ALBERT

Note: Ersch. unregelmäßig , Beiträge teilweise in Englisch

Note: The basics -- Matching, covering and packing -- Connectivity -- Planar graphs -- Colouring -- Flows -- Extremal graph theory -- Infinite graphs -- Ramsey theory for graphs -- Hamilton cycles -- Random graphs -- Minors, trees, and WQO..

Note: Text dt. und engl.

Note: Techn. Univ., Diss. u.d.T.: Scheel, Katrin: Der Briefwechsel von Richard Dedekind mit Heinrich Weber--Braunschweig, 2015 , Frontmatter -- Grußwort Geleitwort Vorwort des Herausgebers Danksagung Editionskriterien Abkürzungsverzeichnis Inhalt: 1. Einleitung 2. Richard Dedekind 3. Heinrich Weber 4. Briefwechsel Dedekind - Weber 5. Elise Riemann 6. Verlag B. G. Teubner 7. Karl Hattendorff 8. Hermann Amandus Schwarz 9. Friedrich Wöhler A. Verlagsverträge B.G.Teubner-Verlag B. Chronologisches Dokumentenverzeichnis C. Verzeichnis der Fundstellen D. Literaturverzeichnis zum Briefwechsel E. Kurzbiographien Literatur Personenindex..

Note: Contents: Linear Control Systems ; The Dynamic Programming Approach ; Ellipsoidal Techniques: Reachability and Control Synthesis ; Solution Examples on Ellipsoidal Methods: Computation in High Dimensions ; The Comparison Principle: Nonlinearity and Nonconvexity ; Impulse Controls and Double Constraints ; Dynamics and Control Under State Constraints ; Trajectory Tubes State-Constrained Feedback Control ; Guaranteed State Estimation ; Uncertain Systems: Output Feedback Control ; Verification: Hybrid Systems

Note: In kyrill. Schr.

Note: Cover; Copyright; Praise; Introduction; Contents; Section 1: THINK IT; The First Thing to Do When You Find Yourself in a Hole: Stop Digging; Stay Positive; Never Lose Faith; Seven Career Lessons I Learned from Selling Ginsu Knives; A Turning Point; Stop. Breathe. Think. Then Act.; Overcoming Inertia; Overcoming Fear; Keep Swimming; Section 2: DO IT; What Is a Resume?; What Are Managers Looking For?; Dirty Little Resume Secrets; The T-Bomb; Current Experience; What You Do Is More Important than What You're Called; The Top Ten Mistakes Professionals Make When Looking for Work. , Resumes: A SummaryCover Your Letter; Following Up; Getting Interviews; Be Proactive; Be Visible; Social Networking; Four Critical Steps to Getting a Job Offer; Send Out Ships; Gold Calling; Section 3: HAVE IT; Creating the Path; Recession-Proof Your Career; Creating a PR Campaign; Taking the Initiative; Increase Your Ability to Find Work; Advancing Your Career through Personal Branding; Advancing Your Career through Progressive Information Disclosure; Honing Your Workplace Negotiation Skills; The Sky's the Limit; What Are You Waiting For?; About Making Money; Creating the Life You Want. , Recommended ReadingAbout the Author.

Note: Vorwort; Inhaltsverzeichnis; 1 Einführung; 1.1 Grundlegende Begriffe; 1.2 Schutzziele; 1.3 Schwachstellen, Bedrohungen, Angriffe; 1.3.1 Bedrohungen; 1.3.2 Angriffs- undAngreifer-Typen; 1.3.3 Rechtliche Rahmenbedingungen; 1.4 ComputerForensik; 1.5 Sicherheitsrichtlinie; 1.6 Sicherheitsinfrastruktur; 2 Spezielle Bedrohungen; 2.1 Einführung; 2.2 Buffer-Overflow; 2.2.1 Einführung; 2.2.2 Angriffe; 2.2.3 Gegenmaßnahmen; 2.3 Computerviren; 2.3.1 Eigenschaften; 2.3.2 Viren-Typen; 2.3.3 Gegenmaßnahmen; 2.4 Würmer; 2.5 Trojanisches Pferd; 2.5.1 Eigenschaften; 2.5.2 Gegenmaßnahmen; 2.6 Bot-Netze undSpam. , 2.6.1 Bot-Netze2.6.2 Spam; 2.7 MobilerCode; 2.7.1 Eigenschaften; 2.7.2 Sicherheitsbedrohungen; 2.7.3 Gegenmaßnahmen; 2.7.4 MobileApps; 3 Internet-(Un-)Sicherheit; 3.1 Einführung; 3.2 Internet-Protokollfamilie; 3.2.1 ISO/OSI-Referenzmodell; 3.2.2 DasTCP/IP-Referenzmodell; 3.2.3 Das Internet-Protokoll IP; 3.2.4 DasTransmissionControlProtokoll TCP; 3.2.5 DasUserDatagramProtocolUDP; 3.2.6 DHCP und NAT; 3.3 Sicherheitsprobleme; 3.3.1 Sicherheitsprobleme von IP; 3.3.2 Sicherheitsprobleme von ICMP; 3.3.3 Sicherheitsprobleme vonARP; 3.3.4 Sicherheitsprobleme vonUDPundTCP. , 3.4 Sicherheitsprobleme vonNetzdiensten3.4.1 DomainNameService (DNS); 3.4.2 NetworkFileSystem(NFS); 3.4.3 WeitereDienste; 3.5 Web-Anwendungen; 3.5.1 World Wide Web (WWW); 3.5.2 Sicherheitsprobleme; 3.5.3 OWASPTop-TenSicherheitsprobleme; 3.6 Analysetools undSystemhärtung; 4 Security Engineering; 4.1 Entwicklungsprozess; 4.1.1 AllgemeineKonstruktionsprinzipien; 4.1.2 Phasen; 4.1.3 BSI-Sicherheitsprozess; 4.2 Strukturanalyse; 4.3 Schutzbedarfsermittlung; 4.3.1 Schadensszenarien; 4.3.2 Schutzbedarf; 4.4 Bedrohungsanalyse; 4.4.1 Bedrohungsmatrix; 4.4.2 Bedrohungsbaum; 4.5 Risikoanalyse. , 4.5.1 Attributierung4.5.2 Penetrationstests; 4.6 Sicherheitsarchitektur und Betrieb; 4.6.1 Sicherheitsstrategie undSicherheitsmodell; 4.6.2 Systemarchitektur undValidierung; 4.6.3 Aufrechterhaltung im laufenden Betrieb; 4.7 Sicherheitsgrundfunktionen; 4.8 Realisierung der Grundfunktionen; 4.9 Security Development Lifecycle (SDL); 4.9.1 Die Entwicklungsphasen; 4.9.2 Bedrohungs- und Risikoanalyse; 5 Bewertungskriterien; 5.1 TCSEC-Kriterien; 5.1.1 Sicherheitsstufen; 5.1.2 Kritik am Orange Book; 5.2 IT-Kriterien; 5.2.1 Mechanismen; 5.2.2 Funktionsklassen; 5.2.3 Qualität; 5.3 ITSEC-Kriterien. , 5.3.1 Evaluationsstufen5.3.2 Qualität und Bewertung; 5.4 Common Criteria; 5.4.1 Überblick über dieCC; 5.4.2 CC-Funktionsklassen; 5.4.3 Schutzprofile; 5.4.4 Vertrauenswürdigkeitsklassen; 5.5 Zertifizierung; 6 Sicherheitsmodelle; 6.1 Modell-Klassifikation; 6.1.1 Objekte undSubjekte; 6.1.2 Zugriffsrechte; 6.1.3 Zugriffsbeschränkungen; 6.1.4 Sicherheitsstrategien; 6.2 Zugriffskontrollmodelle; 6.2.1 Zugriffsmatrix-Modell; 6.2.2 RollenbasierteModelle; 6.2.3 Chinese-Wall Modell; 6.2.4 Bell-LaPadula Modell; 6.3 Informationsflussmodelle; 6.3.1 Verbands-Modell; 6.4 Fazit undAusblick. , 7 Kryptografische Verfahren.

Note: Machine generated contents note: 1. The role of experts in international and European decision-making processes: setting the scene Monika Ambrus, Karin Arts, Ellen Hey and Helena Raulus; Part I. Theorizing Expert Involvement in International and European Decision-Making: 2. Ideas, experts and governance Peter M. Haas; 3. The politics of expertise: applying paradoxes of scientific expertise to international law Wouter G. Werner; 4. Reflections on the different roles of expertise in regulatory policy-making Lorna Schrefler; 5. The virtues of expertise Jan Klabbers; Part II. Expert Involvement in International Decision-Making in the Environmental Sphere: 6. The role of scientific expertise in multilateral environmental agreements: influence and effectiveness Steinar Andresen; 7. Changing demands at the science-policy interface: organisational learning in the IPCC Bernd Siebenhüner; 8. Global scientific assessments and environmental resource governance: towards a science-policy interface ladder Joyeeta Gupta; Part III. Experts in the WTO and Risk Regulation: 9. The structural logic of expert participation in WTO decision-making processes Jessica Lawrence; 10. Health risks, experts and decision making within the SPS Agreement and the Codex Alimentarius Alexia Herwig; 11. The role of experts in environmental and health-related trade disputes in the WTO: deconstructing decision-making processes Lukasz Gruszczynski; Part IV. Experts in Human Rights Related Decision-Making Processes: 12. Human rights experts in the United Nations: a review of the role of UN special procedures Surya P. Subedi; 13. 'Experts': the mantra of irregular migration and the reproduction of hierarchies Jeff Handmaker and Claudia Mora; 14. Private carriers as experts in immigration control Sophie Scholten and Ashley Terlouw; Part V. Experts in Decision-Making Processes of the European Union: 15. The European system of financial supervision: a technology of expertise Michelle Everson; 16. The role of experts and financial supervision in the European Union: the de Larosière Commission Karim Knio; 17. Expertise at the crossroads of national and international policy-making: a public management perspective Adriaan Schout and Jaap Sleifer; 18. Blurred areas of responsibility: European agencies' scientific 'opinions' under scrutiny E. Madalina Busuioc..

Note: Vorwort zur zweiten Auflage; Vorwort; Inhalt; Abkürzungen; Einführung; Teil I; Eine kurze Geschichte der Energiewende; Fukushima und Ausstieg (2011); Fundamente der Energiewende (1980 - 1998); EnWG und EEG (1998 - 2003); Emissionshandel und Energiepreise (2003 - 2008); Netzregulierung und EEG (2004 - 2008); Krise in Europa (2009 - 2012); Teil II; Die Zukunft der Energiewende; Standortbestimmung (2013); 2050: Energiewende; Fossile Primärenergien; Die Regenerativen; Energiesystem der Zukunft; Politik für die Energiewende; 1 Braunkohle und Erdgas; 2 Auslaufbetrieb der Kernenergie ; 3 Energieeffizienz ; 4 Emissionshandel ; 5 EEG Reform ; 6 Regulierung der Stromnetze ; 7 Strommarktgestaltung ; 8 Koordinierung der Energiewende ; Zusammenfassung.

Note: Particle Drifts and the First Adiabatic InvariantParticle Trapping, Drift Shells and the Second Adiabatic Invariant -- Periodic Drift Motion and the Third Adiabatic Invariant -- Trapped Particle Distributions and Flux Mapping -- Violation of the Adiabatic Invariants and Trapped Particle Diffusion -- Introduction to Plasma Physics..

Note: Foreword; Preface; Acknowledgments; Contents; Abbreviations; Part I The Arctic Environment; 1 Introduction to the Arctic ,; Abstract; 1.1 Arctic Marine Area; 1.2 Law of the Sea in the Arctic Marine Area; 1.3 Arctic Council; 1.4 Arctic Policies of the EU and US; 1.4.1 EU Arctic Policy and Competences; 1.4.2 US Arctic Policy; 1.5 EU and US Marine Policy; 1.5.1 EU Maritime Policy; 1.5.2 US Ocean Policy; 1.6 Conclusion; References; 2 The Arctic Marine Environment; Abstract; 2.1 Introduction; 2.2 The Arctic Environment; 2.2.1 Marine Environment; 2.2.2 Land-Based Impacts on the Marine Environment. , 2.3 Specific Threats2.3.1 Climate Change; Sea Ice Reduction; Melting Glaciers and Rising Sea Levels; Greenhouse Gas Release by Melting Permafrost; Ocean Acidification; 2.3.2 Chemicals and Air Pollution; 2.3.3 Fisheries; 2.3.4 Shipping; 2.3.5 Oil and Gas Extraction; 2.3.6 Tourism; 2.3.7 Nuclear and Radioactive Waste (Including Military Use); 2.4 Conclusion; References; 3 Environmental Governance in the Marine Arctic ,; Abstract; 3.1 Introduction; 3.2 Environmental Governance; 3.3 Legal and Policy Framework; 3.3.1 Global Agreements and Institutions; 3.3.2 Regional and Sub-Regional Regimes. , 3.3.3 Informal Approaches and Initiatives3.4 Analysis of Governance Shortcomings; 3.5 Perspectives on the Way Forward: Policy Pathways; 3.5.1 Principles of Environmental Governance; 3.5.2 Conclusion and Questions for Discussion; References; 4 Arctic Indigenous Peoples and the Challenge of Climate Change ,; Abstract; 4.1 Introduction; 4.2 Arctic Indigenous Peoples; 4.2.1 Traditional Harvesting and Mixed Economies; 4.2.2 Challenges for Indigenous Societies and Culture; 4.2.3 Political and Legal Framework; 4.2.4 Arctic Cooperation. , 4.3 Climate Change Impacts, Stressors, and Indigenous Vulnerability4.3.1 Primary Impacts on Livelihoods, Harvesting, Health, and Infrastructure; 4.3.2 Impacts on Northern Economies, Societies, Cultures and Health; 4.4 Adaptive Capacity and Proposed Responses to Climate Change; 4.4.1 The Concepts of Adaptation and Adaptive Capacity; 4.4.2 Autonomous Adaptations; 4.4.3 Adaptation Planning and Governance; 4.4.4 Barriers to Adaptation; 4.5 Criticism Towards Vulnerability and Adaptation Approaches; 4.5.1 Crisis Narrative and Resilience Language; 4.5.2 Adaptation Governance as Intervention. , 4.5.3 Using Traditional Knowledge4.6 Empowerment as a Primary Response; 4.6.1 Co-management, Participatory Capacities, and Clear Outcomes of Participatory Engagement; 4.6.2 Indigenous Rights; 4.7 Conclusion: A Holistic Response; References; Part II Impacts and Activities in the Marine Arctic; 5 Status and Reform of International Arctic Fisheries Law; Abstract; 5.1 Introduction; 5.2 Arctic Fish Stocks, Fisheries, and Climate Change; 5.3 International Legal and Policy Framework for Arctic Fisheries Management; 5.3.1 Interests, Rights, Obligations, and Jurisdiction. , 5.3.2 Substantive Fisheries Standards.

Note: Thinking differently for an age of complexity -- How can theory improve practice? -- Stories from the field -- The praxis of collaboration -- Dialogue as a community of inquiry -- Knowledge into action : the role of dialogue -- Using local knowledge for justice and resilience -- Beyond collaboration : democratic governance for a resilient society..

Note: In kyrill. Schr., russ.

Note: GrainsChapter 1: Quartz and silica - Monocrystalline - Polycrystalline -- Chapter 2: Feldspars - Plagioclase - Potassium feldspars -- Chapter 3: Rock fragments - Sedimentary rock fragments - Metamorphic rock fragments - Igneous rock fragments -- Chapter 4: Accessory minerals - Light minerals: Muscovite - Biotite - Chlorite ; Ultrastable heavy minerals: Zircon, tourmaline and rutile ; Intermediate-stability heavy minerals: Apatite - Epidote - Zoisite and clinozoisite - Garnet - Kyanite - Monzonite, sillimanite and staurolite - Titanite ; Unstable heavy minerals: Amphibole, pyroxene and olivine ; Opaque minerals -- Chapter 5: Associated detrital grains and rocks: Carbonate grains - Siliceous grains and rocks - Phosphatic grains and rocks - Organic grains and rocks - Evaporite grains and rocks - Green marine clays and rocks - Green marine clays and ironstones - Iron-rich grains and iron formations - Tuffaceous deposits.. , Texture and ClassificationChapter 6: Sand and sandstone textures -- Chapter 7: Sandstone classification.. , MudrocksChapter 8: Siltstones, mudstones, claystones and shales.. , DiagenesisChapter 9: Synsedimentary and surficial diagenetic features -- Chapter 10: Compaction -- Chapter 11: Cementation - Introduction / Quartz and silica - Quartz overgrowths - Polycrystalline quartz cements - Amorphous silica cements -- Chapter 12: Cementation - Feldspars -- Chapter 13: Cementation - Clays - Chamosite - Glauconite - Kaolinite/dickite - Smectite and illite/smectite - Illite/sericite - Chlorite -- Chapter 14: Cementation - Zeolites -- Chapter 15: Cementation - Carbonates - Calcite - Siderite - Dolomite - Ankerite -- Chapter 16: Cementaton - Sulfates and halides - Gypsum - Anhydrite - Barite - Celestite and halite -- Chapter 17: Cementation - Iron oxides and sulfides -- Chapter 18: Cementation - Other cements -- Chapter 19: Dissolution -- Chapter 20: Replacement and recrystallization - Feldspars - Carbonates - Sulfates - Other -- Chapter 21: Deformation features.. , Other topicsChapter 22: Porosity -- Chapter 23: Paragenesis -- Chapter 24: Emerging techniques..

Note: Contents: Preface. - Acknowledgments. - 1. Data Acquisition and Recording. - 1.1 Introduction. - 1.2 Basic Sampling Requirements. - 1.3 Temperature. - 1.4 Salinity. - 1.5 Depth or Pressure. - 1.6 Sea-Level Measurement. - 1.7 Eulerian Currents. - 1.8 Lagrangian Current Measurements. - 1.9 Wind. - 1.10 Precipitation. - 1.11 Chemical Tracers. - 1.12 Transient Chemical Tracers. - 2. Data Processing and Presentation. - 2.1 Introduction. - 2.2 Calibration. - 2.3 Interpolation. - 2.4 Data Presentation. - 3. Statistical Methods and Error Handling. - 3.1 Introduction. - 3.2 Sample Distributions. - 3.3 Probability. - 3.4 Moments and Expected Values. - 3.5 Common PDFs. - 3.6 Central Limit Theorem. - 3.7 Estimation. - 3.8 Confidence Intervals. - 3.9 Selecting the Sample Size. - 3.10 Confidence Intervals for Altimeter-Bias Estimates. - 3.11 Estimation Methods. - 3.12 Linear Estimation (Regression). - 3.13 Relationship between Regression and Correlation. - 3.14 Hypothesis Testing. - 3.15 Effective Degrees of Freedom. - 3.16 Editing and Despiking Techniques: The Nature of Errors. - 3.17 Interpolation: Filling the Data Gaps. - 3.18 Covariance and the Covariance Matrix. - 3.19 The Bootstrap and Jackknife Methods. - 4. The Spatial Analyses of Data Fields. - 4.1 Traditional Block and Bulk Averaging. - 4.2 Objective Analysis. - 4.3 Kriging. - 4.4 Empirical Orrhogonal Functions. - 4.5 Extended Empirical Orrhogonal Functions. - 4.6 Cyclostationary EOFs. - 4.7 Factor Analysis. - 4.8 Normal Mode Analysis. - 4.9 Self Organizing Maps. - 4.10 Kalman Filters. - 4.11 Mixed Layer Depth Estimation. - 4.12 Inverse Methods. - 5. Time Series Analysis Methods. - 5.1 Basic Concepts. - 5.2 Stochastic Processes and Stationarity. - 5.3 Correlation Functions. - 5.4 Spectral Analysis. - 5.5 Spectral Analysis (Parametric Methods). - 5.6 Cross-Spectral Analysis. - 5.7 Wavelet Analysis. - 5.8 Fourier Analysis. - 5.9 Harmonic Analysis. - 5.10 Regime Shift Detection. - 5.11 Vector Regression. - 5.12 Fractals. - 6. Digital Filters. - 6.1 Introduction. - 6.2 Basic Concepts. - 6.3 Ideal Filters. - 6.4 Design of Oceanographic Filters. - 6.5 Running-Mean Filters. - 6.6 Godin-Type Filters. - 6.7 Lanczos-window Cosine Filters. - 6.8 Butterworth Filters. - 6.9 Kaiser-Bessel Filters. - 6.10 Frequency-Domain (Transform) Filtering. - References. - Appendix A: Units in Physical Oceanography. - Appendix B: Glossary of Statistical Terminology. - Appendix C: Means, Variances and Moment,Generating Functions for Some Common Continuous Variables. - Appendix D: Statistical Tables. - Appendix E: Correlation Coefficients at the 5% and 1% Levels of Significance for Various Degrees of Freedom v. - Appendix F: Approximations and Nondimensional Numbers in Physical Oceanography. - Appendix G: Convolution. - Index.

Note: lndice: Prólogo The Circumpolar Active Layer Monitoring Network - CALM III (2009-2014): Long-term Observations on the Climate-Active Layer-Permafrost System, / Frederick E. Nelson and Nikolay l. Shiklomanov Red de Monitoreo Circumpolar de la Capa Activa - CALM III (2009-2014): Observaciones de Largo Plazo del Sistema "Clima-Capa Activa-Permafrost" / Frederick E. Nelson y Nikolay l. Shiklomanov Colaboração Ibérica no Estudo do Estado Térmico do Permafrost nas ilhas Shetlands do Sul (Antárctica Marítima). Estado actual e perspectivas / Gonçalo Vieira Monitorización dinámica y control térmico en geoformas solifluidales del piso crionival de Sierra Nevada / M. Oliva y A. Gómez Ortiz Inestabilidad de laderas durante el Holoceno en el piso periglaciar actual de Sierra Nevada / M. Oliva y A. Gómez Ortiz Evolución reciente y dinámica actual del helero del Jou Negro (Picos de Europa). Primera aproximación / E. Serrano, M. Del Río, J. J. San José, J. J. González Trueba, A. Atkinson, A. Fernández y R. Martín Factores geomorfológicos y nivometeorológicos condicionantes de aludes en el circo de Musales (Pirineo central aragonés): el evento de abril de 2008 / J. Chueca, A. Julián, M. Palomo, E. Muntán, P. Oller, M. Barriendos y E. Gutiérrez Caracterización térmica del suelo en el circo del Aneto (Pirineo central aragonés): cartografía de variaciones estacionales / J. Chueca y A. Julián Comportamiento térmico del suelo en un enclave de alta montaña mediterránea con permafrost residual: Corral del Veleta (Sierra Nevada, Granada, España) / F. Salvador-Franch, A. Gómez-Ortiz y D. Palacios-Estremera Cubierta nival y temperaturas de superficie en Sierra Nevada a través del tratamiento digital de imágenes LANDSAT 7 (avance preliminar: periodo 2007-2008) / Benedita A. Milheiro Santos, Antonio Gómez Ortiz, Montserrat Salvá Catarineu y Ferran Salvador Franch Estado térmico del permafrost en el monte Reina Sofía, primer año de registro continuo. Isla Livingston (Antártida") / M. Ramos, G. Vieira, S. Gruber, MA. de Pablo y A. Correia Nuevas estaciones de medida del régimen térmico del permafrost en el área de "Crater Lake". Isla Decepción (Antártida). Resultados preliminares / M. Ramos, G. Vieira, D. Guilichinski, M. A. de Pablo Distribuição Espacial das Formas e Processos Periglaciários da Área de Cerro Caliente - Crater Lake (ilha Deception, Antárctida Marítima) / R. Melo, G. Vieira, A. Caselli, V. Batista, M. Ramos ERA-Interim torced H-TESSEL scheme for modeling ground temperatures for Livingston lsland (South Shetlands, Antarctic Península), M.J. Rocha, E. Dutra, R. Tomé, G. Vieira, P. Miranda, M. Fragoso, M. Ramos Resultados preliminares de urna campanha de prospecçáo geoeléctrica realizada na llha de Livingston junto a Base Antárctica Búlgara / A. Correia, G. Vieira, M. Ramos Condutividade térmica de testemunhos obtidos em duas perfurações realizadas na ilha de Livingston (Antárctida Marítima). Resultados preliminares / P. M. Amaral, A. Correia, G. Vieira, M. Ramos, A. Trindade Determinación de la difusividad térmica en suelos helados en la Isla Livingston / Juan Jose Blanco, Miguel Angel Hidalgo, Miguel Ramos y GonÇalo Vieira Un nuevo emplazamiento CALMS en la Península Bayers, Isla Livingston, Antártida = A new CALM-S site on Byers península, Livingston island, Antarctica / M. A. de Pablo, M. Ramos, G. Vieira, A. Quesada O efeito da neve no regime térmico do solo na área da Base Antárctica Búlgara St. Kliment Ohridski, llha Livingston, Antárctida / A. Trindade, G. Vieira, M. Ramos, C. Pimpirev, R. Kenderova Detecção da cobertura de neve na ilha Livingston (Antárctida marítima) com imagens de satélite ASAR. Resultados preliminares / C. Mora, G. Vieira, M. Ramos Ensayos de campo del sensor GTS-REMS en la Antártida. Resultados y optimización. / B. Esteban, M. Ramos, E. Sebastián, C. Armiens, M. A. De Pablo y W. Cabos ldentification and characterization of polygonal networks on the Martian boreal plain, / J. Saraiva, L. Bandeira, N. Benavente, P. Pina Studying Martian permafrost from surface temperature data of Mini-TES, Spirit MER mission / A. Molina, M. A. de Pablo, M. Ramos

Note: Content Foreword Preface 1 – The PERMAFrance network 1.1 – Objectives 1.2 – Structure and partners 1.3 – Monitoring sites 2 – Permafrost in the French mountains 2.1 – Distribution of permafrost in France 2.2 – Monitoring sites 3 – Weather and climate 3.1 – Climatic trends of the last 4 decades 3.2 – Annual weather summary 2002-2009 3.3 – Summary of nivo-meteorological conditions 4 – Surface temperature on surficial deposits 4.1 – BTS datasets 4.2 – GST datasets 5 – Geodetic measurements and surface dynamics of rock glaciers 5.1 – GPS & total station 5.2 – LIDAR 6 – Rockfalls and evolution of rockfaces 6.1 – LiDAR datasets for rockwalls in the Mont Blanc massif 6.2 – Rockfall inventories in the Mont Blanc massif 7 – References / Bibliographie , In englischer und französischer Sprache

Note: Contents: Preface: Asset Management ; Part I: The Asset Owner ; Chapter 1: Asset Owners ; Chapter 2: Preferences ; Chapter 3: Mean-Variance Investing ; Chapter 4: Investing for the Long Run ; Chapter 5: Investing Over the Life Cycle ; Part II: Factor Risk Premiums ; Chapter 6: Factor Theory ; Chapter 7: Factors ; Chapter 8: Equities ; Chapter 9: Bonds ; Chapter 10: Alpha (and the Low Risk Anomaly) ; Chapter 11: "Real " Assets ; Chapter 12: Tax-Efficient Investing ; Chapter 13: Illiquid Assets ; Chapter 14: Factor Investing ; Part III: Delegated Portfolio Management ; Chapter 15: Delegated Investing ; Chapter 16: Mutual Funds and Other 40-Act Funds ; Chapter 17: Hedge Funds ; Chapter 18: Private Equity ; Afterword: Factor Management ; Appendix: Returns ; Acknowledgements ; Bibliography ; Index

Note: Includes bibliographical references and index

Note: Zugleich: Dissertation, Christian-Albrechts-Universität zu Kiel, 1999 , INHALTSVERZEICHNIS 1. Einleitung 1.1 Kenntnisstand und offene Fragen 1.2 Fragestellung und Ziele dieser Arbeit 2. Umweltbedingungen in den Arbeitsgebieten 2.1 Hydrographie, Eisverhältnisse und NAO 2.2 Zur Variation von Wassertiefe und Breite der Dänemarkstraße und zur Vereisung Islands während des letzten Glazials 3. Methoden 3.1 Auswahl der Kernstationen 3.2 Probennahme und Analysen (Übersicht) 3.3 Zur Rekonstruktion von Paläobedingungen im Oberflächenwasser Zur Aussage stabiler Isotopenverhältnisse in planktischen Foraminiferen Zur Messung stabiler Isotopenverhältnisse Zur Massenspektrometrie Zur Rekonstruktion von Oberflächentemperaturen Alkane und Alkohole als Maß für Staubeintrag Eistranspmtiertes Material und vulkanische Aschen 3.4 Zur Rekonstruktion von Paläobedingungen im Zwischen-/ Tiefenwasser Häufigkeit von Cibicides- und anderen benthischen Arten (inkl. Taxonomie) Stabile Isotopenverhältnisse in benthischen Foraminiferen 3.5 AMS 14C-Datierungen Probenreinigung 3. 6 Hauptelementanalysen von vulkanischen Asche-Leithorizonten 3. 7 Geomagnetische Meßgrößen und magnetische Suszeptibiltät 3.8 Techniken zur Spektralanalyse 4. Methodische Ergebnisse 4.1 Zum Einfluß der Probenreinigung auf δ18O-/ δ13C-Werte 4.2 Probleme bei der langfristigen Reproduzierbarkeit von δ18O-Zeitreihen 4.3 Einfluß der Korngröße und Artendefinition planktischer Foraminiferen auf SST-Rekonstruktionen in hohen Breiten 4.4 Vergleich der stabilen Isotopenwerte von Cibicides lobatulus und Cibicidoides wuellerstorfi 5. Stratigraphische Grundlagen und Tiefenprofile der Klimasignale 5.1 Stratigraphische Korrelation zwischen parallel-gekernten GKG- und SL-/KL-Profilen 5.2 Flanktische δ18O-/ δ13C-Kurven, 14C-Alter und biostratigraphische Fixpunkte Westliches Islandbecken Kern PS2644 Kern PS2646 Kern PS2647 Kern 23351 Vøring-Plateau Kern 23071 Kern 23074 5.3 Benthische δ18O-/ δ13C-Werte in Kern PS2644 5.4 Siliziklastische Sedimentkomponenten: Eistransportiertes Material Westliches Islandbecken Kern PS2644 Kern PS2646 Kern PS2647 Vøring-Plateau Kern 23071 Kern 23074 5.5 Vulkanische Glasscherben in Kern PS2644: Wind- und Eiseintrag 5.6 Geochemie und Alter einzelner Tephralagen als Leithorizonte Westliches Islandbecken Kern PS2644 Kern PS2646 Kern PS2647 Vøring-Plateau Kern 23071 Kern 23074 5.7 Magnetische Suszeptibilität in den Kernen PS2644, PS2646 und PS2647 Kern PS2644 Kern PS2646 und PS2647 5.8 Geomagnetische Feldintensität und Richtungsänderungen in Kern PS2644 5.9 Variation von Planktonfauna und -flora Westliches Islandbecken: Kern PS2644 Kern PS2646 und PS2647 Vøring-Plateau: Kern 23071 und 23074 5.10 Benthische Foraminiferen in Kern PS2644 6. Entwicklung von Temperatur und Salzgehalt nördlich der Dänemark-Straße 6.1 Variation der Oberflächentemperatur nach Planktonforaminiferen 6.2 Variation der Oberflächentemperatur nach Uk37 6.3 Variation der Oberflächensalinität 7. Die Feinstratigraphie von Kern PS2644 als Basis für eine Eichung der 14C-Altersskala 22 - 55 ka 7.1 Korrelation zwischen den Klimasignalen in Kern PS2644 und der GISP2-Klimakurve zum Kalibrieren der 14C-Alter und Erstellen eines Altersmodells Tephrachronologische Marker Korrelationsparameter und -regeln Sonderfälle/ Probleme bei der Korrelation 7.2 Alters-stratigraphische Korrelation der Klimakurven von Kern 23071 und 23074 7.3 Variation der Altersanomalien zwischen 20 und 55 14C-ka 7.4 Variabilität des planktischen 14C-Reservoiralters in Schmelzwasserbeeinflußten Seegebieten Variation der planktischen 14C-Alter unmittelbar an der Basis von Heinrich-Ereignis 4 Unterschiede zwischen planktischen und benthischen 14C-Altern in der westlichen Islandsee. Zur Erklärung der inversen Altersdifferenzen 7.5 Differenz zwischen 14C- und Kalenderalter: Zeitliche Variation unter Einfluß des Erdmagnetfeldes - Modell und Befund 7.6 Sedimentationsraten der Kerne 23071, 23074 und PS2644 nach dem GISP2-Altersmodell Vøring-Plateau: Kerne 23071 und 23074 Südwest-Islandsee: Kern PS2644 8. Klimaoszillationen im Europäischen Nordmeer in der Zeit und Frequenzdomäne 8.1 "Der Einzelzyklus" in den Klimakurven von Kern PS2644 8.2 Zur Veränderlichkeit der Warm- und Kaltextreme sowie Zyklenlänge Besonderheiten in der Zyklenlänge Variation der Kalt-(Stadiale) Variation der Interstadiale 8.3 Periodizitäten der Klimasignale im Frequenzband der D.-Oe.-Zyklen. Der D.-Oe.-Zyklus von 1470 J., seine Multiplen und harmonischen Schwingungen Weitere Frequenzen: 1000-1150 Jahre- und 490- 510 Jahre-Zyklizitäten Höhere Frequenzen im Bereich von Jahrhunderten und Dekaden 8.4 Phasenbeziehungen und (örtliche) Steuemngsmechanismen der Dansgaard-Oeschger-Zyklen 9. Schlußfolgerungen Danksagung Literaturverzeichnis Anhang

Note: 1. Experiment, Scheitern und Resilienz 2. Georg Simmel und die Beobachtung der Natur 3. Objektive Kultur und die Entwicklung des Nichtwissens 4. Kollektive Experimente in Natur und Gesellschaft 5. Unberechenbare Umwelt 6. Landschaftsdesign als experimenteller Lehrpfad: die Entwicklung postindustrieller Regionen 7. Vor der Hacke bleibt es duster: experimentelles Nichtwissen und die Sanierung kontaminierter Landschaften 8. Reise zur Hitze der Erde: Geothermie und nachhaltige Energiegewinnung Zu viel Resilienz Hindernisse auf dem Weg in die experimentelle Gesellschaft Literatur NachweiseBackmatter..

Note: In English

Note: Zugleich: Dissertation, Freie Unversität Berlin, [ca. 1963] , INHALTSVERZEICHNIS PROBLEMSTELLUNG UND ZIELSETZUNG 1. BEMERKUNGEN ZUM BEOBACHTUNGSGELÄNDE UND ZUM BEOBACHTUNGSMATERIAL 1.1 Das Beobachtungsgelände 1.2 Das Beobachtungsmaterial 2. HOMOGENITÄTSBETRACHTUNGEN 2.1 Temperatur 2.2 Niederschlag 2.3 Wind 2.4 Sonnenschein und Bewölkung 3. TEMPERATURVERHÄLTNISSE 3.1 Monats- und Jahreswerte 3.2 Tageswerte 3.3 Pentadenwerte 3.4 Häufigkeitsbetrachtungen 3.5 Interdiurne Veränderlichkeit 3.6 Der tägliche Gang 3.7 Vorkommen bestimmter Schwellenwerte 3.71 Frost- und Eistage 3.72 Sommer- und Tropentage 4. DER WASSERGEHALT DER LUFT 4.1 Monats- und Jahreswerte 4.2 Tageswerte 4.3 Häufigkeitsbetrachtungen 4.4 Interdiurne Veränderlichkeit 4.5 Der tägliche Gang 5. BEWÖLKUNGSVERHÄLTNISSE 5.1 Monats- und Jahreswerte 5.2 Tageswerte 5.3 Häufigkeitsbetrachtungen 5.4 Der tägliche Gang 5.5 Heitere und trübe Tage 5.6 Nebel 6. SONNENSCHEIN 6.1 Monats- und Jahreswerte 6.2 Tageswerte 6.3 Der tägliche Gang 7. NIEDERSCHLAGSVERHÄLTNISSE 7.1 Monats- und Jahreswerte 7.2 Niederschlagsbereitschaft 7.3 Tageswerte 7.4 Der tägliche Gang 7.5 Häufigkeitsbetrachtungen 7.6 Niederschlags- und Trockenperioden 7.7 Niederschlag und Wind· 7.8 Schneeverhältnisse 7.81 Schneefall und Schneedecke 7.82 Schneehöhe 7.9 Gewitter 8. WINDVERHÄLTNISSE 8.1 Windrichtung 8.2 Windgeschwindigkeit 8.21 Der jährliche Gang 8.22 Häufigkeitsbetrachtungen 8.23 Sturmtage und Windstillen 8.24 Der tägliche Gang 9.ZUSAMMENFASSUNG VERZEICHNIS DER TEXTTABELLEN VERZEICHNIS DER ABBILDUNGEN LITERATURVERZEICHNIS TABELLENANHANG

Note: A theory of private authorityAgents of the state : a century of delegation in international environmental lawGovernors of the market : the evolution of entrepreneurial authorityAtmospheric police : delegated authority in the clean development mechanismAtmospheric accountants : entrepreneurial authority and the greenhouse gas protocol..

Note: Contents: Preface. - 1. Introduction. - 1.1. Relations among Thermodynamics, Kinetics, and Cloud Microphysics. - 1.2. The Correspondence Principle. - 1.3. Structure of the Book. - 2. Clouds and Their Properties. - 2.1. Cloud Classification. - 2.2. Cloud Regimes and Global Cloud Distribution. - 2.2.1. Large-Scale Condensation in Fronts and Cyclones. - 2.2.2. Sc-St Clouds and Types of Cloud-Topped Boundary Layer. - 2.2.3. Convective Cloudiness in the Intertropical Convergence Zone. - 2.2.4. Orographic Cloudiness. - 2.3. Cloud Microphysical Properties. - 2.4. Size Spectra and Moments. - 2.4.1. Inverse Power Laws. - 2.4.2. Lognormal Distributions. - 2.4.3. Algebraic Distributions. - 2.4.4. Gamma Distributions. - 2.5. Cloud Optical Properties. - Appendix A.2. Evaluation of the Integrals with Lognormal Distribution. - 3. Thermodynamic Relations. - 3.1. Thermodynamic Potentials. - 3.2. Statistical Energy Distributions. - 3.2.1. The Gibbs Distribution. - 3.2.2. The Maxwell Distribution. - 3.2.3. The Boltzmann Distribution. - 3.2.4. Bose–Einstein Statistics. - 3.2.5. Fermi–Dirac Statistics. - 3.3. Phase Rules. - 3.3.1. Bulk Phases. - 3.3.2. Systems with Curved Interfaces. - 3.4. Free Energy and Equations of State. - 3.4.1. An Ideal Gas. - 3.4.2. Free Energy and the van der Waals Equation of State for a Non-Ideal Gas. - 3.5. Thermodynamics of Solutions. - 3.6. General Phase Equilibrium Equation for Solutions. - 3.6.1. General Equilibrium Equation. - 3.6.2. The Gibbs–Duhem Relation. - 3.7. The Clausius–Clapeyron Equation. - 3.7.1. Equilibrium between Liquid and Ice Bulk Phases. - 3.7.2. Equilibrium of a Pure Water Drop with Saturated Vapor. - 3.7.3. Equilibrium of an Ice Crystal with Saturated Vapor. - 3.7.4. Humidity Variables. - 3.8. Phase Equilibrium for a Curved Interface - The Kelvin Equation. - 3.9. Solution Effects and the Köhler Equation. - 3.10. Thermodynamic Properties of Gas Mixtures and Solutions. - 3.10.1. Partial Gas Pressures in a Mixture of Gases. - 3.10.2. Equilibrium of Two Bulk Phases around a Phase Transition Point. - 3.10.3. Raoult’s Law for Solutions. - 3.10.4. Freezing Point Depression and Boiling Point Elevation. - 3.10.5. Relation of Water Activity and Freezing Point Depression. - 3.11. A diabatic Processes. - 3.11.1. Dry Adiabatic Processes. - 3.11.2. Wet Adiabatic Processes. - Appendix A.3. Calculation of Integrals with the Maxwell Distribution. - 4. Properties of Water and Aqueous Solutions. - 4.1. Properties of Water at Low Temperatures and High Pressures. - 4.1.1. Forms of Water at Low Temperatures. - 4.1.2. Forms of Water at High Pressures. - 4.2. Theories of Water. - 4.3. Temperature Ranges in Clouds and Equivalence of Pressure and Solution Effects. - 4.4. Parameterizations of Water and Ice Thermodynamic Properties. - 4.4.1. Saturated Vapor Pressures. - 4.4.2. Heat Capacity of Water and Ice. - 4.4.3. Latent Heats of Phase Transitions. - 4.4.4. Surface Tension between Water and Air or Vapor. - 4.4.5. Surface Tension between Ice and Water or Solutions. - 4.4.6. Surface Tension between Ice and Air or Vapor. - 4.4.7 Density of Water. - 4.4.8. Density of Ice. - 4.5. Heat Capacity and Einstein-Debye Thermodynamic Equations of State for Ice. - 4.6. Equations of State for Ice in Terms of Gibbs Free Energy. - 4.7. Generalized Equations of State for Fluid Water. - 4.7.1. Equations of the van der Waals Type and in Terms of Helmholtz Free Energy. - 4.7.2. Equations of State Based on the Concept of the Second Critical Point. - Appendix A.4. Relations among Various Pressure Units. - 5. Diffusion and Coagulation Growth of Drops and Crystals. - 5.1. Diffusional Growth of Individual Drops. - 5.1.1. Diffusional Growth Regime. - 5.1.2. The Kinetic Regime and Kinetic Corrections to the Growth Rate. - 5.1.3. Psychrometric Correction Due to Latent Heat Release. - 5.1.4. Radius Growth Rate. - 5.1.5. Ventilation Corrections. - 5.2. Diffusional Growth of Crystals. - 5.2.1. Mass Growth Rates. - 5.2.2. Axial Growth Rates. - 5.2.3. Ventilation Corrections. - 5.3. Equations for Water and Ice Supersaturations. - 5.3.1. General Form of Equations for Fractional Water Supersaturation. - 5.3.2. Supersaturation Relaxation Times and Their Limits. - 5.3.3. E quation for Water Supersaturation in Terms of Relaxation Times. - 5.3.4. Equivalence of Various Forms of Supersaturation Equations. - 5.3.5. Equation for Fractional Ice Supersaturation. - 5.3.6. Equilibrium Supersaturations over Water and Ice. - Liquid Clouds. - Ice Clouds. - Mixed Phase Clouds. - 5.3.7. A diabatic Lapse Rates with Non zero Supersaturations. - 5.4. The Wegener–Bergeron–Findeisen Process and Cloud Crystallization. - 5.5. Kinetic Equations of Condensation and Deposition in the Adiabatic Process. - 5.5.1. Derivation of the Kinetic Equations. - 5.5.2. Some Properties of Regular Condensation. - 5.5.3. Analytical Solution of the Kinetic Equations of Regular Condensation. - 5.5.4. Equation for the Integral Supersaturation. - 5.6. Kinetic Equations of Coagulation. - 5.6.1. Various Forms of the Coagulation Equation. - 5.6.2. Collection Kernels for Various Coagulation Processes. - Brownian Coagulation. - Gravitational Coagulation. - 5.7. Thermodynamic and Kinetic Equations for Multidimensional Models. - 5.8. Fast Algorithms for Microphysics Modules in Multidimensional Models. - 6. Wet Aerosol Processes. - 6.1. Introduction. - 6.1.1. Empirical Parameterizations of Hygroscopic Growth. - 6.1.2. Empirical Parameterizations of Droplet Activation. - 6.2. Equilibrium Radii. - 6.2.1. Equilibrium Radii at Subsaturation. - 6.2.2. Equilibrium Radii of Interstitial Aerosol in a Cloud. - 6.3. Critical Radius and Supersaturation. - 6.4. Aerosol Size Spectra. - 6.4.1. Lognormal and Inverse Power Law Size Spectra. - 6.4.2. Approximation of the Lognormal Size Spectra by the Inverse Power Law. - 6.4.3. Examples of the Lognormal Size Spectra, Inverse Power Law, and Power Indices. - 6.4.4. Algebraic Approximation of the Lognormal Distribution. - 6.5. Transformation of the Size Spectra of Wet Aerosol at Varying Humidity. - 6.5.1. Arbitrary Initial Spectrum of Dry Aerosol. - 6.5.2. Lognormal Initial Spectrum of Dry Aerosol. - 6.5.3. Inverse Power Law Spectrum. - 6.5.4. Algebraic Size Spectra. - 6.6. CCN Differential Supersaturation Activity Spectrum. - 6.6.1. A rbitrary Dry Aerosol Size Spectrum. - 6.6.2. Lognormal Activity Spectrum. - 6.6.3. Algebraic Activity Spectrum. - 6.7. Droplet Concentration and the Modified Power Law for Drops Activation. - 6.7.1. Lognormal and Algebraic CCN Spectra. - 6.7.2. Modified Power Law for the Drop Concentration. - 6.7.3. Supersaturation Dependence of Power Law Parameters. - Appendix A.6. Solutions of Cubic Equations for Equilibrium and Critical Radii. - 7. Activation of Cloud Condensation Nuclei into Cloud Drops. - 7.1. Introduction. - 7.2. Integral Supersaturation in Liquid Clouds with Drop Activation. - 7.3. Analytical Solutions to the Supersaturation Equation. - 7.4. Analytical Solutions for the Activation Time, Maximum Supersaturation, and Drop Concentration. - 7.5. Calculations of CCN Activation Kinetics. - 7.6. Four Analytical Limits of Solution. - 7.7. Limit #1: Small Vertical Velocity, Diffusional Growth Regime. - 7.7.1. Lower Bound. - 7.7.2. Upper Bound. - 7.7.3. Comparison with Twomey’s Power Law. - 7.8. Limit #2: Small Vertical Velocity, Kinetic Growth Regime. - 7.8.1. Lower Bound. - 7.8.2. Upper Bound. - 7.9. Limit #3: Large Vertical Velocity, Diffusional Growth Regime. - 7.9.1. Lower Bound. - 7.9.2. Upper Bound. - 7.10. Limit #4: Large Vertical Velocity, Kinetic Growth Regime. - 7.10.1. Lower Bound. - 7.10.2. Upper Bound. - 7.11. Interpolation Equations and Comparison with Exact Solutions. - Appendix A.7. Evaluation of the Integrals J2 and J3 for Four Limiting Cases. - 8. Homogeneous Nucleation. - 8.1. Metastable States and Nucleation of a New Phase. - 8.2. Nucleation Rates for Condensation and Deposition. - 8.2.1. Application of Boltzmann Statistics. - 8.2.2. The Fokker–Planck

Note: Machine generated contents note:1. Introduction2. The Investible Agricultural Space3. Climate Change and Agriculture4. Agricultural Risk Management & Insurance5. Biofuels and Agriculture5b. Biofuels and the Sustainability Conundrum6. Financing the Agricultural Firm7. Farmland as an Investible Asset Class7b. Farmland7c. Land Expectation Value and Timberland Valuation8. Advanced Technologies and Agriculture9. Challenges in Agricultural Production and Natural Resources Management10. Sustainability of Agricultural Productivity Growth11. Commodity Derivative Markets11b. Trading Agricultural Commodities11c. Speculation on (Agricultural) Commodity Markets & Financialization of Commodity Price Formation12. The Global Water Challenge13. Future Agricultural Dynamics..

Note: Deducing typesauto -- Moving to Modern C++ -- Smart pointers -- Rvalue references, move semantics, and perfect forwarding -- Lambda expressions -- The concurrency API -- Tweaks..

Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System

Note: Text dt. und engl. - Text in Faltbl. [1] dt.

Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.

Note: Zugl.: Hamburg, Univ., FB Rechtswiss., Diss., 2013

Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; PART I. THE COMPLEXITY FRAME FOR POLICY; Chapter 1. Twin Peaks; Chapter 2. Government With, Not Versus, the Market; Chapter 3. I Pencil Revisited: Beyond Market Fundamentalism; Chapter 4. The Complexity Policy Frame; PART II. EXPLORING THE FOUNDATIONS; Chapter 5. How Economics Lost the Complexity Vision; Chapter 6. How Macroeconomics Lost the Complexity Vision; Chapter 7. Complexity: A New Kind of Science?; Chapter 8: A New Kind of Complexity Economics?; Chapter 9. Nudging toward a Complexity Policy Frame. , PART III. LAISSEZ-FAIRE ACTIVISM IN PRACTICEChapter 10. The Economics of Influence; Chapter 11. Implementing Influence Policy; Chapter 12. Laissez-Faire Activism; Chapter 13. Getting the Ecostructure of Government Right; PART IV. THE LOST AGENDA; Chapter 14. Getting the Ecostructure of Social Science Education Right; Chapter 15. The Lost Agenda; Notes; Bibliography; Index.

Note: Sovereignty as an institution of international society / Matthew S. WeinertWestphalian sovereignty and realism in contemporary international security / Robert W. Murray -- International institutions and state sovereignty : frozen in time or warming to change / Tom Keating -- Ecological sovereignty and Arctic politics / Guy-Serge Côté and Matthew Paterson -- Canadian Arctic security : shifting challenges / Rob Huebert -- U.S. Arctic policy : reproducing hegemony in a maritime region / Philip E. Steinberg -- Russia's Arctic policy : continuity and changes / Gleb Yarovoy -- Norway's high Arctic policy / Geir Hønneland -- Territory, security and sovereignty : the kingdom of Denmark's Arctic strategy / Mark Nuttall -- Sweden and Arctic policy : possibilities for new wine in old bottles? / E. Carina H. Keskitalo -- Finland as an Arctic and European state : Finland's northern dimension (policy) / Lassi Heininen -- Iceland : a state within the Arctic / Alyson JK Bailes and Margrét Cela -- The Arctic and the European Union / Clive Archer -- The United Nations on Arctic issues / W. Andy Knight -- The future of the Arctic Council : navigating between sovereignty and security / Timo Koivurova and Piotr Graczyk -- International law and the Arctic : how territoriality, human rights and the environment can shape sovereignty / Betsy Baker -- Arctic oil, Inuit resource governance and the Arctic Council / Jessica M. Shadian -- A work in progress : the United Kingdom and the Arctic region / Klaus Dodds -- Emerging interests of non-Arctic countries in the Arctic : China, Japan, South Korea and India / Nong Hong & Anita Dey Nuttall -- Sovereignty, security and international cooperation : significance of the Antarctic experience for the Arctic / Anita Dey Nuttall..

Note: Cover; Contents; Preface and Overview; Acknowledgments; Introduction to the 2014 Edition; 1. The Distinctiveness of Comparative Social Science; 2. Heterogeneity and Causal Complexity; 3. Case-Oriented Comparative Methods; 4. The Variable-Oriented Approach; 5. Combined Versus Synthetic Comparative Strategies; 6. A Boolean Approach to Qualitative Comparison: Basic Concepts; 7. Extensions of Boolean Methods of Qualitative Comparison; 8. Applications of Boolean Methods of Qualitative Comparison; 9. The Dialogue of Ideas and Evidence in Social Research; Bibliography; Index.

Note: Introduction -- A brief detour: 10 reasons why politicians fail to represent us (and always will) -- Delegation and irreflection: the twin roots of failed political representation -- #1 Discovering citizen deliberation in the Pacific Northwest -- #2 Voting like the Irish while campaigning like the French -- #3 Keeping a tight grip: the Swiss-Oregonian lock -- #4 Learning from the British tabloid press -- #5 Recovering our distance vision in Saint Petersburg -- Conclusion -- Postscript.

Note: Text dt. und engl.

Note: Contents: 1. Introduction: The Climate Change Problem and Solutions Part 1: Theory 2. The Basis of an Obligation Towards Future Generations in Justice and Ethics in the Context of Climate Change 3. Content of Justice-based Obligations Towards Future Generations in the Context of Climate Change Part II: International Law and Politics 4. Current International Law, Intergenerational Justice and Climate Change 5. International Human Rights Law, Intergenerational Justice and Climate Change 6. Climate Change Discources and Intergenerational Justice Part III: The Way Forward and Conclusion 7. The Way Forward – Incorporating Intergenerational Justice Principles into International Climate Law 8. Conclusion Bibliography Index