity 5-10.4 Bistatic-Scattering Coefficient 5-10.5 Backscattering Response of a Smooth Surface 5-11 Polarization Synthesis 5-11.1 RCS Polarization Response 5-11.2 Distributed Targets 5-11.3 Mueller Matrix Approach 5-12 Polarimetric Scattering Statistics 5-13 Polarimetric Analysis Tools 5-13.1 Scattering Covariance Matrix 5-13.2 Eigenvector Decomposition 5-13.3 Useful Polarimetric Parameters 5-13.4 Image Examples 5-13.5 Freeman-Durden Decomposition 6 Microwave Radiometry and Radiative Transfer 6-1 Radiometric Quantities 6-2 Thermal Radiation 6-2.1 Quantum Theory of Radiation 6-2.2 Planck's Blackbody Radiation Law 6-2.3 The Rayleigh-Jeans Law 6-3 Power-Temperature Correspondence 6-4 Radiation by Natural Materials 6-4.1 Brightness Temperature 6-4.2 Brightness Temperature Distribution 6-4.3 Antenna Temperature 6-5 Antenna Efficiency Considerations 6-5.1 Beam Efficiency 6-5.2 Radiation Efficiency 6-5.3 Radiometer Measurement Ambiguity 6-6 Theory of Radiative Transfer 6-6.1 Equation of Radiative Transfer 6-6.2 Brightness-Temperature Equation 6-6.3 Brightness Temperature of a Stratified Medium 6-6.4 Brightness Temperature of a Scatter-Free Medium 6-6.5 Upwelling and Downwelling Atmospheric Brightness Temperatures 6-7 Terrain Brightness Temperature 6-7.1 Brightness Transmission Across a Specular Boundary 6-7.2 Emission by a Specular Surface 6-7.3 Emissivity of a Rough Surface 6-7.4 Extreme Surface Conditions 6-7.5 Emissivity of a Two-Layer Composite 6-8 Downward-Looking Satellite Radiometer 6-9 Polarimetric Radiometry 6-10 Stokes Parameters and Periodic Structures 7 Microwave Radiometric Systems 7-1 Equivalent Noise Temperature 7-2 Characterization of Noise 7-2.1 Noise Figure 7-2.2 Equivalent Input Noise Temperature 7-2.3 Noise Temperature of a Cascaded System 7-2.4 Noise Temperature of a Lossy Two-Port Device 7-3 Receiver and System Noise Temperatures 7-3.1 Receiver Alone 7-3.2 Total System Including Antenna 7-4 Radiometer Operation 7-4.1 Measurement Accuracy 7-4.2 Total-Power Radiometer 7-4.3 Radiometric Resolution 7-5 Effects of Receiver Gain Variations 7-6 Dicke Radiometer 7-7 Balancing Techniques 7-7.1 Reference-Channel Control Method 7-7.2 Antenna-Channel Noise-Injection Method 7-7.3 Pulsed Noise-Injection Method 7-7.4 Gain-Modulation Method 7-8 Automatic-Gain-Control (AGC) Techniques 7-9 Noise-Adding Radiometer 7-10 Summary of Radiometer Properties 7-11 Radiometer Calibration Techniques 7-11.1 Receiver Calibration 7-11.2 Calibration Sources 7-11.3 Effects of Impedance Mismatches 7-11.4 Antenna Calibration 7-11.5 Cryoload Technique 7-11.6 Bucket Technique 7-12 Imaging Considerations 7-12.1 Scanning Configurations 7-12.2 Radiometer Uncertainty Principle 7-13 Interferometric Aperture Synthesis 7-13.1 Image Reconstruction 7-13.2 MIR Radiometric Sensitivity 7-14 Polarimetric Radiometer 7-14.1 Coherent Detection 7-14.2 Incoherent Detection 7-15 Calibration of Polarimetric Radiometers 7-15.1 Forward Model for a Fully Polarimetric Radiometer 7-15.2 Forward Model for the Polarimetric Calibration Source 7-15.3 Calibration by Inversion of the Forward Models 7-16 Digital Radiometers 8 Microwave Interaction with Atmospheric Constituents 8-1 Standard Atmosphere 8-1.1 Atmospheric Composition 8-1.2 Temperature Profile 8-1.3 Density Profile 8-1.4 Pressure Profi

Note: Dissertation

Note: Vorwort 1. Rationalität in Politik und Wirtschaft 2. Worum geht es in der Rational–Choice–Theorie? 3. Methodologische Defekte 4. Das Paradox der Wahlbeteiligung 5. Soziale Dilemmata und das Trittbrettfahrerproblem 6. Gesetzgebung und Abstimmungsparadox 7. Räumliche Theorien des politischen Wettbewerbs 8. Erwiderungen auf mögliche Gegenargumente Literatur Index

Note: IntroductionTheorising Norms -- Theorising Crime -- Agent-based Modelling -- The Environment and Social Norms -- Punishment and Social Norms -- Imitation and Social Norms -- Socially Situated Social Norms -- Internalisation and Social Norms -- Modelling Norms -- Delinquent Networks -- Social Construction of Knowledge -- Morality -- We-Intentionality -- Conclusion -- Index..

Note: Table of Contents Introduction: Thermokarst Lakes of Western Siberia as Dominant Forms of Landscape and Regulators of Greenhouse Gas Exchange with the Atmosphere Chapter 1. Thermokarst Lakes: Distribution, Cycle of Development, Surface Coverage and Evolution Chapter 2. Sources of Dissolved Components in Thermokarst Lakes Chapter 3. Temperature and Gas Regime Chapter 4. Dissolved Organic Carbon Chapter 5. Microbiology of Thermokarst Lake Systems Chapter 6. Trace Elements in Thermokarst Lakes Chapter 7. Colloids in Thermokarst Lakes Chapter 8. Latitude Profile Gradients of Lakes: Substituting Space for Time Chapter 9. Possible Impact of Climate Warming on Stocks and Fluxes of Carbon and Related Elements in Western Siberian Lakes Conclusions: Thaw Lakes as Indicators of Climate Change References Index

Note: Contents Foreword Preface Contributors I Introduction 1 The Development of Climate Research / by ANTONIO NAVARRA 1.1 The Nature of Climate Studies 1.1.1 The Big Storm Controversy 1.1.2 The Great Planetary Oscillations 1.2 The Components of Climate Research 1.2.1 Dynamical Theory 1.2.2 Numerical Experimentation 1.2.3 Statistical Analysis 2 Misuses of Statistical Analysis in Climate Research / by HANS VON STORCH 2.1 Prologue 2.2 Mandatory Testing and the Mexican Hat 2.3 Neglecting Serial Correlation 2.4 Misleading Names: The Case of the Decorrelation Time 2.5 Use of Advanced Techniques 2.6 Epilogue II Analyzing The Observed Climate 3 Climate Spectra and Stochastic Climate Models / by CLAUDE FRANKIGNOUL 3.1 Introduction 3.2 Spectral Characteristics of Atmospheric Variables 3.3 Stochastic Climate Model 3.4 Sea Surface Temperature Anomalies 3.5 Variability of Other Surface Variables 3.6 Variability in the Ocean Interior 3.7 Long Term Climate Changes 4 The Instrumental Data Record: Its Accuracy and Use in Attempts to Identify the "CO2 Signal" / by PHIL JONES 4.1 Introduction 4.2 Homogeneity 4.2.1 Changes in Instrumentation, Exposure and Measuring Techniques 4.2.2 Changes in Station Locations 4.2.3 Changes in Observation Time and the Methods Used to Calculate Monthly Averages 4.2.4 Changes in the Station Environment 4.2.5 Precipitation and Pressure Homogeneity 4.2.6 Data Homogenization Techniques 4.3 Surface Climate Analysis 4.3.1 Temperature 4.3.2 Precipitation 4.3.3 Pressure 4.4 The Greenhouse Detection Problem 4.4.1 Definition of Detection Vector and Data Used 4.4.2 Spatial Correlation Methods 4.5 Conclusions 5 Interpreting High-Resolution Proxy Climate Data - The Example of Dendr о climatology / by KEITH R. BRIFFA 5.1 Introduction 5.2 Background 5.3 Site Selection and Dating 5.4 Chronology Confidence 5.4.1 Chronology Signal 5.4.2 Expressed Population Signal 5.4.3 Subsample Signal Strength 5.4.4 Wider Relevance of Chronology Signal 5.5 "Standardization" and Its Implications for Judging Theoretical Signal 5.5.1 Theoretical Chronology Signal 5.5.2 Standardization of "Raw" Data Measurements 5.5.3 General Relevance of the "Standardization" Problem 5.6 Quantifying Climate Signals in Chronologies 5.6.1 Calibration of Theoretical Signal 5.6.2 Verification of Calibrated Relationships 5.7 Discussion 5.8 Conclusions 6 Analysing the Boreal Summer Relationship Between World wide Sea-Surface Temperature and Atmospheric Variability / by M. NEIL WARD 6.1 Introduction 6.2 Physical Basis for Sea-Surface Temperature Forcing of the Atmosphere 6.2.1 Tropics 6.2.2 Extratropics 6.3 Characteristic Patterns of Global Sea Surface Temperature: EOFs and Rotated EOFs 6.3.1 Introduction 6.3.2 SST Data 6.3.3 EOF method 6.3.4 EOFs p^→1 - p^→3 6.3.5 Rotation of EOFs 6.4 Characteristic Features in the Marine Atmosphere Associated with the SST Patterns p^→2, p ^→3 and p^→2R in JAS 6.4.1 Data and Methods 6.4.2 Patterns in the Marine Atmosphere Associated with EOF p^→2 6.4.3 Patterns in the Marine Atmosphere Associated with EOF p^→3 6.4.4 Patterns in the Marine Atmosphere Associated with Rotated EOF p^→2R 6.5 JAS Sahel Rainfall Links with Sea-Surface Temperature and Marine Atmosphere 6.5.1 Introduction 6.5.2 Rainfall in the Sahel of Africa 6.5.3 High Frequency Sahel Rainfall Variations 6.5.4 Low Frequency Sahel Rainfall Variations 6.6 Conclusions III Simulating and Predicting Climate 7 The Simulation of Weather Types in GCMs : A Regional Approach to Control-Run Validation / by KEITH R. BRIFFA 7.1 Introduction 7.2 The Lamb Catalogue 7.3 An "Objective" Lamb Classification 7.4 Details of the Selected GCM Experiments 7.5 Comparing Observed and GCM Climates 7.5.1 Lamb Types 7.5.2 Temperature and Precipitation 7.5.3 Relationships Between Circulation Frequencies and Temperature and Precipitation 7.5.4 Weather-Type Spell Lengths and Storm Frequencies 7.6 Conclusions 7.6.1 Specific Conclusions 7.6.2 General Conclusions 8 Statistical Analysis of GCM Output / by CLAUDE FRANKIGNOUL 8.1 Introduction 8.2 Univariate Analysis 8.2.1 The i-Test on the Mean of a Normal Variable 8.2.2 Tests for Autocorrelated Variables 8.2.3 Field Significance 8.2.4 Example: GCM Response to a Sea Surface Temperature Anomaly 8.3 Multivariate Analysis 8.3.1 Test on Means of Multidimensional Normal Variables 8.3.2 Application to Response Studies 8.3.3 Application to Model Testing and Intercomparison 9 Field Intercomparison / by ROBERT E . LIVEZEY 9.1 Introduction 9.2 Motivation for Permutation and Monte Carlo Testing 9.2.1 Local vs. Field Significance 9.2.2 Test Example 9.3 Permutation Procedures 9.3.1 Test Environment 9.3.2 Permutation (PP) and Bootstrap (BP) Procedures 9.3.3 Properties 9.3.4 Interdependence Among Field Variables 9.4 Serial Correlation 9.4.1 Local Probability Matching 9.4.2 Times Series and Monte Carlo Methods 9.4.3 Independent Samples 9.4.4 Conservatism 9.5 Concluding Remarks 10 The Evaluation of Forecasts / by ROBERT E. LIVEZEY 10.1 Introduction 10.2 Considerations for Objective Verification 10.2.1 Quantification 10.2.2 Authentication 10.2.3 Description of Probability Distributions 10.2.4 Comparison of Forecasts 10.3 Measures and Relationships: Categorical Forecasts 10.3.1 Contingency and Definitions 10.3.2 Some Scores Based on the Contingency Table 10.4 Measures and Relationships: Continuous Forecasts 10.4.1 Mean Squared Error and Correlation 10.4.2 Pattern Verification (the Murphy-Epstein Decomposition) 10.5 Hindcasts and Cross-Validation 10.5.1 Cross-Validation Procedure 10.5.2 Key Constraints in Cross-Validation 11 Stochastic Modeling of Precipitation with Applications to Climate Model Downscaling / by DENNIS LETTENMAIER 11.1 Introduction 11.2 Probabilistic Characteristics of Precipitation 11.3 Stochastic Models of Precipitation 11.3.1 Background 11.3.2 Applications to Global Change 11.4 Stochastic Precipitation Models with External Forcing 11.4.1 Weather Classification Schemes 11.4.2 Conditional Stochastic Precipitation Models 11.5 Applications to Alternative Climate Simulation 11.6 Conclusions IV Pattern Analysis 12 Teleconnections Patterns / by ANTONIO NAVARRA 12.1 Objective Teleconnections 12.2 Singular Value Decomposition 12.3 Teleconnections in the Ocean-Atmosphere System 12.4 Concluding Remarks 13 Spatial Patterns: EOFs and CCA / by HANS VON STORCH 13.1 Introduction 13.2 Expansion into a Few Guess Patterns 13.2.1 Guess Patterns, Expansion Coefficients and Explained Variance 13.2.2 Example: Temperature Distribution in the Mediterranean Sea 13.2.3 Specification of Guess Patterns 13.2.4 Rotation of Guess Patterns 13.3 Empirical Orthogonal Functions 13.3.1 Definition of EOFs 13.3.2 What EOFs Are Not Designed for 13.3.3 Estimating EOFs 13.3.4 Example: Central European Temperature 13.4 Canonical Correlation Analysis 13.4.1 Definition of Canonical Correlation Patterns 13.4.2 CCA in EOF Coordinates 13.4.3 Estimation: CCA of Finite Samples 13.4.4 Example: Central European Temperature 14 Patterns in Time : SSA and MSSA / by ROBERT VAUTARD 14.1 Introduction 14.2 Reconstruction and Approximation of Attractors 14.2.1 The Embedding Problem 14.2.2 Dimension and Noise 14.2.3 The Macroscopic Approximation 14.3 Singular Spectrum Analysis 14.3.1 Time EOFs 14.3.2 Space-Time EOFs 14.3.3 Oscillatory Pairs 14.3.4 Spectral Properties 14.3.5 Choice of the Embedding Dimension 14.3.6 Estimating Time and Space-Time Patterns 14.4 Climatic Applications of SSA 14.4.1 The Analysis of Intraseasonal Oscillations 14.4.2 Empirical Long-Range Forecasts Using MSSA Predictors 14.5 Conclusions 15 Multivariate Statistical Modeling : POP-Model as a First Order Approximation / by JIN-SONG VON STORCH 15.1 Introduction 15.2 The Cross-Covariance Matrix and the Cross-Spectrum Matrix 15.3 Multivariate AR(1) Process and its Cross-Covariance and Cross-Spectrum Matrices 15.3.1 The System Matrix A and its POPs 15.3.2 Cross-Spectrum Matrix in POP-Basis: Its Matrix Formulation 15.3.3 Cross-Spectrum Matrix in POP-Basis: Its Diagonal Components

Note: Contents Contents Preface Acknowledgements Part 1: Making Sediment Introduction Clastic sediment as a chemical and physical breakdown product 1.1 Introduction: clastic sediments—'accidents' of weathering 1.2 Silicate minerals and chemical weathering 1.3 Solute flux: rates and mechanisms of silicate chemical weathering 1.4 Physical weathering 1.5 Soils as valves and filters for the natural landscape 1.6 Links between soil age, chemical weathering and weathered-rock removal 1.7 Provenance: siliciclastic sediment-sourcing Further reading 2 Carbonate, siliceous, iron-rich and evaporite sediments 2.1 Marine vs. freshwater chemical composition and fluxes 2.2 The calcium carbonate system in the oceans 2.3 Ooid carbonate grains 2.4 Carbonate grains from marine plants and animals 2.5 Carbonate muds, oozes and chalks 2.6 Other carbonate grains of biological origins 2.7 Organic productivity, sea-level and atmospheric controls of biogenic CaCO3 deposition rates 2.8 CaCO3 dissolution in the deep ocean and the oceanic CaCO3 compensation mechanism 2.9 The carbonate system on land 2.10 Evaporite salts and their inorganic precipitation as sediment 2.11 Silica and pelagic plankton 2.12 Iron minerals and biomineralizers 2.13 Desert varnish 2.14 Phosphates 2.15 Primary microbial-induced sediments: algal mats and stromatolites Further reading 3 Sediment grain properties 3.1 General 3.2 Grain size 3.3 Grain-size distributions 3.4 Grain shape and form 3.5 Bulk properties of grain aggregates Further reading Part 2: Moving Fluid Introduction 4 Fluid basics 4.1 Material properties of fluids 4.2 Fluid kinematics 4.3 Fluid continuity with constant density 4.4 Fluid dynamics 4.5 Energy, mechanical work and power Further reading 5 Types of fluid motion 5.1 Osborne Reynolds and flow types 5.2 The distribution of velocity in viscous flows: the boundary layer 5.3 Turbulent flows 5.4 The structure of turbulent shear flows 5.5 Shear flow instabilities, flow separation and secondary currents 5.6 Subcritical and supercritical flows: the Froude number and hydraulic jumps 5.7 Stratified flow generally 5.8 Water waves 5.9 Tidal flow—long-period waves Further reading Part 3: Transporting Sediment Introduction 6 Sediment in fluid and fluid flow—general 6.1 Fall of grains through stationary fluids 6.2 Natural flows carrying particulate material are complex 6.3 Fluids as transporting machines 6.4 Initiation of grain motion 6.5 Paths of grain motion 6.6 Categories of transported sediment 6.7 Some contrasts between wind and water flows 6.8 Cohesive sediment transport and erosion 6.9 A warning: nonequilibrium effects dominate natural sediment transport systems 6.10 Steady state, deposition or erosion: the sediment continuity equation and competence vs. capacity Further reading 7 Bedforms and sedimentary structures in flows and under waves 7.1 Trinity of interaction: turbulent flow, sediment transport and bedform development 7.2 Water-flow bedforms 7.3 Bedform phase diagrams for water flows 7.4 Water flow erosional bedforms on cohesive beds 7.5 Water wave bedforms 7.6 Combined flows: wave-current ripples and hummocky cross-stratification 7.7 Bedforms and structures formed by atmospheric flows Further reading 8 Sediment gravity flows and their deposits 8.1 Introduction 8.2 Granular flows 8.3 Debris flows 8.4 Turbidity flows 8.5 Turbidite evidence for downslope transformation from turbidity to debris flows Further reading 9 Liquefaction, fluidization and sliding sediment deformation 9.1 Liquefaction 9.2 Sedimentary structures formed by and during liquefaction 9.3 Submarine landslides, growth faults and slumps 9.4 Desiccation and synaeresis shrinkage structures Further reading Part 4: Major External Controls on Sedimentation and Sedimentary Environments Introduction 10 Major external controls on sedimentation 10.1 Climate 10.2 Global climates: a summary 10.3 Sea-level changes 10.4 Tectonics 10.5 Sediment yield, denudation rate and the sedimentary record Further reading Part 5: Continental Sedimentary Environments Introduction 11 Rivers 11.1 Introduction 11.2 River networks, hydrographs,patterns and long profiles 11.3 Channel form 11.4 Channel sediment transport processes, bedforms and internal structures 11.5 The floodplain 11.6 Channel belts, alluvial ridges and avulsion 11.7 River channel changes, adjustable variables and equilibrium 11.8 Alluvial architecture: product of complex responses 11.9 Alluvial architecture: scale, controls and time Further reading 12 Subaerial Fans: Alluvial and Colluvial 12.1 Introduction 12.2 Controls on the size (area) and gradient of fans 12.3 Physical processes on alluvial fans 12.4 Debris-flow-dominated alluvial fans 12.5 Stream-flow-dominated alluvial fans 12.6 Recognition of ancient alluvial fans and talus cones Further reading 13 Aeolian Sediments in Low-Latitude Deserts 13.1 Introduction 13.2 Aeolian system state 13.3 Physical processes and erg formation 13.4 Erg margins and interbedform areas 13.5 Erg and draa evolution and sedimentary architecture 13.6 Erg construction, stasis and destruction: climate and sea-level controls 13.7 Ancient desert facies Further reading 14 Lakes 14.1 Introduction 14.2 Lake stratification 14.3 Clastic input by rivers and the effect of turbidity currents 14.4 Wind-forced physical processes 14.5 Temperate lake chemical processes and cycles 14.6 Saline lake chemical processes and cycles 14.7 Biological processes and cycles 14.8 Modern temperate lakes and their sedimentary facies 14.9 Lakes in the East African rifts 14.10 Lake Baikal 14.11 The succession of facies as lakes evolve 14.12 Ancient lake facies Further reading 15 Ice 15.1 Introduction 15.2 Physical processes of ice flow 15.3 Glacier flow, basal lubrication and surges 15.4 Sediment transport, erosion and deposition by flowing ice 15.5 Glacigenic sediment: nomenclature and classification 15.6 Quaternary and modern glacial environments and facies 15.7 Ice-produced glacigenic erosion and depositional facies on land and in the periglacial realm 15.8 Glaciofluvial processes on land at and within the ice-front 15.9 Glacimarine environments 15.10 Glacilacustrine environments 15.11 Glacial facies in the pre-Quaternary geological record: case of Cenozoic Antarctica Further reading Part 6: Marine Sedimentary Environments Introduction 16. Estuaries 16.1 Introduction 16.2 Estuarine dynamics 16.3 Modern estuarine morphology and sedimentary environments 16.4 Estuaries and sequence stratigraphy Further reading 17. River and Fan Deltas 17.1 Introduction to river deltas 17.2 Basic physical processes and sedimentation at the river delta front 17.3 Mass movements and slope failure on the subaqueous delta 17.4 Organic deposition in river deltas 17.5 River delta case histories 17.6 River deltas and sea-level change 17.7 Ancient river delta deposits 17.8 Fan deltas Further reading 18. Linear Siliciclastic Shorelines 18.1 Introduction 18.2 Beach processes and sedimentation 18.3 Barrier-inlet-spit systems and their deposits 18.4 Tidal flats, salt marsh and chenier ridges 18.5 Ancient clastic shoreline facies Further reading 19 Siliciclastic Shelves 19.1 Introduction: shelf sinks and lowstand bypass 19.2 Shelf water dynamics 19.3 Holocene highstand shelf sediments: general 19.4 Tide-dominated, low river input, highstand shelves 19.5 Tide-dominated, high river input, highstand shelves 19.6 Weather-dominated highstand shelves Further reading 20 Calcium-carbonate-evaporite Shorelines, Shelves and Basins 20.1 Introduction: calcium carbonate 'nurseries' and their consequences 20.2 Arid carbonate tidal flats, lagoons and evaporite sabkhas 20.3 Humid carbonate tidal flats and marshes 20.4 Lagoons and bays 20.5 Tidal delta and margin-spillover carbonate tidal sands 20.6 Open-shelf carbonate ramps 20.7 Platform margin reefs and carbonate build-ups 20.8 Platform margin slopes and basins 20.9 Carbonate sediments, cycles and sea-level change 20.10 Displacement and destruction of carbonate environments: silicicl

Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.

Note: Cover; Title Page; Copyright Page; Dedication Page; Table of Contents; Acknowledgments; Part One: Prehistory; 1. Introduction; 2. Sex and Salesmanship; 3. Seduction and the Emotions; 4. Social Primates; Part Two: Today; 5. Testing for Talent; 6. What Do Women Want?; 7. Coalitions of the Willing; 8. The Scarcity of Charm; 9. The Tender War; Notes; References; Index.

Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; PART I. THE COMPLEXITY FRAME FOR POLICY; Chapter 1. Twin Peaks; Chapter 2. Government With, Not Versus, the Market; Chapter 3. I Pencil Revisited: Beyond Market Fundamentalism; Chapter 4. The Complexity Policy Frame; PART II. EXPLORING THE FOUNDATIONS; Chapter 5. How Economics Lost the Complexity Vision; Chapter 6. How Macroeconomics Lost the Complexity Vision; Chapter 7. Complexity: A New Kind of Science?; Chapter 8: A New Kind of Complexity Economics?; Chapter 9. Nudging toward a Complexity Policy Frame. , PART III. LAISSEZ-FAIRE ACTIVISM IN PRACTICEChapter 10. The Economics of Influence; Chapter 11. Implementing Influence Policy; Chapter 12. Laissez-Faire Activism; Chapter 13. Getting the Ecostructure of Government Right; PART IV. THE LOST AGENDA; Chapter 14. Getting the Ecostructure of Social Science Education Right; Chapter 15. The Lost Agenda; Notes; Bibliography; Index.

Note: Front cover; Title page; Copyright page; Contents; Dedication; Friends of the Earth: rethinking travel; Foreword; Preface; Introduction; PART 1: THINKING BEYOND FLYING; Chapter 1: To fly or not to fly?; Chapter 2: Deciding never to fly again; Chapter 3: Young people and climate change; Chapter 4: Waking up to the downsides of flying; Chapter 5: Slow and low - the way to go: a systems view of travel emissions; PART 2: BUSINESS BEYOND FLYING; Chapter 6: A green travel experiment; Chapter 7: Trains versus planes: building a low-carbon travel agency. , Chapter 8: Going cold turkey: a law practice without any flightsChapter 9: The no-flying conference: Signs of Change; Chapter 10: Slowlier than thou: why flight-free travel is about better, not less; PART 3: SAVOURING THE JOURNEY; Chapter 11: The human engine: bicycling to Beijing; Chapter 12: Walking distance; Chapter 13: bike2oz: the world going through you instead of around you; Chapter 14: A small matter of distance: trying not to fly to climate talks; Chapter 15: Travel on a hot planet: exploring the global tourist industry overland; How to fly less; Index; Other Green Books titles. , About Green Books.

Note: Cover; Copyright; Praise; Introduction; Contents; Section 1: THINK IT; The First Thing to Do When You Find Yourself in a Hole: Stop Digging; Stay Positive; Never Lose Faith; Seven Career Lessons I Learned from Selling Ginsu Knives; A Turning Point; Stop. Breathe. Think. Then Act.; Overcoming Inertia; Overcoming Fear; Keep Swimming; Section 2: DO IT; What Is a Resume?; What Are Managers Looking For?; Dirty Little Resume Secrets; The T-Bomb; Current Experience; What You Do Is More Important than What You're Called; The Top Ten Mistakes Professionals Make When Looking for Work. , Resumes: A SummaryCover Your Letter; Following Up; Getting Interviews; Be Proactive; Be Visible; Social Networking; Four Critical Steps to Getting a Job Offer; Send Out Ships; Gold Calling; Section 3: HAVE IT; Creating the Path; Recession-Proof Your Career; Creating a PR Campaign; Taking the Initiative; Increase Your Ability to Find Work; Advancing Your Career through Personal Branding; Advancing Your Career through Progressive Information Disclosure; Honing Your Workplace Negotiation Skills; The Sky's the Limit; What Are You Waiting For?; About Making Money; Creating the Life You Want. , Recommended ReadingAbout the Author.

Note: Pages 1-6, Introduction, Etsuro Shimokawa --- Pages 7-26, Prediction of debris flow for warning and evacuation, Muneo Hirano --- Pages 27-45, Large and small debris flows—Occurrence and behaviour, Tim R. Davies --- Pages 46-63, Field survey for debris flow in volcanic area, Etsuro Shimokawa, Takashi Jitousono --- Pages 65-69, Introduction, Pierre Julien --- Pages 70-92, A comparison between gravity flows of dry sand and sand-water mixtures, Haruyuki Hashimoto --- Pages 93-116, Review dynamic modeling of debris flows, Chyan-Deng Jan, Hsieh Wen Shen --- Pages 117-143, Dynamics of the inertial and viscous debris flows, Tamotsu Takahashi --- Pages 144-162, Selected notes on debris flow dynamics, P. Y. Julien, J. S. O'Brien --- Pages 163-165, Introduction, Aronne Armanini --- Pages 166-185, Development of new methods for countermeasures against debris flows, Shun Okubo, Hiroshi Ikeya, Yoshiharu Ishikawa, Takashi Yamada --- Pages 186-207, Torrent check dams as a control measure for debris flows, Martin N. R. Jaeggi, Stefano Pellandini --- Pages 208-226, On the dynamic impact of debris flows, Aronne Armanini

Note: Cover; Half title; Title; Copyright; Contents; Contributors; Preface; 1 Introduction; 2 Intraplate earthquakes in Australia; 2.1 Introduction; 2.2 Two centuries of earthquake observations in Australia; 2.2.1 Mechanism, geographic distribution, and strain rate; 2.2.2 Seismogenic depth; 2.2.3 Attenuation and scaling relations; 2.3 A long-term landscape record of large (morphogenic) earthquakes; 2.3.1 Variation in fault scarp length and vertical displacement; 2.3.2 The influence of crustal type and character on seismic activity rates; 2.4 Patterns in earthquake occurrence. , 2.5 Maximum magnitude earthquake2.5.1 Scarp length as a proxy for paleo-earthquake magnitude; 2.6 Implications for SCR analogue studies: factors important in earthquake localisation; 2.6.1 Mechanical and thermal influences; 2.6.2 Structural architectural influences; 2.7 Conclusions; Acknowledgements; 3 Intraplate seismicity in Brazil; 3.1 Introduction; 3.2 Earthquake catalogue; 3.3 Seismicity map; 3.4 Seismotectonic correlations; 3.4.1 Lower seismicity in Precambrian cratonic provinces; 3.4.2 Intraplate seismicity and cratonic roots; 3.4.3 Passive margin seismicity. , 3.4.4 Influence of neotectonic faults3.4.5 Flexural stresses; 3.5 Discussion and conclusions; Acknowledgments; 4 Earthquakes and geological structures of the St. Lawrence Rift System; 4.1 Introduction; 4.2 Historical earthquakes and their impact; 4.3 Seismic zones of the SLRS; 4.3.1 Charlevoix; 4.3.2 Lower St. Lawrence; 4.3.3 Western Quebec; 4.3.4 Background seismicity; 4.4 The St. Lawrence Rift System; 4.5 The rift hypothesis and the SLRS: discussion and conclusions; Acknowledgments; 5 Intraplate earthquakes in North China; 5.1 Introduction; 5.2 Tectonic background; 5.2.1 Geological history. , 5.2.2 Lithospheric structure5.2.3 Major seismogenic faults; 5.3 Active tectonics and crustal kinematics; 5.4 Strain rates and seismicity; 5.5 Seismicity; 5.5.1 Paleoseismicity; 5.5.2 Large historic events; 1303 Hongdong earthquake (M 8.0); 1556 Huaxian earthquake (M 8.3); 1668 Tancheng earthquake (M 8.5); 1679 Sanhe earthquake (M 8.0); 1695 Linfen earthquake (M 7.5-8.0); 5.5.3 Large instrumentally recorded earthquake; The 1966 Xingtai earthquake (Ms 7.2); The 1975 Haicheng earthquake (Ms 7.3); The 1976 Tangshan earthquake (Ms 7.8); 5.6 Spatiotemporal patterns of large earthquakes. , 5.6.1 Long-distance roaming of large earthquakes5.6.2 Fault coupling and interaction; 5.6.3 A conceptual model for mid-continental earthquakes; 5.7 Implications for earthquake hazards; Acknowledgements; 6 Seismogenesis of earthquakes occurring in the ancient rift basin of Kachchh, Western India; 6.1 Introduction; 6.2 Tectonic framework, structure, and tectonic evolution of Kachchh Rift basin; 6.2.1 Structure and tectonics; 6.2.2 Tectono-volcanic events; 6.2.3 Tectonic evolution and existing earthquake generation models of the Kachchh Rift zone. , 6.2.4 Identification of magmatic intrusive bodies.

Note: Ecotones Between Forest and Grassland; Preface; Contents; Contributors; Chapter 1: Introduction; 1.1 Rationale; 1.2 Case Study: The Cross Timbers; 1.3 About This Book; References; Part I: Temperate Forest-Grassland Ecotones: Prairies, Steppes, and Pampas; Chapter 2: Woodland-Grassland Ecotonal Shifts in Environmental Mosaics: Lessons Learnt from the Environmental History of the Carpathian Basin (Central Europe) During the Holocene and the Last Ice Age Based on Investigation of Paleobotanical and Mollusk Remains; 2.1 Introduction. , 2.2 Modern Woodland-Grassland Ecotone in the Carpathian Basin and Controversies Around Definitions2.3 Profiles Selected and Methods Applied in Modeling Woodland-Grassland Ecotone Shifts in the Carpathian Basin; 2.3.1 The Climate-Zonal Hypothesis Put to the Test; 2.3.2 Testing the Model of Edaphic Ecological Factors; 2.3.3 Testing the Idea of Human-Induced Ecotone Development; 2.4 The Vegetation History of the Great Hungarian Plains as Inferred from the Evaluation of Quaternary Paleoecological and Environmental Historical Data; 2.4.1 Vegetation Development During Last Ice Age. , 2.4.2 Vegetation Development During the Terminal Part of the Last Ice Age2.4.3 Vegetation Development During the Pleistocene/Holocene Transition; 2.4.4 Vegetation History of the Carpathian Basin from the Settlement of the First Farmers; 2.5 Summary; References; Chapter 3: Ecotones as Complex Arenas of Disturbance, Climate, and Human Impacts: The Trans-Andean Forest-Steppe Ecotone of Northern Patagonia; 3.1 Introduction; 3.2 Physical and Biological Setting of Forest-Steppe Ecotone of Northern Patagonia; 3.2.1 Abiotic Transition; 3.2.2 Ecosystem Properties Across the Transition. , 3.2.3 Plant Communities and Plant Diversity Across the Transition3.3 Disturbance Variation and Forest Dynamics Across the Transition; 3.3.1 Fine-Scale Disturbances; 3.3.2 Coarse-Scale Disturbances; 3.4 Direct and Disturbances-Mediated In fl uences of Climate Variability Across the Transition; 3.5 Climate, Fire, Land Use, and Long-Term Vegetation Changes Across the Transition; 3.5.1 Xeric Steppe-Woodland Belt; 3.5.2 The Nothofagus Forest-Shrubland Belt; 3.5.3 The Wet Rainforest Belt; 3.6 Conclusions; References; Chapter 4: Woody-Herbaceous-Livestock Species Interaction; 4.1 Introduction. , 4.2 Woody-Herbaceous Species Interactions and Associated Models4.3 Woodland and Grassland Stable States and Conceptual Models; 4.4 Woody-Herbaceous Ecotones; 4.5 Rates and Patterns of Woody-Herbaceous Ecotone Shift; 4.6 Woody-Herbaceous-Livestock Species Dynamics; 4.7 Other Potential Factors In fl uencing Woody-Herbaceous Species Dynamics; 4.8 Current and Future Research on Woody-Herbaceous-Livestock Species Interaction; References; Chapter 5: Woody Plant Invasions in Pampa Grasslands: A Biogeographical and Community Assembly Perspective; 5.1 Introduction. , 5.2 Woody Invasions as Hierarchical Assembly Processes.

Note: Preface; Contributors; Content; Introduction; Cosmology - The Largest Possible Model?; The Standard Model of Cosmology as a Tool for Interpretation and Discovery; Patterns in Physical and Biological Systems; Symmetry and the Explanation of Organismal Form; Pluralistic Modeling of Complex Systems; The Methodological Challenges of Complex Systems; Contested Modeling: The Case of Economics; A Unifying Approach to High- and Low-Level Cognition; High-vs Low-Level Cognition and the Neuro- Emulative Theory of Mental Representation. , Evaluating a Computational Model of Eye-Movement Control in ReadingConsidering Criteria for Model Modification and Theory Change in Psychology; Identification of Kinetic Models by Incremental Refinement; Kinetics, Models, and Mechanism; Modeling Complexity: The Case of Climate Science; Chaos, Plurality, and Model Metrics in Climate Science; Subject Index; Author Index.

Note: Contents: I Grundlegungen und Orientierungen ; 1. Grundlegungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; 2. Orientierungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; II Forschungs- und Handlungsfelder der Nachhaltigkeitswissenschaften und -politik ; 1. Einführung ; 2. Wissenschaft und Forschung ; 3. Wirtschaften und Arbeiten ; 4. Raumentwicklung ; 5. Mobilität ; 6. Klimawandel und -politik ; 7. Ressourcenpolitik und Infrastruktur ; 8. Natur und Landschaft ; 9. Konsum- und Lebensstile ; 10. Zeit(en) ; 11. Governance, Partizipation, Empowerment ; III Fazit - Die Kategorie Geschlecht: Neue Perspektiven für die Nachhaltigkeitswissenschaften

Note: Cover; Contents; Preface and Overview; Acknowledgments; Introduction to the 2014 Edition; 1. The Distinctiveness of Comparative Social Science; 2. Heterogeneity and Causal Complexity; 3. Case-Oriented Comparative Methods; 4. The Variable-Oriented Approach; 5. Combined Versus Synthetic Comparative Strategies; 6. A Boolean Approach to Qualitative Comparison: Basic Concepts; 7. Extensions of Boolean Methods of Qualitative Comparison; 8. Applications of Boolean Methods of Qualitative Comparison; 9. The Dialogue of Ideas and Evidence in Social Research; Bibliography; Index.

Note: Introduction, Pages 1-2 --- Relaxation, Pages 3-16 --- Shear Relaxation, Pages 17-32 --- Volume Relaxation, Pages 33-43 --- Enthalpy Relaxation, Pages 45-62 --- Summary, Pages 63-72

Note: Univ. of Western Australia, Diss. von D. Müller--Nedlands , Pages 1-2, Introduction --- Pages 3-10, Definitions and Nomenclature --- Pages 11-39, Tectonic settings of potassic igneous rocks --- Pages 41-64, Selected type-localities of potassic igneous rocks from the five tectonic settings --- Pages 65-84, Primary enrichment of precious metals in potassic igneous rocks --- Pages 85-134, Direct associations between potassic igneous rocks and gold-copper deposits --- Pages 135-158, Indirect associations between lamprophyres and gold-copper deposits --- Pages 159-171, Halogen contents of mineralized versus unmineralized potassic igneous rocks --- Pages 173-176, Implications for mineral exploration --- Pages 177-200, Characteristics of some gold-copper deposits associated with potassic igneous rocks

Note: Contents; Preface; 1 Introduction; 2 Fundamentals of rock failure physics; 2.1 Mechanical properties and constitutive relations; 2.1.1 Elastic deformation; 2.1.2 Ductile deformation; 2.1.3 Fracture; 2.1.4 Friction; 2.2 Basics of rock fracture mechanics; 2.2.1 Energy release rate and resistance to rupture growth; 2.2.2 Stress concentration and cohesive zone model; 2.2.3 Breakdown zone model for shear failure; 2.2.4 j-integral and energy criterion for shear failure; 2.2.5 Relation between resistance to rupture growth and constitutive relation parameters. , 3 Laboratory-derived constitutive relations for shear failure3.1 Shear failure of intact rock; 3.1.1 Method and apparatus used; 3.1.2 Constitutive relations derived from data on the shear failure of intact rock; 3.1.3 Geometric irregularity of shear-fractured surfaces and characteristic length; 3.2 Frictional slip failure on precut rock interface; 3.2.1 Method and apparatus used; 3.2.2 Geometric irregularity of precut fault surfaces and characteristic length; 3.2.3 Constitutive relations derived from data on frictional stick-slip failure. , 3.2.4 Laboratory-derived relationships between physical quantities observed during dynamic slip rupture propagation3.3 Unifying constitutive formulation and a constitutive scaling law; 3.3.1 Unification of constitutive relations for shear fracture and for frictional slip failure; 3.3.2 A constitutive scaling law; 3.3.3 Critical energy required for shear fracture and for frictional stick-slip failure; 3.3.4 Stabilityinstability of the breakdown process; 3.3.5 Breakdown zone size; 3.4 Dependence of constitutive law parameters on environmental factors; 3.4.1 Introduction. , 3.4.2 Dependence of shear failure strength on environmental factors3.4.3 Dependence of breakdown stress drop on environmental factors; 3.4.4 Dependence of breakdown displacement on environmental factors; 4 Constitutive laws for earthquake ruptures; 4.1 Basic foundations for constitutive formulations; 4.2 Rate-dependent constitutive formulations; 4.3 Slip-dependent constitutive formulations; 4.4 Depth dependence of constitutive law parameters; 5 Earthquake generation processes; 5.1 Shear failure nucleation processes observed in the laboratory; 5.1.1 Introduction; 5.1.2 Experimental method. , 5.1.3 Nucleation phases observed on faults with different surface roughnessesRough fault; Smooth fault; Extremely smooth fault; 5.1.4 Scaling of the nucleation zone size; 5.2 Earthquake rupture nucleation; 5.2.1 Seismogenic background; 5.2.2 Physical modeling and theoretical derivation of the nucleation zone size; 5.2.3 Comparison of theoretical relations with seismological data; 5.2.4 Foreshock activity associated with the nucleation process; 5.3 Dynamic propagation and generation of strong motion seismic waves; 5.3.1 Slip velocity and slip acceleration in the breakdown zone. , 5.3.2 The cutoff frequency fs max of the power spectral density of slip acceleration at the source.

Note: Machine generated contents note: Introduction Jan Aart Scholte; 1. Global governance, accountability and civil society Jan Aart Scholte; 2. Civil society and accountability of the United Nations Kerstin Martens; 3. The World Bank and democratic accountability: the role of civil society Alnoor Ebrahim and Steven Herz; 4. Civil society and IMF accountability Jan Aart Scholte; 5. Civil society and the WTO: contesting accountability Marc Williams; 6. Civil society and accountability in the Commonwealth Timothy M. Shaw and Pamela K. Mbabazi; 7. The organisation of the Islamic conference, accountability and civil society Saied Reza Ameli; 8. Civil society and patterns of accountability in the OECD Morten Ougaard; 9. Civil society and G8 accountability Peter I. Hajnal; 10. Structuring accountability: the Asia-Europe meeting Julie Gilson; 11. Civil society and accountability in global governance of climate change Peter Newell; 12. Civil society and accountability promotion in the global fund Carolyn Long and Nata Duvvury; 13. Accountability in private global governance: ICANN and civil society Mawaki Chango; 14. Civil society and the World Fair Trade Organisation: developing responsive accountability Heidi Ullrich; Conclusion Jan Aart Scholte..

Note: ""Cover""; ""Contents""; ""Acknowledgments""; ""Chapter 1 Introduction""; ""1.1 Types of Disease""; ""1.2 Characterization of Diseases""; ""1.3 Control of Infectious Diseases""; ""1.4 What Are Mathematical Models?""; ""1.5 What Models Can Do""; ""1.6 What Models Cannot Do""; ""1.7 What Is a Good Model?""; ""1.8 Layout of This Book""; ""1.9 What Else Should You Know?""; ""Chapter 2 Introduction to Simple Epidemic Models""; ""2.1 Formulating the Deterministic SIR Model""; ""2.1.1 The SIR Model Without Demography""; ""2.1.1.1 The Threshold Phenomenon""; ""2.1.1.2 Epidemic Burnout"". , ""2.1.1.3 Worked Example: Influenza in a Boarding School""""2.1.2 The SIR Model With Demography""; ""2.1.2.1 The Equilibrium State""; ""2.1.2.2 Stability Properties""; ""2.1.2.3 Oscillatory Dynamics""; ""2.1.2.4 Mean Age at Infection""; ""2.2 Infection-Induced Mortality and SI Models""; ""2.2.1 Mortality Throughout Infection""; ""2.2.1.1 Density-Dependent Transmission""; ""2.2.1.2 Frequency Dependent Transmission""; ""2.2.2 Mortality Late in Infection""; ""2.2.3 Fatal Infections""; ""2.3 Without Immunity: The SIS Model""; ""2.4 Waning Immunity: The SIRS Model"". , ""2.5 Adding a Latent Period: The SEIR Model""""2.6 Infections with a Carrier State""; ""2.7 Discrete-Time Models""; ""2.8 Parameterization""; ""2.8.1 Estimating R[sub(0)] from Reported Cases""; ""2.8.2 Estimating R[sub(0)] from Seroprevalence Data""; ""2.8.3 Estimating Parameters in General""; ""2.9 Summary""; ""Chapter 3 Host Heterogeneities""; ""3.1 Risk-Structure: Sexually Transmitted Infections""; ""3.1.1 Modeling Risk Structure""; ""3.1.1.1 High-Risk and Low-Risk Groups""; ""3.1.1.2 Initial Dynamics""; ""3.1.1.3 Equilibrium Prevalence""; ""3.1.1.4 Targeted Control"". , ""3.1.1.5 Generalizing the Model""""3.1.1.6 Parameterization""; ""3.1.2 Two Applications of Risk Structure""; ""3.1.2.1 Early Dynamics of HIV""; ""3.1.2.2 Chlamydia Infections in Koalas""; ""3.1.3 Other Types of Risk Structure""; ""3.2 Age-Structure: Childhood Infections""; ""3.2.1 Basic Methodology""; ""3.2.1.1 Initial Dynamics""; ""3.2.1.2 Equilibrium Prevalence""; ""3.2.1.3 Control by Vaccination""; ""3.2.1.3 Parameterization""; ""3.2.2 Applications of Age Structure""; ""3.2.2.1 Dynamics of Measles""; ""3.2.2.2 Spread and Control of BSE""; ""3.3 Dependence on Time Since Infection"". , ""3.3.1 SEIR and Multi-Compartment Models""""3.3.2 Models with Memory""; ""3.3.3 Application: SARS""; ""3.4 Future Directions""; ""3.5 Summary""; ""Chapter 4 Multi-Pathogen/Multi-Host Models""; ""4.1 Multiple Pathogens""; ""4.1.1 Complete Cross-Immunity""; ""4.1.1.1 Evolutionary Implications""; ""4.1.2 No Cross-Immunity""; ""4.1.2.1 Application: The Interaction of Measles and Whooping Cough""; ""4.1.2.2 Application: Multiple Malaria Strains""; ""4.1.3 Enhanced Susceptibility""; ""4.1.4 Partial Cross-Immunity""; ""4.1.4.1 Evolutionary Implications"". , ""4.1.4.2 Oscillations Driven by Cross-Immunity"".

Note: CONTENTS; List of Figures; List of Tables; List of Contributors; Introduction; PART I: ECONOMISTS ON TRIAL; 1. Who predicted the crisis and what can we learn from them? ; 2 A brief note on economic recessions, banking reform and the future of capitalism; 3 Understanding crisis: on the meaning of uncertainty and probability; 4 Financial crisis and risk measurement: the historical perspective and a new methodology; 5 Did economic analysis fail in the current financial crisis?; PART II: WHAT DOES HISTORY TELL US? ; 6 Does the current global crisis remind us of the Great Depression?. , 7 Innovation, growth, cycles and finance: three (or four or more) stories from the 1930s and their lessons8 Epic Recession and economic theory; 9 Did asset prices cause the current crisis?; 10 The role of the history of economic thought in the development of economic theory and policy; PART III: COUNTRY CASES IN A GLOBAL CRISIS; 11. Testimony to the Financial Crisis Inquiry Commission by Alan Greenspan; 12 Long-term depression and new markets: economists and the 2008 recession; 13 Manifestations of the global crisis in a small open economy. , 14 The aftermath of a long decade of real nil interest rates (Spain 1996-2008)Index.

Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.

Note: The Application of IR Spectroscopy to the Investigation of MineralsThe Discrete Approach -- The Full-Profile Analysis -- Polymerization of coordination polyhedra and structure topology -- Hydrogen-bearing groups and hydrogen bonding -- Solid-solution series -- Force parameters of cations in silicates -- IR spectra of minerals and reference samples data -- Borates, including sulfato-borates and arsenato-borates -- Carbides and carbonates -- Organic compounds and salts of organic acids -- Ammino-complexes, nitrates and sulfato-nitrates -- Oxides and hydroxides -- Fluorides -- Silicates -- Phosphates -- Sulfates, carbonato-sulfates, phosphato-sulfates and sulfides -- Chlorides -- Vanadates and vanadium oxides -- Chromates -- Arsenates, arsenites and sulfato-arsenates -- Selenites, molybdates, tellurites, tellurates, iodites, wolframates and wolfram oxides..

Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System

Note: Vorwort zur zweiten Auflage; Vorwort; Inhalt; Abkürzungen; Einführung; Teil I; Eine kurze Geschichte der Energiewende; Fukushima und Ausstieg (2011); Fundamente der Energiewende (1980 - 1998); EnWG und EEG (1998 - 2003); Emissionshandel und Energiepreise (2003 - 2008); Netzregulierung und EEG (2004 - 2008); Krise in Europa (2009 - 2012); Teil II; Die Zukunft der Energiewende; Standortbestimmung (2013); 2050: Energiewende; Fossile Primärenergien; Die Regenerativen; Energiesystem der Zukunft; Politik für die Energiewende; 1 Braunkohle und Erdgas; 2 Auslaufbetrieb der Kernenergie ; 3 Energieeffizienz ; 4 Emissionshandel ; 5 EEG Reform ; 6 Regulierung der Stromnetze ; 7 Strommarktgestaltung ; 8 Koordinierung der Energiewende ; Zusammenfassung.

Note: Inhalt; Über dieses Buch; Teil I Einführungen: Theorien der Erzählungen; Erzählen. Die ethisch-politische Funktion narrativer Diskurse; 1 Narrative Diskurse: Eigenschaften und Funktionen; 1.1 Die narrative Kunst der Begründung; 1.2 Ein semantisches Modell der Erzählung: Algirdas J. Greimas' Aktantentheorie; 1.3 Narrative Begründungen: Eine semantische Typologie; 1.4 Die Schuld und die Vergebung: Zum Verantwortungsmanagement narrativer Diskurse; 1.5 In medias res: Warum Erzählungen oft mit dem Ende beginnen; 1.6 Die doppelte Referenz: Das Allgemeine und das Einzigartige. , 2 Die Erzähler und ihr Publikum: Zur Öffentlichkeit narrativer Diskurse2.1 Öffentliche Urteile: Die Erzähler und ihr Publikum; 2.2 Die zwei Stimmen des Erzählers; 2.3 Die Präsenz des Erzählers in der Erzählung; 2.4 Die Öffentlichkeiten des Erzählers; 2.5 Autobiografisches Erzählen: Der innere Dialog und das Denken; 2.6 Ausblick: Die Öffentlichkeitsregime narrativer Diskurse; Literatur; »Menschen lesbarer machen«1: Narration, Diskurs,Referenz; 1 Narrationen als sozialwissenschaftliches Konzept; 1.1 Erzählungen zwischen Text und Handlung; 1.2 Typen der Erzählung. , 1.3 Zur lebensweltlichen Einbettung von Narrativen2 Zum Verhältnis von Narration und Diskurs; 2.1 Brauchen Diskurse Erzählungen?; 2.2 Narrationen als Sprech-Handlungen (über Satzniveau); 3 Erzählungen: Strukturen, Ereignisse und dieKomposition der Fabel; 3.1 Narration und Fabelkomposition; 3.2 Ebenen der Erzählung; 3.3 Kollektiv-Symbole und ihre Erzählungen; 3.4 Narrative und ihre Bedeutung für die kulturelle Reproduktion und Innovation; 4 Referenz und Erzählung: Jenseits der Innenwelt von Texten; 4.1 Öffentliche Erzählungen als Mimesis von Handlungen?. , 5 ConclusioLiteratur; Öffentliche Erzählungen und der globale Wandel des Klimas; 1 Einleitung; 2 Der Mensch als Klimageschichtenerzähler; 2.1 Was heißt Narrativisierung des Klimas?; 2.2 Narrationen als Geburtshelfer möglicher Welten; 2.3 Klimageschichten sind lebende Geschichten; 3 Globaler Klimawandel: Geburt eines Konzepts; 4 Sechs Varianten der Narrativisierung des globalenKlimawandels; 4.1 Das »globale Treibhaus« als anthropogene Katastrophe; 4.2 Anthropogene Eiszeiten: die Katastrophe des; 4.3 Die Geschichte vom »nuklearen Winter«; 4.4 »Paradiesische Warmzeiten«. , 4.5 Die ewige Wiederkehr der »Sonnenflecken«: Normalität statt Katastrophe. , 4.2 Die Konfiguration von Charakteren in öffentlichen Erzählungen4.3 Re-figuration und die Rolle des Lesers; Teil II Erzählungen in den Medien; Kollektivsymbolik und die deutsche Krise seit dem Jahr 2000; Heimat, Natur und die gute alte Zeit. Erzählungenüber Nachhaltige Entwicklung im Spannungsfeldöffentlicher und wissenschaftlicher Diskurse1; 1 Einleitung; 2 Wissenschaftliche Diskurse über Nachhaltige Entwicklung; 3 Nachhaltige Ernährung und Ernährungskommunikation; 4 Erzählungen über Ernährung in den Medien; 4.1 Polarisierende Rhetorik; 4.2 Affirmative Rhetorik; 4.3 Reflektierende Rhetorik.

Note: Front Cover; SEAWATER: ITS COMPOSITION, PROPERTIES AND BEHAVIOUR; Copyright Page; CONTENTS; ABOUT THIS VOLUME; ABOUT THIS SERIES; CHAPTER 1. WATER , AIR AND ICE; 1.1 THE SPECIAL PROPERTIES OF WATER; 1.2 THE HYDROLOGICAL CYCLE; 1.3 SUMMARY OF CHAPTER 1; CHAPTER 2. TEMPERATURE IN THE OCEANS; 2.1 SOLAR RADIATION; 2.2 DISTRIBUTION OF SURFACE TEMPERATURES; 2.3 DISTRIBUTION OF TEMPERATURE WITH DEPTH; 2.4 ENERGY FROM THE THERMOCLINE - A BRIEF DIGRESSION; 2.5 TEMPERATURE DISTRIBUTION AND WATER MOVEMENT; 2.6 SUMMARY OF CHAPTER 2; CHAPTER 3. SALINITY IN THE OCEANS; 3.1 CONSTANCY OF COMPOSITION. , 3.2 VARIATIONS IN SALINITY3.3 THE MEASUREMENT OF SALINITY; 3.4 SUMMARY OF CHAPTER 3; CHAPTER 4. DENSITY AND PRESSURE IN THE OCEAN; 4.1 WATER MASSES; 4.2 DEPTH (PRESSURE), DENSITY AND TEMPERATURE; 4.3 T-S DIAGRAMS; 4.4 MIXING PROCESSES IN THE OCEANS; 4.5 SUMMARY OF CHAPTER4; CHAPTER 5. LIGHT AND SOUND IN SEAWATER; 5.1 UNDERWATER LIGHT; 5.2 UNDERWATER SOUND; 5.3 SUMMARY OF CHAPTER 5; CHAPTER 6. THE SEAWATER SOLUTION; 6.1 THE GROSS CHEMICAL COMPOSITION OF SEAWATER; 6.2 SOURCES AND SINKS, OR WHY THE SEA IS SALT; 6.3 CHEMICAL AND BIOLOGICAL REACTIONS IN SEAWATER; 6.4 SUMMARY OF CHAPTER 6. , CHAPTER 7. SEAWATER AND THE GLOBAL CYCLE7.1 A SHORT HISTORY OF SEAWATER; 7.2 A LOOK AHEAD; 7.3 SUMMARY OF CHAPTER; APPENDIX: CONVERSIONS BETWEEN pH AND [H+]; SUGGESTED AND COMMENTS READING; ANSWERS AND COMMENTS TO QUESTIONS; ACKNOWLEDGEMENTS; INDEX.

Note: I Physics of the Upper AtmosphereI.1 Introduction to the Earth’s Atmosphere -- I.2 Dynamics of the Atmosphere -- I.3 Atmospheric Tides -- I.4 Chemistry in the Atmosphere -- I.5 H2O in the Atmosphere -- I.6 Pollution of the Upper Atmosphere -- I.7 Transatmospheric Propagation of Radio Waves: The Role of the Atmosphere in Communication, Navigation, Geodesy etc. -- I.8 Atmosphere as a Part of the Biosphere -- I.9 Legal Aspects -- II Investigation Methods of the Upper Atmosphere -- II.1 Acoustic Methods for Probing the Upper Atmosphere -- II.2 Hydrodynamic and Electrodynamic Measurements -- II.3 Electromagnetic Waves in the Upper Atmosphere -- II.4 Chemistry and Physico-Chemistry -- II.5 Modification Methods -- III International Reference and Model Atmosphere -- III.1 Selected Features of the Middle Atmosphere -- III.2 The Thermosphere: Selected Features -- III.3 The Ionosphere -- III.4 Magnetosphere -- IV Special Phenomena of the Upper Atmosphere -- IV.1 Stratospheric Midwinter Warmings -- IV.2 The Antarctic Ozone Hole -- IV.3 Polar Mesospheric Clouds -- IV.4 Night Glow -- IV.5 Aurorae -- V Solar-Terrestrial Relations -- V.1 Solar Activity, Solar Cycle, Coordinates -- V.2 The Solar Wind and Its Effects on Geospace -- V.3 Geomagnetic Activity Indices -- VI Data Centres, Computer Network Communications, Observing Systems and Data Growth Rate Problems, Problems with Long-Term Data, Relevant for the Upper Atmosphere -- VI.1 General Overview of Online Services and Data Centres -- VI.2 The World Data Centre System, International Data Exchange, and New ICSU Programs -- VI.3 Computer Network Communications -- VI.4 SELDADS and SELSIS -- VI.5 Data Growth Rate Problems and Problems with Long-Term Data..

Note: Particle Drifts and the First Adiabatic InvariantParticle Trapping, Drift Shells and the Second Adiabatic Invariant -- Periodic Drift Motion and the Third Adiabatic Invariant -- Trapped Particle Distributions and Flux Mapping -- Violation of the Adiabatic Invariants and Trapped Particle Diffusion -- Introduction to Plasma Physics..

Note: German

Note: section A. Language, ideology and powersection B. Discourse and sociocultural change -- section C. Dialectics of discourse: theoretical developments -- section D. Methodology in CDA research -- section E. Political discourse -- F. Globalisation and 'transition' -- section G. Language and education..

Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..

Note: Berlin, Humboldt-Univ., Diss., 2011

Note: Pages 3-6, Introduction, Helmut Wilhelm, Walter Zürn, Hans-Georg Wenzel --- Pages 9-26, Tide-generating potential for the earth, Hans-Georg Wenzel --- Pages 27-57, Tidal response of the solid Earth, Rongjiang Wang --- Pages 59-75, Analysis of earth tide observations, Hans-Georg Wenzel --- Pages 77-94, Earth tide observations and interpretation, Walter Zürn --- Pages 95-109, The nearly-diurnal free wobble-resonance, Walter Zürn --- Pages 113-143, Ocean tides, Wilfried Zahel --- Pages 145-171, Earth tides and ocean tidal loading, Gerhard Jentzsch --- Pages 173-181, Ocean tides and earth rotation, Johannes Wünsch --- Pages 183-218, Chandler wobble and pole tide in relation to interannual atmosphere-ocean dynamics, Hans-Peter Plag --- Pages 221-246, Atmospheric tides, Hans Volland --- Pages 247-260, Long-period variations of solar irradiance, Helmut Wilhelm --- Pages 261-274, Geomagnetic tides and related phenomena, Nils Olsen --- Pages 277-291, Tides in water saturated rock, Hans-Joachim Kümpel --- Pages 293-309, Tidal triggering of earthquakes and volcanic events, Dieter Emter --- Pages 311-339, Tidal tilt modification along an active fault, Malte Westerhaus --- Pages 343-344, Satellite orbit perturbations induced by tidal forces, Peter Schwintzer --- Pages 345-377, Tides of io, Tilman Spohn --- Pages 379-380, Tidal effects in binary star systems, Gerhard Schäfer --- Pages 381-386, Tidal interactions between galaxies, Claus Möllenhoff

Note: Pages 3-34, Physical grounds for acoustic remote sensing of the atmospheric boundary layer, M. A. Kallistratova --- Pages 35-84, An overview of the technological development of atmospheric echosounders (SODARS), John A. Kleppe --- Pages 85-104, Design of a tri-monostatic doppler sodar system, Yoshiki Ito --- Pages 105-116, A modular PC-based multiband sodar system, G. Mastrantonio, S. Argentini --- Pages 117-132, Mini acoustic sounding, a powerful tool for ABL applications: Recent advances, D. N. Asimakopoulos, C. G. Helmis, M. Petrakis --- Pages 133-141, Radio-acoustic temperature profiling in the troposphere, G. Bonino --- Pages 142-176, Radio acoustic sounding system (RASS) for studying the lower atmosphere, S. P. Singal, Malti Goel --- Pages 179-190, Determination of the turbulent structure parameters, Pan Naixian --- Pages 191-201, Turbulence variables derived from sodar data, R. L. Coulter --- Pages 202-235, Development of sodar detection and its application for studies of atmospheric boundary layer in Beijing, China, Mingyu Zhou --- Pages 236-246, Influence of the nocturnal low-level-jet on the vertical and mesoscale structure of the stable boundary layer as revealed from doppler-sodar-observations, Frank Beyrich, Dieter Kalass, Ulrich Weisensee --- Pages 247-274, Dynamics of the continental boundary layer: The CRPE sodar results (1984–1993), Christine Amory-Mazaudier --- Pages 275-292, Sodar investigations of gravity waves by cross spectral analysis, Günther Bull --- Pages 293-306, Sodar monitoring of nocturnal boundary layer during the harmattan in Ile-Ife, Nigeria, J. A. Adedokun --- Pages 307-324, An overview of similarity methods to estimate turbulence quantities from sodar measurements in the convective boundary layer, Dimitrios Melas --- Pages 325-384, Sodar: A tool to characterize hazardous situations in air pollution and communication, S. P. Singal, B. S. Gera, Neeraj Saxena --- Pages 385-394, Application of sodar in urban air-quality monitoring systems, Jacek Walczewski --- Pages 395-405, Operational use of sodar information in nowcasting, Th. Foken, H.-J. Albrecht, K. Sasz, F. Vogt --- Pages 409-448, Acoustic remote sensing of ocean flows, Antony Joseph K, Ehrlich Desa --- Pages 449-475, Acoustic remote sensing of ocean-atmosphere interactions, A. Weill, H. Dupuis

Note: Problemanalyse und ÜberblickNeue Institutionen: Zukunftsräte -- Neue Institutionen: Ombudspersonen -- Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten -- Ombudspersonen in Unternehmen?..

Note: Vorwort; Inhaltsverzeichnis; 1 Einführung; 1.1 Grundlegende Begriffe; 1.2 Schutzziele; 1.3 Schwachstellen, Bedrohungen, Angriffe; 1.3.1 Bedrohungen; 1.3.2 Angriffs- undAngreifer-Typen; 1.3.3 Rechtliche Rahmenbedingungen; 1.4 ComputerForensik; 1.5 Sicherheitsrichtlinie; 1.6 Sicherheitsinfrastruktur; 2 Spezielle Bedrohungen; 2.1 Einführung; 2.2 Buffer-Overflow; 2.2.1 Einführung; 2.2.2 Angriffe; 2.2.3 Gegenmaßnahmen; 2.3 Computerviren; 2.3.1 Eigenschaften; 2.3.2 Viren-Typen; 2.3.3 Gegenmaßnahmen; 2.4 Würmer; 2.5 Trojanisches Pferd; 2.5.1 Eigenschaften; 2.5.2 Gegenmaßnahmen; 2.6 Bot-Netze undSpam. , 2.6.1 Bot-Netze2.6.2 Spam; 2.7 MobilerCode; 2.7.1 Eigenschaften; 2.7.2 Sicherheitsbedrohungen; 2.7.3 Gegenmaßnahmen; 2.7.4 MobileApps; 3 Internet-(Un-)Sicherheit; 3.1 Einführung; 3.2 Internet-Protokollfamilie; 3.2.1 ISO/OSI-Referenzmodell; 3.2.2 DasTCP/IP-Referenzmodell; 3.2.3 Das Internet-Protokoll IP; 3.2.4 DasTransmissionControlProtokoll TCP; 3.2.5 DasUserDatagramProtocolUDP; 3.2.6 DHCP und NAT; 3.3 Sicherheitsprobleme; 3.3.1 Sicherheitsprobleme von IP; 3.3.2 Sicherheitsprobleme von ICMP; 3.3.3 Sicherheitsprobleme vonARP; 3.3.4 Sicherheitsprobleme vonUDPundTCP. , 3.4 Sicherheitsprobleme vonNetzdiensten3.4.1 DomainNameService (DNS); 3.4.2 NetworkFileSystem(NFS); 3.4.3 WeitereDienste; 3.5 Web-Anwendungen; 3.5.1 World Wide Web (WWW); 3.5.2 Sicherheitsprobleme; 3.5.3 OWASPTop-TenSicherheitsprobleme; 3.6 Analysetools undSystemhärtung; 4 Security Engineering; 4.1 Entwicklungsprozess; 4.1.1 AllgemeineKonstruktionsprinzipien; 4.1.2 Phasen; 4.1.3 BSI-Sicherheitsprozess; 4.2 Strukturanalyse; 4.3 Schutzbedarfsermittlung; 4.3.1 Schadensszenarien; 4.3.2 Schutzbedarf; 4.4 Bedrohungsanalyse; 4.4.1 Bedrohungsmatrix; 4.4.2 Bedrohungsbaum; 4.5 Risikoanalyse. , 4.5.1 Attributierung4.5.2 Penetrationstests; 4.6 Sicherheitsarchitektur und Betrieb; 4.6.1 Sicherheitsstrategie undSicherheitsmodell; 4.6.2 Systemarchitektur undValidierung; 4.6.3 Aufrechterhaltung im laufenden Betrieb; 4.7 Sicherheitsgrundfunktionen; 4.8 Realisierung der Grundfunktionen; 4.9 Security Development Lifecycle (SDL); 4.9.1 Die Entwicklungsphasen; 4.9.2 Bedrohungs- und Risikoanalyse; 5 Bewertungskriterien; 5.1 TCSEC-Kriterien; 5.1.1 Sicherheitsstufen; 5.1.2 Kritik am Orange Book; 5.2 IT-Kriterien; 5.2.1 Mechanismen; 5.2.2 Funktionsklassen; 5.2.3 Qualität; 5.3 ITSEC-Kriterien. , 5.3.1 Evaluationsstufen5.3.2 Qualität und Bewertung; 5.4 Common Criteria; 5.4.1 Überblick über dieCC; 5.4.2 CC-Funktionsklassen; 5.4.3 Schutzprofile; 5.4.4 Vertrauenswürdigkeitsklassen; 5.5 Zertifizierung; 6 Sicherheitsmodelle; 6.1 Modell-Klassifikation; 6.1.1 Objekte undSubjekte; 6.1.2 Zugriffsrechte; 6.1.3 Zugriffsbeschränkungen; 6.1.4 Sicherheitsstrategien; 6.2 Zugriffskontrollmodelle; 6.2.1 Zugriffsmatrix-Modell; 6.2.2 RollenbasierteModelle; 6.2.3 Chinese-Wall Modell; 6.2.4 Bell-LaPadula Modell; 6.3 Informationsflussmodelle; 6.3.1 Verbands-Modell; 6.4 Fazit undAusblick. , 7 Kryptografische Verfahren.

Note: Cover; Title Page; Copyright Page; Table of Contents; List of illustrations; Notes on contributors; Acknowledgements; 1 Socio-ecological transformations and the social sciences; PART I Challenges, contradictions and consequences of global socio-ecological change; 2 Ecological modernization theory: taking stock, moving forward; 3 The emergence of new world-systems perspectives on global environmental change; 4 China's economic growth and environmental protection: approaching a 'win-win' situation? A discussion of ecological modernization theory; 5 Eco-imperialism and environmental justice. , 6 Neoliberalism by design: changing modalities of market-based environmental governance7 Dilemmas for standardizers of sustainable consumption; PART II Climate change, energy and adaptation; 8 Climate, scenario-building and governance: comprehending the temporalities of social-ecological change; 9 From Rio to Copenhagen: multilateral agreements, disagreements and situated actions; 10 Marriage on the rocks: sociology's counsel for our struggling energy-society relationships; 11 Sustainability as social practice: new perspectives on the theory and policies of reducing energy consumption. , 12 Environmental migration: nature, society and population movementPART III Urban environmental change, governance and adaptation; 13 Climate change and urban governance: a new politics?; 14 Recovering the city level in the global environmental struggle: going beyond carbon trading; 15 Hybrid arrangements within the environmental state; 16 The new mobilities paradigm and sustainable transport: finding synergies and creating new methods; PART IV Risk, uncertainty and social learning; 17 Towards a socio-ecological foundation for environmental risk research. , 18 Uncertainty and claims of uncertainty as impediments to risk management19 Transboundary risk governance: co-constructing environmental issues and political solutions; 20 The role of professionals in managing technological hazards: the Montara blowout; 21 Social learning to cope with global environmental change and unsustainability; PART V (Re)assembling social-ecological systems; 22 The social-ecological co-constitution of nature through ecological restoration: experimentally coping with inevitable ignorance and surprise. , 23 Biological invasions as cause and consequence of 'our' changing world: social and environmental paradoxes24 Biological resources, knowledge and property; 25 Disassembling and reassembling socionatural networks: integrated natural resource management in the Great Bear Rainforest; 26 Land use tensions for the development of renewable sources of energy; Index.

Note: The democratic promiseThe deliberative turn in democratic theory -- The elusive concept of empathy -- Empathy in deliberative theory -- Empathy's importance : the empirical evidence -- Deliberative democracy and its critics -- Empathy and democracy..

Note: German

Note: Front Cover; Contents; Preface; 1. What's Vis, and Why Do It?; 2. What: Data Abstraction; 3. Why: Task Abstraction; 4. Analysis: Four Levels for Validation; 5. Marks and Channels; 6. Rules of Thumb; 7. Arrange Tables; 8. Arrange Spatial Data; 9. Arrange Networks and Trees; 10. Map Color and Other Channels; 11. Manipulate View; 12. Facet into Multiple Views; 13. Reduce Items and Attributes; 14. Embed: Focus+Context; 15. Analysis Case Studies; Figure Credits; Bibliography.