ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • 2015-2019  (22)
  • 2010-2014  (1,827,662)
  • 2005-2009  (26)
  • 1995-1999  (16)
  • 2014  (737,106)
  • 2012  (653,335)
  • 2010  (437,266)
Collection
Language
Years
Year
  • 1
    Monograph available for loan
    Monograph available for loan
    Novato, Calif. :New World Library,
    Call number: IASS 16.90550
    Type of Medium: Monograph available for loan
    Pages: xiv, 272 p. : , ill. ; , 22 cm.
    ISBN: 9781577319726 (pbk. : alk. paper)
    Language: English
    Note: Three stories of our time -- Trusting the spiral -- Coming from gratitude -- Honoring our pain for the world -- A wider sense of self -- A different kind of power -- A richer experience of community -- A larger view of time -- Catching an inspiring vision -- Daring to believe it is possible -- Building support around you -- Maintaining energy and enthusiasm -- Strengthened by uncertainty.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    Monograph available for loan
    Monograph available for loan
    Cambridge [u.a.] : Cambridge Univ. Press
    Call number: PIK N 106-16-89934
    Type of Medium: Monograph available for loan
    Pages: XV, 488 S. , Ill., graph. Darst.
    ISBN: 9780521851039 (hbk.)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
    Monograph available for loan
    Cambridge : Cambridge Univ. Press
    Call number: 13/M 16.89930
    Description / Table of Contents: Understanding sea-level processes, such as ocean tides, storm surges, tsunamis, El Niño and rises caused by climate change, is key to planning effective coastal defence. Building on David Pugh's classic book Tides, Surges and Mean Sea-Level, this substantially expanded, full-colour book now incorporates major recent technological advances in the areas of satellite altimetry and other geodetic techniques (particularly GPS), tsunami science, measurement of mean sea level and analyses of extreme sea levels. The authors discuss how each surveying and measuring technique complements others in providing an understanding of present-day sea-level change and more reliable forecasts of future changes. Giving the how and the why of sea-level change on timescales from hours to centuries, this authoritative and exciting book is ideal for graduate students and researchers in oceanography, marine engineering, geodesy, marine geology, marine biology and climatology. It will also be of key interest to coastal engineers and governmental policy-makers.
    Type of Medium: Monograph available for loan
    Pages: XII, 395 S. , Ill., graph. Darst., Kt.
    Edition: 2nd ed.
    ISBN: 1107028191 , 9781107028197
    URL: Cover
    Language: English
    Note: 1. Introduction; 2. Observations and data reduction; 3. Tidal forces; 4. Tidal analysis and prediction; 5. Tidal dynamics; 6. Shallow water and coastal tides; 7. Storm surges, meteotsunamis and other meteorological effects on sea level; 8. Tsunamis; 9. Sea-level changes in space; 10. Mean sea-level changes in time; 11. Sea-level changes in time to do with the solid Earth; 12. Sea-level applications; 13. Sea level and life; Appendix A. The basic hydrostatic and hydrodynamic equations; Appendix B. Currents; Appendix C. High and low water times and heights; Appendix D. Theoretical tidal dynamics; Appendix E. Legal definitions in the coastal zone; Glossary; References; Index..
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 4
    Call number: 2/M 16.89938
    Type of Medium: Monograph available for loan
    Pages: 157 S. , Ill., graph Darst.
    ISBN: 9783868560107
    Series Statement: Edition Wissenschaftsmanagement
    Classification:
    E.7.
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    Call number: IASS 16.90624
    Description / Table of Contents: "Analyses of the significance of knowledge in present day society, also referred to as knowledge society, fuelled our curiosity about the role that experts play in international and European decision-making processes. This interest prompted us to ask the question reflected in the title of this book: are experts in these decision-making processes advisors, decisio"--
    Description / Table of Contents: "Experts are increasingly relied on in decision-making processes at international and European levels. Their involvement in those processes, however, is contested. This timely book on the role of 'experts' provides a broad-gauged analysis of the issues raised by their involvement in decision-making processes. The chapters explore three main recurring themes: the rationales for involving experts and ensuing legitimacy problems; the individual and collective dimensions of expert involvement in decision making; and experts and politics and the politics of expertise. With contributions from leading scholars and practitioners, they theorize the experts' involvement in general and address their role in the policy areas of environment, trade, human rights, migration, financial regulation, and agencification in the European Union"--
    Type of Medium: Monograph available for loan
    Pages: XI, 416 S.
    ISBN: 1107074789 (hardback) , 9781107074781 (hardback)
    URL: Cover
    Language: English
    Note: Machine generated contents note: 1. The role of experts in international and European decision-making processes: setting the scene Monika Ambrus, Karin Arts, Ellen Hey and Helena Raulus; Part I. Theorizing Expert Involvement in International and European Decision-Making: 2. Ideas, experts and governance Peter M. Haas; 3. The politics of expertise: applying paradoxes of scientific expertise to international law Wouter G. Werner; 4. Reflections on the different roles of expertise in regulatory policy-making Lorna Schrefler; 5. The virtues of expertise Jan Klabbers; Part II. Expert Involvement in International Decision-Making in the Environmental Sphere: 6. The role of scientific expertise in multilateral environmental agreements: influence and effectiveness Steinar Andresen; 7. Changing demands at the science-policy interface: organisational learning in the IPCC Bernd Siebenhüner; 8. Global scientific assessments and environmental resource governance: towards a science-policy interface ladder Joyeeta Gupta; Part III. Experts in the WTO and Risk Regulation: 9. The structural logic of expert participation in WTO decision-making processes Jessica Lawrence; 10. Health risks, experts and decision making within the SPS Agreement and the Codex Alimentarius Alexia Herwig; 11. The role of experts in environmental and health-related trade disputes in the WTO: deconstructing decision-making processes Lukasz Gruszczynski; Part IV. Experts in Human Rights Related Decision-Making Processes: 12. Human rights experts in the United Nations: a review of the role of UN special procedures Surya P. Subedi; 13. 'Experts': the mantra of irregular migration and the reproduction of hierarchies Jeff Handmaker and Claudia Mora; 14. Private carriers as experts in immigration control Sophie Scholten and Ashley Terlouw; Part V. Experts in Decision-Making Processes of the European Union: 15. The European system of financial supervision: a technology of expertise Michelle Everson; 16. The role of experts and financial supervision in the European Union: the de Larosière Commission Karim Knio; 17. Expertise at the crossroads of national and international policy-making: a public management perspective Adriaan Schout and Jaap Sleifer; 18. Blurred areas of responsibility: European agencies' scientific 'opinions' under scrutiny E. Madalina Busuioc..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    Monograph available for loan
    Monograph available for loan
    New York, NY : Springer
    Call number: PIK N 531-16-90092
    Description / Table of Contents: Ecotones are dynamic over-lapping boundary areas where major terrestrial biomes meet.  As past studies have shown, and as the chapters in this book will illustrate, their structure, size, and scope have changed considerably over the millennia, expanding and shrinking as climate and/or other driving conditions, also changed.  Today, however, many of them are changing at a rate not seen for a long time, perhaps largely due to climate change and other human-induced factors.  Indeed ecotones are more sensitive to climate change than the biomes on either side, and thus may serve as critical early indicators of future climate change.  As ecotones change, they also redefine the limits of the biomes on either side by altering their distributions of species because, in addition to their own endemic species, any ecotone will also have species from both adjoining biomes.  Consequently, they may also be places of high levels of species interaction, serving as active evolutionary laboratories, which generate new species that then migrate back into adjacent biomes.Ecotones Between Forest and Grassland explores how these ecotones have changed in the past, how they are changing today, and how they are likely to change in the future. The book includes chapters from around the world with a special focus on South American and Neotropical ecotones. 
    Type of Medium: Monograph available for loan
    Pages: XIII, 327 Seiten , Ill., graph. Darst.
    ISBN: 9781461437963 (print)
    Language: English
    Note: Ecotones Between Forest and Grassland; Preface; Contents; Contributors; Chapter 1: Introduction; 1.1 Rationale; 1.2 Case Study: The Cross Timbers; 1.3 About This Book; References; Part I: Temperate Forest-Grassland Ecotones: Prairies, Steppes, and Pampas; Chapter 2: Woodland-Grassland Ecotonal Shifts in Environmental Mosaics: Lessons Learnt from the Environmental History of the Carpathian Basin (Central Europe) During the Holocene and the Last Ice Age Based on Investigation of Paleobotanical and Mollusk Remains; 2.1 Introduction. , 2.2 Modern Woodland-Grassland Ecotone in the Carpathian Basin and Controversies Around Definitions2.3 Profiles Selected and Methods Applied in Modeling Woodland-Grassland Ecotone Shifts in the Carpathian Basin; 2.3.1 The Climate-Zonal Hypothesis Put to the Test; 2.3.2 Testing the Model of Edaphic Ecological Factors; 2.3.3 Testing the Idea of Human-Induced Ecotone Development; 2.4 The Vegetation History of the Great Hungarian Plains as Inferred from the Evaluation of Quaternary Paleoecological and Environmental Historical Data; 2.4.1 Vegetation Development During Last Ice Age. , 2.4.2 Vegetation Development During the Terminal Part of the Last Ice Age2.4.3 Vegetation Development During the Pleistocene/Holocene Transition; 2.4.4 Vegetation History of the Carpathian Basin from the Settlement of the First Farmers; 2.5 Summary; References; Chapter 3: Ecotones as Complex Arenas of Disturbance, Climate, and Human Impacts: The Trans-Andean Forest-Steppe Ecotone of Northern Patagonia; 3.1 Introduction; 3.2 Physical and Biological Setting of Forest-Steppe Ecotone of Northern Patagonia; 3.2.1 Abiotic Transition; 3.2.2 Ecosystem Properties Across the Transition. , 3.2.3 Plant Communities and Plant Diversity Across the Transition3.3 Disturbance Variation and Forest Dynamics Across the Transition; 3.3.1 Fine-Scale Disturbances; 3.3.2 Coarse-Scale Disturbances; 3.4 Direct and Disturbances-Mediated In fl uences of Climate Variability Across the Transition; 3.5 Climate, Fire, Land Use, and Long-Term Vegetation Changes Across the Transition; 3.5.1 Xeric Steppe-Woodland Belt; 3.5.2 The Nothofagus Forest-Shrubland Belt; 3.5.3 The Wet Rainforest Belt; 3.6 Conclusions; References; Chapter 4: Woody-Herbaceous-Livestock Species Interaction; 4.1 Introduction. , 4.2 Woody-Herbaceous Species Interactions and Associated Models4.3 Woodland and Grassland Stable States and Conceptual Models; 4.4 Woody-Herbaceous Ecotones; 4.5 Rates and Patterns of Woody-Herbaceous Ecotone Shift; 4.6 Woody-Herbaceous-Livestock Species Dynamics; 4.7 Other Potential Factors In fl uencing Woody-Herbaceous Species Dynamics; 4.8 Current and Future Research on Woody-Herbaceous-Livestock Species Interaction; References; Chapter 5: Woody Plant Invasions in Pampa Grasslands: A Biogeographical and Community Assembly Perspective; 5.1 Introduction. , 5.2 Woody Invasions as Hierarchical Assembly Processes.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : VS, Verl. für Sozialwiss.
    Associated volumes
    Call number: IASS 16.90102
    Description / Table of Contents: Das Handbuch Sozialwissenschaftliche Diskursanalyse stellt in Einzelbeiträgen aus unterschiedlichen Disziplinen theoretische und methodologische Grundlagen sowie exemplarische Vorgehensweisen der Diskursforschung vor. Es wendet sich an Studierende und WissenschaftlerInnen, die sich mit der Diskursanalyse vertraut machen wollen. Der erste Teilband präsentiert theoretische Grundlagen und allgemeine methodische Zugänge unterschiedlicher Ansätze der Diskursforschung. Der vorliegende Teilband 2 versammelt in 16 Einzelbeiträgen exemplarische diskursanalytische Studien aus Soziologie, Geschichts- und Politikwissenschaft, Diskursiver Psychologie, Kritischer Diskursanalyse, linguistischer Diskursgeschichte und Korpuslinguistik. Im Vordergrund stehen nicht die jeweiligen Fragestellungen der Einzeluntersuchungen, sondern der Zusammenhang von Fragestellung, empirischem Design, Detailanalyse und Formulierung des Gesamtergebnisses. Die Erläuterung des methodischen Vorgehens an Beispielen eignet sich für den Einsatz in der Lehre wie für die Orientierung in Bezug auf Planung und Durchführung eigener Forschungsprojekte.
    Type of Medium: Monograph available for loan
    Pages: 533 S. , Ill., graph. Darst.
    Edition: 4. Aufl.
    ISBN: 9783531166513 (kart.)
    Series Statement: Interdisziplinäre Diskursforschung
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Monograph available for loan
    Monograph available for loan
    Princeton and Oxford : Princeton University Press,
    Call number: M 17.90645
    Description / Table of Contents: Cover; Title; Copyright; Contents; List of Illustrations; Preface; PART ONE: What Has Controlled Earth's Climate?; CHAPTER ONE: Climate and Human History; PART TWO: Nature in Control; CHAPTER TWO: Slow Going for a Few Million Years; CHAPTER THREE: Linking Earth's Orbit to Its Climate; CHAPTER FOUR: Orbital Changes Control Ice-Age Cycles; CHAPTER FIVE: Orbital Changes Control Monsoon Cycles; CHAPTER SIX: Stirrings of Change; PART THREE: Humans Begin to Take Control; CHAPTER SEVEN: Early Agriculture and Civilization; CHAPTER EIGHT: Taking Control of Methane
    Description / Table of Contents: CHAPTER NINE: Taking Control of CO[sub(2)]CHAPTER TEN: Have We Delayed a Glaciation?; CHAPTER ELEVEN: Challenges and Responses; PART FOUR: Disease Enters the Picture; CHAPTER TWELVE: But What about Those CO[sub(2)] "Wiggles"?; CHAPTER THIRTEEN: The Horsemen of the Apocalypse: Which One?; CHAPTER FOURTEEN: Pandemics, CO[sub(2)], and Climate; PART FIVE: Humans in Control; CHAPTER FIFTEEN: Greenhouse Warming: Tortoise and Hare; CHAPTER SIXTEEN: Future Warming: Large or Small?; CHAPTER SEVENTEEN: From the Past into the Distant Future; EPILOGUE; CHAPTER EIGHTEEN: Global-Change Science and Politics
    Description / Table of Contents: CHAPTER NINETEEN: Consuming Earth's GiftsAfterword to the Princeton Science Library Edition; Bibliography; Figure Sources; Index; A; B; C; D; E; F; G; H; I; K; L; M; N; O; P; R; S; T; U; V; W; Y
    Description / Table of Contents: The impact on climate from 200 years of industrial development is an everyday fact of life, but did humankind''s active involvement in climate change really begin with the industrial revolution, as commonly believed? Plows, Plagues, and Petroleum has sparked lively scientific debate since it was first published--arguing that humans have actually been changing the climate for some 8,000 years--as a result of the earlier discovery of agriculture. The ""Ruddiman Hypothesis"" will spark intense debate. We learn that the impact of farming on greenhouse-gas levels, thousands of years before the i
    Type of Medium: Monograph available for loan
    Pages: xiv, 226 Seiten , Illustrationen
    Edition: New Princeton Science Library edition
    ISBN: 9780691173214
    Series Statement: Princeton Science Library
    Classification:
    Meteorology and Climatology
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    Series available for loan
    Series available for loan
    Hannover : Fachrichtung Geodäsie und Geoinformatik der Leibniz Universität Hannover
    Associated volumes
    Call number: S 99.0139 (316)
    In: Wissenschaftliche Arbeiten der Fachrichtung Geodäsie und Geoinformatik der Leibniz Universität Hannover
    Type of Medium: Series available for loan
    Pages: 121 Seiten
    Series Statement: Wissenschaftliche Arbeiten der Fachrichtung Geodäsie und Geoinformatik der Universität Hannover 316
    Classification:
    Geodetic Measurement Systems
    Note: Auch als: Deutsche Geodätische Kommission bei der Bayerischen Akademie der Wissenschaften : Reihe C, Dissertationen ; 740 , Zugl.: Hannover, Univ., Diss., 2015
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Call number: S 99.0139(312)
    In: Wissenschaftliche Arbeiten der Fachrichtung Geodäsie und Geoinformatik der Leibniz Universität Hannover
    Type of Medium: Series available for loan
    Pages: 132 Seiten
    Series Statement: Wissenschaftliche Arbeiten der Fachrichtung Geodäsie und Geoinformatik der Leibniz Universität Hannover 312
    Classification:
    Photogrammetry, Remote Sensing
    Note: Auch als: Deutsche Geodätische Kommission bei der Bayerischen Akademie der Wissenschaften : Reihe C, Dissertationen ; 723 , Zugl.: Hannover, Univ., Diss., 2014
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    Call number: IASS 16.90467
    Type of Medium: Monograph available for loan
    Pages: 266 S. , Ill., graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9783531163031 (Pb.)
    Series Statement: Interdisziplinäre Diskursforschung
    Parallel Title: Online-Ausg. Keller, Reiner: Diskurs - Macht - Subjekt
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
    Call number: M 16.90285
    Keywords: SAP ERP Financials ; Jahresabschluss
    Pages: 336 S. , Ill., graph. Darst. , 240 mm x 168 mm
    Edition: 1. Aufl.
    ISBN: 3836218321 , 9783836218320
    Series Statement: SAP PRESS
    Language: Undetermined
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 13
    Monograph available for loan
    Monograph available for loan
    Waterloo, Ontario :CIGI,
    Call number: IASS 16.90382
    Description / Table of Contents: Acronyms -- Acknowledgments -- Introduction -- Kimie Hara and Ken Coates -- Forces for Change in the Arctic: Reflections on a Region in Transition -- Ken Coates -- The Process of Formulating Japan's Arctic Policy: From Involvement to Engagement -- Fujio Ohnishi -- China and the Arctic: China's Interests and Participation in the Region -- Kai Sun -- Arctic Prospects and Challenges from a Korean Perspective -- Young Kil Park -- East Asia and the Arctic: Alaskan and American Perspectives -- Jerry McBeath -- Canada's Northern Strategy and East Asian Interests in the Arctic
    Description / Table of Contents: P. Whitney Lackenbauer and James Manicom -- The Cooperation of Russia and Northeast Asian Countries in the Arctic: Challenges and Opportunities -- Tamara Troyakova -- From Cold War Thaws to the Arctic Thaw: The Changing Arctic and Its Security Implications to East Asia -- Kimie Hara -- The Business of Arctic Development: East Asian Economic Interests in the Far North -- Carin Holroyd -- Border Dynamics in Eurasia: Implications for the Arctic Thaw -- Akihiro Iwashita -- The Arctic and Geopolitics -- David A. Welch -- East Asian States and the Pursuit of Arctic Council Observer Status
    Description / Table of Contents: James Manicom and P. Whitney Lackenbauer -- Contributors
    Description / Table of Contents: The Arctic's profile as a region for engagement and opportunity is rising among both circumpolar and non-circumpolar states
    Type of Medium: Monograph available for loan
    Pages: viii, 217 Seiten , Illustrationen, Karten
    ISBN: 9781928096023 (print) , 9781928096030
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 14
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 91.0021(44)
    In: Mainzer geowissenschaftliche Mitteilungen
    Type of Medium: Series available for loan
    Pages: 225 Seiten , Illustrationen, Karten
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Monograph available for loan
    Monograph available for loan
    London : Thistle Publishing
    Call number: IASS 17.90724
    Type of Medium: Monograph available for loan
    Pages: i, 116 Seiten , Illustrationen
    ISBN: 9781910198179
    Language: English
    Note: Introduction -- A brief detour: 10 reasons why politicians fail to represent us (and always will) -- Delegation and irreflection: the twin roots of failed political representation -- #1 Discovering citizen deliberation in the Pacific Northwest -- #2 Voting like the Irish while campaigning like the French -- #3 Keeping a tight grip: the Swiss-Oregonian lock -- #4 Learning from the British tabloid press -- #5 Recovering our distance vision in Saint Petersburg -- Conclusion -- Postscript.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    Call number: IASS 16.90729
    Type of Medium: Monograph available for loan
    Pages: 135 Bl , zahlr. Ill.
    Edition: 10. Aufl.
    ISBN: 3940315052 (Ringheft.) , 9783940315052 (Ringheft.)
    Language: German , English
    Note: Text dt. und engl.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
    Call number: IASS 16.90731
    Description / Table of Contents: Martin Haussmann ist Visualisierungsexperte bei einer Beratungsagentur für Change-Projekte. Dort haben das Visualisieren von Prozessen und die grafische Darstellung von Zusammenhängen einen hohen Stellenwert. Es geht dabei nicht um das künstlerische Zeichnen, sondern um ein bildhaftes Schreiben mit Text, is
    Type of Medium: Monograph available for loan
    Pages: 304 S. , zahlr. Ill., graph. Darst. , 17 x 25 cm
    Edition: 2., überarb. Aufl.
    ISBN: 3868815171 (kart.) , 9783868815177 (kart.) , 9783864144783 (electronic; PDF)
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 18
    Monograph available for loan
    Monograph available for loan
    Hoboken, N.J : John Wiley & Sons
    Call number: IASS 16.90733
    Type of Medium: Monograph available for loan
    Pages: XXVI, 262 S. , Ill.
    ISBN: 9780470601785 (pbk) , 9780470901045 (ebk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 19
    Call number: S 05.0369(2016,2)
    In: Report / United Nations University, Geothermal Training Programme
    Type of Medium: Series available for loan
    Pages: X, 84 Seiten , Illustrationen
    ISBN: 9789979684060
    Series Statement: Report / United Nations University Geothermal Training Programme 2016, 2
    Classification:
    Geothermal Energy
    Note: Zugl.: Univ. of Iceland, Reykjavík, MSc thesis, 2016
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 20
    Call number: S 05.0369(2016,4)
    In: Report / United Nations University, Geothermal Training Programme
    Type of Medium: Series available for loan
    Pages: X, 85 Seiten , Illustrationen
    ISBN: 9789979684084
    Series Statement: Report / United Nations University Geothermal Training Programme 2016, 4
    Classification:
    Geothermal Energy
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 21
    Monograph available for loan
    Monograph available for loan
    London [u.a.] : Verso
    Call number: IASS 17.90937
    Type of Medium: Monograph available for loan
    Pages: XVIII, 394 S. , graph. Darst. , 23 cm
    ISBN: 184467617X (pbk) , 9781844676170 (pbk) , 1844676188 (hbk) , 9781844676187 (hbk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    Monograph available for loan
    Monograph available for loan
    Dordrecht : Springer Netherlands
    Call number: M 17.90938
    Description / Table of Contents: Over the last 30 years, Dr. Nikita V. Chukanov has collected IR spectra of about 2000 mineral species, including 247 holotype samples. In this book, he presents 3309 spectra of these minerals with detailed  description and analytical data for reference samples. In the course of this work, about 150 new mineral species have been discovered. This book presents spectra of each mineral together with a description and comments on standard samples used (occurrence, appearance, associated minerals, empirical formula etc.). Sections are organized according to different classes of compounds (silicates, phosphates, arsenates, oxides etc.)
    Type of Medium: Monograph available for loan
    Pages: IX, 1726 p. 3547 illus., 1 illus. in color
    Edition: Online edition Springer eBook Collection. Earth and Environmental Science
    ISBN: 9789400771284 , 9789400771277 (print)
    Series Statement: Springer Geochemistry / Mineralogy
    Parallel Title: Print version Infrared spectra of mineral species : Extended library
    Language: English
    Note: The Application of IR Spectroscopy to the Investigation of MineralsThe Discrete Approach -- The Full-Profile Analysis -- Polymerization of coordination polyhedra and structure topology -- Hydrogen-bearing groups and hydrogen bonding -- Solid-solution series -- Force parameters of cations in silicates -- IR spectra of minerals and reference samples data -- Borates, including sulfato-borates and arsenato-borates -- Carbides and carbonates -- Organic compounds and salts of organic acids -- Ammino-complexes, nitrates and sulfato-nitrates -- Oxides and hydroxides -- Fluorides -- Silicates -- Phosphates -- Sulfates, carbonato-sulfates, phosphato-sulfates and sulfides -- Chlorides -- Vanadates and vanadium oxides -- Chromates -- Arsenates, arsenites and sulfato-arsenates -- Selenites, molybdates, tellurites, tellurates, iodites, wolframates and wolfram oxides..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
    Call number: IASS 15.89489
    Keywords: Deutschland ; Vergaberecht
    Type of Medium: Monograph available for loan
    Pages: CVII, 1774 S. , 240 mm x 160 mm
    ISBN: 9783406628597 (Gb.) , 3406628591
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 24
    Monograph available for loan
    Monograph available for loan
    Bonn : Festland Verl.
    Associated volumes
    Call number: PIK A 010-06-0379 (2016)
    In: Taschenbuch des öffentlichen Lebens
    Type of Medium: Monograph available for loan
    Pages: XVIII, 1822 S.
    Edition: 65. Jg., Stand: 13. November 2015
    ISBN: 9783872241405
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Call number: PIK D 025-16-89602
    Type of Medium: Monograph available for loan
    Pages: IX, 283 S. , graph. Darst. , 240 mm x 168 mm
    ISBN: 3658062754 , 9783658062750 , 9783658062767
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    Call number: 3/S 91.1097(2015)
    In: BGR report
    Type of Medium: Series available for loan
    Pages: 84 S. : zahlr. farb. Ill. + 1 CD-ROM
    Series Statement: BGR-Report 2015
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Monograph available for loan
    Monograph available for loan
    Amsterdam [u.a.] : Elsevier
    Associated volumes
    Call number: 9/M 16.89731
    Type of Medium: Monograph available for loan
    Pages: XVIII, 435 S. , Ill., graph. Darst. , 1 Kt.
    ISBN: 9780444593900
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    Monograph available for loan
    Monograph available for loan
    Amsterdam [u.a.] : Elsevier
    Associated volumes
    Call number: 9/M 16.89732
    Type of Medium: Monograph available for loan
    Pages: X S., S. 437 - 1144 , Ill., graph. Darst., Kt.
    ISBN: 9780444594341
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
    Call number: MOP 19538/1d-6d
    Type of Medium: Monograph available for loan
    Pages: 111 S.
    ISSN: 0486-2287
    Language: Russian
    Note: In kyrill. Schr.
    Location: MOP - must be ordered
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 30
    Call number: IASS 16.89630/2
    Type of Medium: Monograph available for loan
    Pages: S. 118 - 235 , Ill. , 28 cm
    Language: German , English
    Note: Text dt. und engl.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 31
    Monograph available for loan
    Monograph available for loan
    Dordrecht [u.a.] : Springer
    Associated volumes
    Call number: 11/M 16.89756
    In: Theory and applications of transport in porous media
    Description / Table of Contents: This book presents the basic principles of soil dynamics, and a variety of solutions of practical interest for geotechnical engineering, geophysics and earthquake engineering. Emphasis is on analytical solutions, often including the full derivation of the solution, and giving the main parts of computer programs that can be used to calculate numerical data. Reference is also made to a website from which complete computer programs can be downloaded. Soil behaviour is usually assumed to be linear elastic, but in many cases the effect of viscous damping or hysteretic damping, due to plastic deformations, is also considered. Special features are: the analysis of wave propagation in saturated compressible porous media, approximate analysis of the generation of Rayleigh waves, the analysis of the response of soil layers to earthquakes in the deep rock, with a theoretical foundation of such problems by the propagation of Love waves, and the solution of such basic problems as the response of an elastic half space to point loads, line loads, strip loads and moving loads.
    Type of Medium: Monograph available for loan
    Pages: XIV, 433 S. , 195 schw.-w. Ill., 6 schw.-w. Tab , 1 CD-ROM , 235 mm x 155 mm
    ISBN: 9789048134403 (Book with DVD.) , 9789048134410
    Series Statement: Theory and applications of transport in porous media 24
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Monograph available for loan
    Monograph available for loan
    London [u.a.] : Routledge
    Call number: IASS 16.90579
    Type of Medium: Monograph available for loan
    Pages: XVIII, 242 S. , graph. Darst., Kt.
    Edition: First paperback ed.
    ISBN: 9781138204232 (pbk) , 9780415639644 (hbk)
    Series Statement: Routledge contemporary Russia and Eastern Europe series 49
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 00.0292(2014)
    In: Jahresbericht / Bundesanstalt für Materialforschung und -prüfung (BAM)
    Type of Medium: Series available for loan
    Pages: 131 S. : zahlr. farb. Ill., graph. Darst.
    Edition: Stand: Juli 2015
    Classification:
    Engineering
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Call number: M 16.89708
    Type of Medium: Monograph available for loan
    Pages: 60 S.
    ISBN: 9783831644964
    Series Statement: acatech IMPULS
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Type of Medium: Monograph available for loan
    ISBN: 9783775727723
    Language: German , English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Call number: AWI S6-16-89182
    Type of Medium: Monograph available for loan
    Pages: 51 S.
    Edition: September 2015
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    Monograph available for loan
    Monograph available for loan
    Frankfurt am Main [u.a.] : Lang
    Call number: PIK B 050-16-89736
    Type of Medium: Monograph available for loan
    Pages: 319 S. , graph. Darst. , 210 mm x 148 mm
    ISBN: 9783631620618 (Gb.)
    Series Statement: Institutionelle und Sozial-Ökonomie 20
    Language: German
    Note: Contents: I. Grundlagen des Modell-Platonismus ; 1. Einleitung ; 2. Hans Alberts Modell-Platonismus-Vorwurf ; 3. Zur logischen Struktur neoklassischer Theorie ; 4. Das Marktmodell vollkommener Konkurrenz ; 5. Varianten der Charakterisierung neoklassischer Ökonomie ; II. Erweiterungen des Modell-Platonismus ; 6. Realitätsbezug und Informationsgehalt: Zur Grenzenlosigkeit neoklassischer Ökonomie ; 7. Axiomatische Variationen: Zur Flexibilität neoklassischer Theorie ; 8. Institutionelle Aspekte: Die Ökonomie als soziales Feld ; 9. Empirie und Evidenz: Zur Rolle von Ökonometrie und Experiment ; 10. Abschließende Bemerkungen
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
    Series available for loan
    Series available for loan
    Potsdam : IASC
    Associated volumes
    Call number: AWI P5-16-89748
    In: IASC ... bulletin
    Type of Medium: Series available for loan
    Pages: 118 S. , Ill., graph. Darst., Kt.
    ISBN: 978-3-9813637-9-1
    ISSN: 1654-7594
    Note: Content: Preface. - 1. IASC Internal Development. - IASC Organization. - IASC Council. - Executive Committee. - Secretariat. - IASC Review. - New Member Country Portugal. - ISIRA. - 2. IASC Working Groups. - Atmosphere Working Group. - Cryosphere Working Group. - Marine Working Group. - Social and Human Working Group. - Terrestrial Working Group. - 3. IASC Networks. - Arctic Coastal Dynamics Network (ACD). - Arctic Freshwater System Synthesis Network (AFS). - Arctic in Rapid Transition Network (ART). - Circum-Arctic Lithosphere Evolution Network (CALE). - INTERACT. - Network on Arctic Glaciology (NAG). - Polar Archaeology Network (PAN). - Palaeo-Arctic Spatial and Temporal Gateways Network (PAST Gateways). - 4. Arctic Science Summit Week 2015. - ICARP III / ISAR-4 Opening Session. - Toyama Conference Statement. - IASC's 25th Anniversary. - IASC Award for Service. - Indigenous participants. - Upcoming ASSWs 2016-2018. - 5. Data and observations. - Arctic Data Committee (ADC). - Sustaining Arctic Observing Networks (SAON). - Arctic Observing Summit (AOS). - 6. Partnerships. - Ice Sheet Mass Balance and Sea Level (ISMASS). - 7. Capacity Building. - IASC Fellowship Program. - Overview of supported Early Career Scientists. - 8. Publications. - IASC History Publication. - Arctic Freshwater Synthesis. - Emerging Questions in Arctic Geosciences. - Annex. - List of Acronyms and Abbreviations.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 39
    Call number: PIK M 900-16-89750
    Description / Table of Contents: Main description: Der Briefwechsel zwischen den Mathematikern Richard Dedekind und Heinrich Weber liegt nun erstmals in transkribierter Form vor. Es handelt sich um einen der wichtigsten Briefwechsel von Mathematikern im 19. Jahrhundert, da nahezu jedes Teilgebiet der Mathematik angesprochen wird und damals beginnende Entwicklungen intensiv diskutiert wurden. Personen- und Werkverzeichnisse erleichtern den Überblick über die in den Briefen diskutierten Themen.
    Description / Table of Contents: Main description: This volume provides the very first transcription of correspondence between Richard Dedekind and Heinrich Weber, one of the most important instances of written dialog between mathematicians in the 19th century. Nearly every subarea of mathematics is addressed in the letters, which intensively discuss nascent developments in the field. A register of persons and index of works ease access to the topics discussed in the letters.
    Type of Medium: Monograph available for loan
    Pages: XX, 490 S. , Ill. , 24 cm
    ISBN: 3110373661 (Gb.) , 9783110373660 (Gb.) , 9783110368048 (electr.; PDF) , 9783110398656 (electr.; ePub)
    Series Statement: Abhandlungen der Akademie der Wissenschaften in Hamburg 5
    Language: German
    Note: Techn. Univ., Diss. u.d.T.: Scheel, Katrin: Der Briefwechsel von Richard Dedekind mit Heinrich Weber--Braunschweig, 2015 , Frontmatter -- Grußwort Geleitwort Vorwort des Herausgebers Danksagung Editionskriterien Abkürzungsverzeichnis Inhalt: 1. Einleitung 2. Richard Dedekind 3. Heinrich Weber 4. Briefwechsel Dedekind - Weber 5. Elise Riemann 6. Verlag B. G. Teubner 7. Karl Hattendorff 8. Hermann Amandus Schwarz 9. Friedrich Wöhler A. Verlagsverträge B.G.Teubner-Verlag B. Chronologisches Dokumentenverzeichnis C. Verzeichnis der Fundstellen D. Literaturverzeichnis zum Briefwechsel E. Kurzbiographien Literatur Personenindex..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
    Call number: PIK N 454-16-89758
    Type of Medium: Monograph available for loan
    Pages: 521 S. , Ill., graph. Darst., Kt. , 235 mm x 165 mm
    ISBN: 3865814808 (Pb.) , 9783865814807 (Pb.)
    Series Statement: Klimawandel in Regionen zukunftsfähig gestalten - KLIMZUG 3
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 41
    Call number: M 16.89641
    Type of Medium: Monograph available for loan
    Pages: 320 S. , graph Darst., Tab. , 168 mm x 240 mm
    Edition: 1. Aufl.
    ISBN: 9783836217187
    Series Statement: SAP PRESS
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    Monograph available for loan
    Monograph available for loan
    Bonn : Rheinwerk Verlag
    Call number: M 16.89643
    Type of Medium: Monograph available for loan
    Pages: 799 S. , graph. Darst. , 25 cm
    Edition: 3., aktualisierte und erweiterte Auflage
    ISBN: 978-3-8362-3720-8
    Series Statement: Rheinwerk Publishing
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
    Call number: IASS 16.89650
    Type of Medium: Monograph available for loan
    Pages: 128 S , überw. Ill , 245 mm x 190 mm
    Edition: 1. Aufl.
    ISBN: 9783852566078
    Language: German , Italian , English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 44
    Call number: IASS 16.89646
    Type of Medium: Monograph available for loan
    Pages: 812 S , graph. Darst. , 23 cm
    Edition: 2., überarb. und erw. Aufl
    ISBN: 3895188654 (Geb.) , 9783895188657 (Geb.)
    Series Statement: Grundlagen der Wirtschaftswissenschaft 15
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
    Call number: IASS 16.89651
    Description / Table of Contents: Ein- und Zweifamilienhäuser bilden vor allem in Westdeutschland einen großen und wichtigen Teil des Wohnungsbestandes. Insbesondere die Einfamilienhausgebiete der 1950er bis 1970er Jahre haben damals einen wesentlichen Beitrag zur quantitativen und qualitativen Verbesserung der Wohnsituation geleistet. In den kommenden Jahren stehen diese Bestände vor erheblichen Veränderungsprozessen.
    Type of Medium: Monograph available for loan
    Pages: 303 S. , zahlr. Ill., graph. Darst., Kt.
    ISBN: 9783933249791
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 46
    Monograph available for loan
    Monograph available for loan
    Washington, DC : US Government Printing Office
    Associated volumes
    Call number: 20/S 91.0908(2016)
    In: The astronomical almanac
    Type of Medium: Monograph available for loan
    Pages: getr. Zähl.
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 47
    Monograph available for loan
    Monograph available for loan
    Köln : Luchterhand
    Call number: PIK B 405-17-90623
    Type of Medium: Monograph available for loan
    Pages: XXXIV, 2474 S.
    Edition: 9. Aufl.
    ISBN: 9783472084273
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    Unknown
    New Brunswick (U.S.A.) and London (U.K.) :Transaction Publishers,
    Call number: IASS 16.89965
    Pages: xviii, 307 pages ; , 23 cm
    ISBN: 9781412847483
    Uniform Title: Art de la conjecture.
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    Call number: IASS 16.90356
    Type of Medium: Monograph available for loan
    Pages: xviii, 1140 Seiten , Illustrationen
    ISBN: 9781849712354
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    Monograph available for loan
    Monograph available for loan
    Cheltenham, UK : Edward Elgar
    Call number: PIK N 073-16-89994
    Type of Medium: Monograph available for loan
    Pages: XXIII, 227 Seiten , 25 cm
    ISBN: 9780857934154 (hbk.) , 0857934155 (hbk.)
    Language: English
    Note: Contents: 1. Introduction: The Climate Change Problem and Solutions Part 1: Theory 2. The Basis of an Obligation Towards Future Generations in Justice and Ethics in the Context of Climate Change 3. Content of Justice-based Obligations Towards Future Generations in the Context of Climate Change Part II: International Law and Politics 4. Current International Law, Intergenerational Justice and Climate Change 5. International Human Rights Law, Intergenerational Justice and Climate Change 6. Climate Change Discources and Intergenerational Justice Part III: The Way Forward and Conclusion 7. The Way Forward – Incorporating Intergenerational Justice Principles into International Climate Law 8. Conclusion Bibliography Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
    Call number: PIK B 160-16-89999
    Description / Table of Contents: 'The financial means embedded in subsidies for unsustainable systems of production and consumption are increasingly well studied and reported. This has led to policy recommendations (e.g. OECD, EU) on how to reform subsidy systems in support of the necessary transitions to a low carbon and ecosystem resilient society based on a strong resource efficient economy. The authors in this book contribute to the debate based on recent, high quality and policy relevant research. It is a timely contribution to a pressing financial issue in environmental policy.'--Hans Bruyninckx , Executive Director of the European Environment Agency. 'Recently the IPCC finished their 5th Assessment report and we see that while emissions continue unabated - and in some areas even increase, relatively little is done in terms of policy making. Instead of sound policies to deal with climate issues, we are still faced with perverse incentives that promote fossil fuels. This book sets itself a very important agenda of trying to find a workable path towards abolishing such subsidies. This is vital reading for all policy makers.'--Thomas Sterner, Visiting Chief Economist, Environmental Defense Fund Professor of environmental economics, University of Gothenburg. 'EU countries increasingly receive recommendations through the European Semester and OECD Environmental Performance Reviews to assess and progressively phase out environmentally harmful subsidies. It is not only a matter of avoiding damage to the environment, it is also a question of transparency, equity, and of eliminating unjustified privileges. Subsidy reform can help reduce public deficits, restore fair market conditions and eliminate distortions in competition. This book is a precious tool for Governments and experts.'--Aldo Ravazzi Douvan, Italian Ministry of Environment, Professor of Sustainable Development at University Roma Luiss. 'Tax spending and public subsidies harmful to the environment have attracted high level attention at the Rio and Johannesburg Sustainable Development Conferences, in the context of the Kyoto Protocol and of the Convention on Biological Diversity, in OECD and EU recommendations, and are now firmly on the public agenda. They are often also poorly designed, do not reach their goals, are costly, not transparent and can be inefficient. With the present public budget crises in many countries, rarely has the timing been more favorable to lower such harmful support. The book is thus timely and shows throu ...
    Type of Medium: Monograph available for loan
    Pages: XIII, 348 S. , graph. Darst.
    ISBN: 9781782545309
    Language: English
    Note: 1. Introduction : high hopes and down-to-earth realism / Frans Oosterhuis and Patrick ten Brink2. A global survey of potentially environmentally harmful subsidies / Ronald Steenblik -- 3. Hidden subsidies : the invisible part of the EHS iceberg / Sirini Withana ... [et al.] -- 4. Can we recognise an environmentally harmful subsidy if we see one? / Jan Pieters -- 5. Quantifying the impacts of environmentally harmful subsidies / Cees van Beers and Jeroen van den Bergh -- 6. Energy subsidies / Frans Oosterhuis and Katharina Umpfenbach -- 7. Environmentally harmful subsidies in the transport sector / Laurent Franckx and Inge Mayeres -- 8. Agriculture, food and water / Frans Oosterhuis and Kris Bachus -- 9. Environmentally harmful subsidies and biodiversity / Patrick ten Brink ... [et al.] -- 10. Reforming EHS in Europe : success stories, failures and agenda setting / Jacqueline Cottrell -- 11. Phasing out environmentally harmful subsidies worldwide / Anja von Moltke -- 12. Reform of environmentally harmful subsidies : distributional issues / Annegrete Bruvoll and Haakon Vennemo -- 13. The way forward : reforming EHS in the transition to a green economy / Patrick ten Brink, Sirini Withana and Frans Oosterhuis..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 52
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: IASS 16.90372 ; PIK D 022-19-89867
    Description / Table of Contents: Wir leben auf Kosten der Zukunft. Warum? Kurzfristige Interessen der Bürger (sichere Arbeit) ergänzen sich mit kurzfristigen Interessen der Politiker (Wiederwahl). Das politische System trägt Mitschuld. Wie kann man es ändern, um  diese Schwächen zu vermeiden? Lässt es sich demokratisch rechtfertigen, wenn Anwälte zukünftiger Generationen heute schon mitentscheiden? Diese Fragen werden  von Wissenschaftlern, Schriftstellern, Politikern und Unternehmern behandelt, um methodische Analyse, politischen und ökonomischen Sachverstand und kreative Ideen zu kombinieren. Das Buch enthält Beiträge von H. Geißler, H. J. Schellnhuber, I. Trojanow u.a. „Die Demokratie hat viele große Vorzüge und Stärken. Langfristigkeit und Nachhaltigkeit gehören bislang nicht dazu. Dem kann man institutionell abhelfen. Das Buch zeigt, wie.“ (Ernst Ulrich von Weizsäcker, MdB a.D.)   Der Inhalt ·         Problemanalyse und Überblick ·         Neue Institutionen: Zukunftsräte ·         Neue Institutionen: Ombudspersonen ·         Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten ·         Ombudspersonen in Unternehmen?   Die Zielgruppen   ·         PolitikwissenschaftlerInnen ·         PhilosophInnen ·         politisch interessierte Bürger     Der Herausgeber Prof. Dr. Bernward Gesang lehrt Philosophie an der Universität Mannheim
    Type of Medium: Monograph available for loan
    Pages: XII, 150 S.
    ISBN: 9783658048952 , 9783658048945
    Parallel Title: Print version: Kann Demokratie Nachhaltigkeit
    Language: German
    Note: Problemanalyse und ÜberblickNeue Institutionen: Zukunftsräte -- Neue Institutionen: Ombudspersonen -- Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten -- Ombudspersonen in Unternehmen?..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 53
    Call number: IASS 16.90668
    Type of Medium: Monograph available for loan
    Pages: 342 S. , graph. Darst.
    Edition: 1. Aufl.
    ISBN: 3848715856 , 9783848715855 , 9783845256009 (electronic; ePDF)
    Language: German
    Note: Zugl.: München, Univ., Diss., 2014
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS
    Call number: IASS 16.90419
    Type of Medium: Monograph available for loan
    Pages: 499 Seiten , Illustrationen
    ISBN: 9783531174433 , 9783531189185 (electronic)
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 55
    Monograph available for loan
    Monograph available for loan
    Frankfurt am Main : Fischer-Taschenbuch-Verl.
    Call number: IASS 16.90436
    Type of Medium: Monograph available for loan
    Pages: 93 S.
    Edition: Erw. Ausg., 13. Aufl.
    ISBN: 9783596100835
    Series Statement: Fischer-Taschenbücher 10083
    Uniform Title: L' ordre du discours 〈dt.〉
    Language: German
    Note: Die Vorlage enth. insgesamt 2 Werke
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 56
    Monograph available for loan
    Monograph available for loan
    Cheltenham [u.a.] : Elgar
    Call number: PIK N 071-16-90003
    Type of Medium: Monograph available for loan
    Pages: XIV, 189 S. , graph. Darst., Kt.
    ISBN: 1781955549 ((cased)) , 9781781955543 ((cased)) , 9781783478910 , 9781781955550 (electronic)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
    Monograph available for loan
    Monograph available for loan
    Wiesbaden : Springer VS Verlag für Sozialwissenschaften
    Call number: IASS 16.90103
    Description / Table of Contents: Ob in Medien, in der Wissenschaft, in der Politik oder in der Alltagskommuni­kation - wir sind stets mit einer Fülle an schriftlichen und mündlichen Erzäh­lungen konfrontiert. Sie schaffen gemeinsame Wirklichkeiten und Identitäten, auf die wir uns als soziale Akteure in unseren Handlungen bewusst oder unbewusst beziehen. Erzählungen im öffentlichen Raum prägen Normen und Moralvorstellungen, helfen beim Aufbau sozialer und kultureller Ordnungen und festigen oder verschieben damit bestehende Normen. Es sind Erzählungen, die in öffentlichen Diskursen bestimmen, was in einer Gesellschaft als wahr
    Type of Medium: Monograph available for loan
    Pages: 394 Seiten
    ISBN: 9783531932569 , 9783531173993 (print)
    Series Statement: Theorie und Praxis der Diskursforschung
    Language: German
    Note: Inhalt; Über dieses Buch; Teil I Einführungen: Theorien der Erzählungen; Erzählen. Die ethisch-politische Funktion narrativer Diskurse; 1 Narrative Diskurse: Eigenschaften und Funktionen; 1.1 Die narrative Kunst der Begründung; 1.2 Ein semantisches Modell der Erzählung: Algirdas J. Greimas' Aktantentheorie; 1.3 Narrative Begründungen: Eine semantische Typologie; 1.4 Die Schuld und die Vergebung: Zum Verantwortungsmanagement narrativer Diskurse; 1.5 In medias res: Warum Erzählungen oft mit dem Ende beginnen; 1.6 Die doppelte Referenz: Das Allgemeine und das Einzigartige. , 2 Die Erzähler und ihr Publikum: Zur Öffentlichkeit narrativer Diskurse2.1 Öffentliche Urteile: Die Erzähler und ihr Publikum; 2.2 Die zwei Stimmen des Erzählers; 2.3 Die Präsenz des Erzählers in der Erzählung; 2.4 Die Öffentlichkeiten des Erzählers; 2.5 Autobiografisches Erzählen: Der innere Dialog und das Denken; 2.6 Ausblick: Die Öffentlichkeitsregime narrativer Diskurse; Literatur; »Menschen lesbarer machen«1: Narration, Diskurs,Referenz; 1 Narrationen als sozialwissenschaftliches Konzept; 1.1 Erzählungen zwischen Text und Handlung; 1.2 Typen der Erzählung. , 1.3 Zur lebensweltlichen Einbettung von Narrativen2 Zum Verhältnis von Narration und Diskurs; 2.1 Brauchen Diskurse Erzählungen?; 2.2 Narrationen als Sprech-Handlungen (über Satzniveau); 3 Erzählungen: Strukturen, Ereignisse und dieKomposition der Fabel; 3.1 Narration und Fabelkomposition; 3.2 Ebenen der Erzählung; 3.3 Kollektiv-Symbole und ihre Erzählungen; 3.4 Narrative und ihre Bedeutung für die kulturelle Reproduktion und Innovation; 4 Referenz und Erzählung: Jenseits der Innenwelt von Texten; 4.1 Öffentliche Erzählungen als Mimesis von Handlungen?. , 5 ConclusioLiteratur; Öffentliche Erzählungen und der globale Wandel des Klimas; 1 Einleitung; 2 Der Mensch als Klimageschichtenerzähler; 2.1 Was heißt Narrativisierung des Klimas?; 2.2 Narrationen als Geburtshelfer möglicher Welten; 2.3 Klimageschichten sind lebende Geschichten; 3 Globaler Klimawandel: Geburt eines Konzepts; 4 Sechs Varianten der Narrativisierung des globalenKlimawandels; 4.1 Das »globale Treibhaus« als anthropogene Katastrophe; 4.2 Anthropogene Eiszeiten: die Katastrophe des; 4.3 Die Geschichte vom »nuklearen Winter«; 4.4 »Paradiesische Warmzeiten«. , 4.5 Die ewige Wiederkehr der »Sonnenflecken«: Normalität statt Katastrophe. , 4.2 Die Konfiguration von Charakteren in öffentlichen Erzählungen4.3 Re-figuration und die Rolle des Lesers; Teil II Erzählungen in den Medien; Kollektivsymbolik und die deutsche Krise seit dem Jahr 2000; Heimat, Natur und die gute alte Zeit. Erzählungenüber Nachhaltige Entwicklung im Spannungsfeldöffentlicher und wissenschaftlicher Diskurse1; 1 Einleitung; 2 Wissenschaftliche Diskurse über Nachhaltige Entwicklung; 3 Nachhaltige Ernährung und Ernährungskommunikation; 4 Erzählungen über Ernährung in den Medien; 4.1 Polarisierende Rhetorik; 4.2 Affirmative Rhetorik; 4.3 Reflektierende Rhetorik.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 58
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 94.0081(53)
    In: Mainzer naturwissenschaftliches Archiv
    Type of Medium: Series available for loan
    Pages: 288 Seiten , farbige Illustrationen
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 59
    Call number: IASS 16.90380
    Description / Table of Contents: Chapter 2 Governance of marine fisheries and biodiversity conservation: Convergence or coevolution?Introduction; Selected strands in fishery governance; Selected strands in conservation governance; Parallel strands in conservation and fishery governance; Discussion and conclusion; Notes; References; Chapter 3 Governance of marine fisheries and biodiversity conservation: The integration challenge; Introduction; Sustainable development backdrop; Integration process; Integration factors; Integration through interaction; Concluding thoughts; Notes; References; Part 2 Governance dimensions
    Description / Table of Contents: Chapter 4 Bio-ecological dimensions of fisheries management, biodiversity and governanceIntroduction and background; Fisheries management up to the 1990s; The ecological categories of impacts of fishing and their management; Areas of overlap and potential for inconsistencies between fisheries and conservation of biodiversity approaches; Venues for change; Conclusions; References; Chapter 5 The economic dimension: Addressing behaviour, incentives and context for effective governance; Introduction; Economic foundations of governance; The economic context of governance
    Description / Table of Contents: Evolving economic scope of governanceEconomic instruments in fisheries and marine conservation; Discussion: Economic instruments and prospects for governance integration; References; Chapter 6 The social dimension: The challenge of dealing with equity; Introduction: The two cultures; Fisheries management: creating wealth, forgetting about distribution; Conservation: creating values with unequal distribution of costs; Reconciling fisheries management and conservation; Consultation and co-management; Fisheries management and conservation within larger frameworks; Lessons learnt; Notes
    Description / Table of Contents: Governance of Marine Fisheries and Biodiversity Conservation; Copyright; Contents; Notes on contributors; Foreword Bonnie J. McCay; Foreword Árni M. Mathiesen; Foreword Braulio Ferreira de Souza Dias; Preface Serge M. Garcia, Jake Rice and Anthony Charles; Acknowledgements; List of selected acronyms; Glossary; Part 1 Governance trends and challenges; Chapter 1 Governance of marine fisheries and biodiversity conservation: A history; Introduction; Historical developments in fishery governance; Historical developments in biodiversity conservation; Conclusions; Notes; References
    Description / Table of Contents: Part 4. Regional governance. Regional governance for fisheries and biodiversity / R. Warner, K.M. Gjerde and D. Freestone ; Regional governance: The case of NEAFC and OSPAR / K. Hoydal, D. Johnson and A.H. Hoel ; Regional governance: The Mediterranean cradle / F. Simard, M. Camilleri and L. Sbai ; CCAMLR and Antarctic conservation: The leader to follow? / D. Miller and N.M. Slicer ; Implementation of the Ecosystem Approach to Fisheries in the Benguela Current LME area / J. Augustyn, S. Petersen, L. Shannon and H. Hamukuaya ; Governance of marine fisheries and conservation in the context of the European Union / S. Beslier and B. Drobenko -- Part 5. National governance. The use of national frameworks for sustainable development of marine fisheries and conservation, ecosystem-based management and integrated ocean management / K. Sainsbury, P. Gullestad and J. Rice ; Small-scale fisheries: Importance, vulnerability and deficient knowledge / J. Kolding, C. Béné and M. Bavinck ; Stewardship in tropical small-scale fisheries: Community and national perspectives / P. Christie, L.M. Campbell and N. Armada ; Making space for small-scale fishing communities: Use and misuse of spatial management instruments / M.R. Sowman, R. Rajagopalan, C. Sharma and J. Sunde ; ENGOs and SIDS: Environmental interventions in small island developing states / P. McConney, R. Pomeroy and Z. Khan ; The role of capacity building for improving governance of fisheries and conservation of marine ecosystems / J.C. Seijo and S. Salas ; Fishers' organizations: Their role in decision-making for fisheries and conservation / M. Makino, A.S. Cabanban and S. Jentoft ; The role of courts in fisheries management and marine biodiversity protection: US and EU systems / P. Shelley and T. van Rijn --
    Description / Table of Contents: Part 5. Conclusion. A tale of two streams: Synthesizing governance of marine fisheries and biodiversity conservation / A. Charles, S.M. Garcia and J. Rice -- Annexes. Annex 1: History of fisheries and biodiversity conservation: A timeline of key events (1850-2012) ; Annex 2: Key global institutions, bodies and processes: Roles, participation and main focus
    Description / Table of Contents: Part 1. Governance trends and challenges. Governance of marine fisheries and biodiversity conservation: A history / S.M. Garcia, J. Rice and A. Charles ; Governance of marine fisheries and biodiversity conservation: Convergence or coevolution? / S.M. Garcia, J. Rice and A. Charles ; Governance of marine fisheries and biodiversity conservation: The integration challenge / S.M. Garcia, J. Rice and A. Charles -- Part 2. Governance dimensions. Bio-ecological dimensions of fisheries management, biodiversity and governance / J. Rice and P. Mace ; The economic dimension: Addressing behaviour, incentives and context for effective governance / S. Hanna ; The social dimension: The challenge of dealing with equity / B. Hersoug ; The global legal dimension: Navigating the legal currents of rights and responsibilities / A.H. Hoel and D. VanderZwaag ; Spatial dimensions of fisheries and biodiversity governance / R. Kenchington, O. Vestergaard and S.M. Garcia ; Scientific foundation: Towards integration / J. Rice, S. Jennings and A. Charles -- Part 3. Global governance. Global level institutions and processes: Frameworks for understanding critical roles and foundations of cooperation and integration / L. Ridgeway ; Global level institutions and processes: Assessment of critical roles, foundations of cooperation and integration and their contribution to integrated marine governance / L. Ridgeway ; Integrative policy and legal instruments, approaches and tools: Fisheries and biodiversity conservation / B. Kuemlangan, J. Sanders, P. Deupmann and C. De Young ; Conservation and risk of extinction of marine species / P. Mace, C. O'Criodain, J. Rice and G. Sant ; Parallel initiatives: CBD's Ecologically or Biologically Significant Areas (EBSAs) and FAO's Vulnerable Marine Ecosystems (VMEs) criteria and processes / J. Rice, J. Lee and M. Tandstad --
    Description / Table of Contents: Governance of Marine Fisheries and Biodiversity Conservation explores governance of the world's oceans with a focus on the impacts of two inter-connected but historically separate streams of governance: one for fisheries, the other for biodiversity conservation. Chapters, most co-authored by leading experts from both streams, investigate the interaction of these governance streams from ecological, economic, social and legal perspectives, with emphasis on policies, institutions processes, and outcomes on scales from the global to the local community, and with coverage of a range of them
    Type of Medium: Monograph available for loan
    Pages: XXXVIII, 511 Seiten , Illustrationen, Karten
    ISBN: 9781118392645 (cloth)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
    Monograph available for loan
    Monograph available for loan
    London : Routledge
    Call number: PIK N 454-17-90902
    Type of Medium: Monograph available for loan
    Pages: XI, 452 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9781444104882 , 1444104888
    Language: English
    Note: Contents: 1. A looming crisis Part I Status and challenges 2. Rising demand and dwindling per capita resources 3. Water and poverty 4. Governance and finance 5. Pollution and water-related disease 6. Water, land and wildlife 7. Dams and diversions 8. Trading water - real and virtual 9. Water, war and terrorism 10. The threat of global warming Part II Nature's resources 11. The restless water cycle 12. Shrinking freshwater stores Part III Towards sustainability 13. Cutting demand 14. Increasing supplies 15. Cleaning up and protecting the aquatic environment 16. Using seawater 17. Controlling the weather 18. Improved monitoring and data management 19. Improving prediction and risk assessment 20. Improving management and justice 21. Aid for the developing world Conclusions 22. Is sustainability achievable?
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 61
    Monograph available for loan
    Monograph available for loan
    Berkeley, Calif. [u.a.] : Univ. of California Press
    Call number: IASS 16.90487
    Type of Medium: Monograph available for loan
    Pages: VI, 323 S.
    Edition: 1. paperback ed., [Nachdr.]
    ISBN: 0520021568 , 9780520021563
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 62
    Call number: M 17.90482
    Keywords: Literaturrecherche ; Bibliothek ; Internet
    Description / Table of Contents: Gewusst wie! Von der Auswahl der Datenbanken und Suchmaschinen über den Einsatz der geeigneten Suchbegriffe und die Auswertung der Ergebnisse, bis hin zum korrekten Zitieren und dem Erstellen eigener Literaturlisten, der Ratgeber demonstriert Schritt für Schritt, wie man die passende Literatur findet und verarbeitet. Berücksichtigt werden neben gedruckten Quellen, wie Büchern, Zeitschriften und Zeitungen, auch frei verfügbare oder lizenzpflichtige Internet-Ressourcen. Für die 2. Auflage wurde der Band umfassend überarbeitet, aktualisiert und um Kapitel zur Nutzung von Zitationsdatenbanken, Discovery Services und den Umgang mit Open-Access-Publikationen erweitert. (Verlag)
    Description / Table of Contents: Einführung in die Literaturrecherche und -beschaffung während des Studiums mithilfe von Bibliothekskatalogen, Datenbanken und Internetsuchmaschinen. (LK/W: Thorn)
    Pages: VI, 161 S. , Ill., graph. Darst. , 23 cm
    Edition: 2., aktualisierte und erw. Aufl.
    ISBN: 9783476025203 (kart.)
    Parallel Title: 1. Aufl. u.d.T.: Franke, Fabian: Schlüsselkompetenzen
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Call number: S 92.0286(38)
    In: Veröffentlichungen des Museums für Naturkunde Chemnitz
    Type of Medium: Series available for loan
    Pages: 166 S. : farb.Ill., graph. Darst.
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
  • 65
    Call number: S 92.0286 (39)
    In: Veröffentlichungen des Museums für Naturkunde Chemnitz
    Type of Medium: Series available for loan
    Pages: 192 Seiten , Illustrationen
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Call number: IASS 16.90603
    Type of Medium: Monograph available for loan
    Pages: XII, 727 S
    ISBN: 9781604978766 (alk. paper)
    Language: English
    Note: Sovereignty as an institution of international society / Matthew S. WeinertWestphalian sovereignty and realism in contemporary international security / Robert W. Murray -- International institutions and state sovereignty : frozen in time or warming to change / Tom Keating -- Ecological sovereignty and Arctic politics / Guy-Serge Côté and Matthew Paterson -- Canadian Arctic security : shifting challenges / Rob Huebert -- U.S. Arctic policy : reproducing hegemony in a maritime region / Philip E. Steinberg -- Russia's Arctic policy : continuity and changes / Gleb Yarovoy -- Norway's high Arctic policy / Geir Hønneland -- Territory, security and sovereignty : the kingdom of Denmark's Arctic strategy / Mark Nuttall -- Sweden and Arctic policy : possibilities for new wine in old bottles? / E. Carina H. Keskitalo -- Finland as an Arctic and European state : Finland's northern dimension (policy) / Lassi Heininen -- Iceland : a state within the Arctic / Alyson JK Bailes and Margrét Cela -- The Arctic and the European Union / Clive Archer -- The United Nations on Arctic issues / W. Andy Knight -- The future of the Arctic Council : navigating between sovereignty and security / Timo Koivurova and Piotr Graczyk -- International law and the Arctic : how territoriality, human rights and the environment can shape sovereignty / Betsy Baker -- Arctic oil, Inuit resource governance and the Arctic Council / Jessica M. Shadian -- A work in progress : the United Kingdom and the Arctic region / Klaus Dodds -- Emerging interests of non-Arctic countries in the Arctic : China, Japan, South Korea and India / Nong Hong & Anita Dey Nuttall -- Sovereignty, security and international cooperation : significance of the Antarctic experience for the Arctic / Anita Dey Nuttall..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    Monograph available for loan
    Monograph available for loan
    Berlin : Springer
    Call number: 6/M 16.89656
    Description / Table of Contents: Geodetic datum (including coordinate datum, height datum, depth datum, gravimetry datum) and geodetic systems (including geodetic coordinate system, plane coordinate system, height system, gravimetry system) are the common foundations for every aspect of geomatics. This course book focuses on geodetic datum and geodetic systems, and describes the basic theories, techniques, methods of geodesy. The main themes include: the various techniques of geodetic data acquisition, geodetic datum and geodetic control networks, geoid and height systems, reference ellipsoid and geodetic coordinate systems, Gaussian projection and Gaussian plan coordinates and the establishment of geodetic coordinate systems. The framework of this book is based on several decades of lecture noted and the contents are developed systematically for a complete introduction to the geodetic foundations of geomatics.
    Description / Table of Contents: REVIEW: "The present work integrates both classical materials and modern developments in geodesy, it describes pure theoretical approaches and recent practical applications. The book can be used as a general textbook for undergraduates studying geomatics and survejing and mapping in higher education institutions. For technicians who are engaged in geomatic and surveying engineering, the book is strongly recommended as a basic and useful reference guide."
    Type of Medium: Monograph available for loan
    Pages: XXI, 401 S.
    ISBN: 9783642412455 , 9783642412448
    Classification:
    Geodesy
    Language: English
    Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Monograph available for loan
    Monograph available for loan
    Cambridge [u.a.] : Cambridge Univ. Press
    Call number: IASS 16.90626
    Type of Medium: Monograph available for loan
    Pages: XV, 495 S. , graph. Darst
    ISBN: 0521199484 (hbk) , 9780521199483 (hbk) , 052113613X (pbk) , 9780521136136 (pbk)
    Language: English
    Note: Introduction.The role of compliance in an evolving climate regime / Lavanya Rajamani, Jutta Brunnée, and Meinhard Doelle -- The emerging post-Cancun climate regime / Jennifer Morgan -- Promoting compliance with multilateral environmental agreements / Jutta Brunnée -- Compliance regimes in multilateral environmental agreements / Jane Bulmer -- Key features of the Kyoto Protocol's compliance system / René Lefeber and Sebastian Oberthür -- Experience with the facilitative and enforcement branches of the Kyoto compliance system / Meinhard Doelle -- Experiences with Articles 5, 7, and 8 defining the monitoring, reporting and verification system under the Kyoto Protocol / Anke Herold -- The role of non-state actors in climate compliance / Eric Dannenmaier -- Facilitation of compliance / Catherine Redgwell -- Enforcing compliance in an evolving climate regime / Michael Mehling -- Financial mechanisms under the climate regime / Haroldo Machado-Filho -- Post-2012 compliance and carbon markets / Franceso Sindico -- Compliance and the use of trade measures / Jacob Werksman -- 'Comparability of efforts' among developed country parties and the post-2012 compliance system / M.J. Mace -- From the Kyoto Protocol compliance system to MRV : what is at stake for the European Union? / Sandrine Maljean-Dubois and Anne-Sophie Tabau -- Compliance in transition countries / Christina Voigt -- Developing countries and compliance in the climate regime / Lavanya Rajamani -- The role of dispute settlement in the climate regime / Ruth Mackenzie -- Depoliticizing compliance / Geir Ulfstein -- Conclusion.Promoting compliance in an evolving climate regime / Meinhard Doelle, Jutta Brunnée, and Lavanya Rajamani..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    Monograph available for loan
    Monograph available for loan
    Frankfurt am Main : Suhrkamp
    Call number: IASS 17.90630
    Type of Medium: Monograph available for loan
    Pages: 167 S.
    Edition: 20. Aufl.
    ISBN: 9783518102879
    Series Statement: Edition Suhrkamp 287
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Call number: S 92.0551(61, 1)
    Type of Medium: Series available for loan
    Pages: 103 Seiten , Illustrationen, Diagramme , 30 cm
    ISBN: 9783910006546
    Series Statement: Geologica Saxonica 61,1
    Language: German
    Note: Beiträge teilweise in deutscher, teilweise in englischer Sprache
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: M 16.89855
    Description / Table of Contents: The first global overview of intraplate earthquakes, their mechanical models and investigative geophysical techniques, for academic researchers, professionals and engineers
    Type of Medium: Monograph available for loan
    ISBN: 9781107040380
    Parallel Title: Print version: Intraplate Earthquakes
    Language: English
    Note: Cover; Half title; Title; Copyright; Contents; Contributors; Preface; 1 Introduction; 2 Intraplate earthquakes in Australia; 2.1 Introduction; 2.2 Two centuries of earthquake observations in Australia; 2.2.1 Mechanism, geographic distribution, and strain rate; 2.2.2 Seismogenic depth; 2.2.3 Attenuation and scaling relations; 2.3 A long-term landscape record of large (morphogenic) earthquakes; 2.3.1 Variation in fault scarp length and vertical displacement; 2.3.2 The influence of crustal type and character on seismic activity rates; 2.4 Patterns in earthquake occurrence. , 2.5 Maximum magnitude earthquake2.5.1 Scarp length as a proxy for paleo-earthquake magnitude; 2.6 Implications for SCR analogue studies: factors important in earthquake localisation; 2.6.1 Mechanical and thermal influences; 2.6.2 Structural architectural influences; 2.7 Conclusions; Acknowledgements; 3 Intraplate seismicity in Brazil; 3.1 Introduction; 3.2 Earthquake catalogue; 3.3 Seismicity map; 3.4 Seismotectonic correlations; 3.4.1 Lower seismicity in Precambrian cratonic provinces; 3.4.2 Intraplate seismicity and cratonic roots; 3.4.3 Passive margin seismicity. , 3.4.4 Influence of neotectonic faults3.4.5 Flexural stresses; 3.5 Discussion and conclusions; Acknowledgments; 4 Earthquakes and geological structures of the St. Lawrence Rift System; 4.1 Introduction; 4.2 Historical earthquakes and their impact; 4.3 Seismic zones of the SLRS; 4.3.1 Charlevoix; 4.3.2 Lower St. Lawrence; 4.3.3 Western Quebec; 4.3.4 Background seismicity; 4.4 The St. Lawrence Rift System; 4.5 The rift hypothesis and the SLRS: discussion and conclusions; Acknowledgments; 5 Intraplate earthquakes in North China; 5.1 Introduction; 5.2 Tectonic background; 5.2.1 Geological history. , 5.2.2 Lithospheric structure5.2.3 Major seismogenic faults; 5.3 Active tectonics and crustal kinematics; 5.4 Strain rates and seismicity; 5.5 Seismicity; 5.5.1 Paleoseismicity; 5.5.2 Large historic events; 1303 Hongdong earthquake (M 8.0); 1556 Huaxian earthquake (M 8.3); 1668 Tancheng earthquake (M 8.5); 1679 Sanhe earthquake (M 8.0); 1695 Linfen earthquake (M 7.5-8.0); 5.5.3 Large instrumentally recorded earthquake; The 1966 Xingtai earthquake (Ms 7.2); The 1975 Haicheng earthquake (Ms 7.3); The 1976 Tangshan earthquake (Ms 7.8); 5.6 Spatiotemporal patterns of large earthquakes. , 5.6.1 Long-distance roaming of large earthquakes5.6.2 Fault coupling and interaction; 5.6.3 A conceptual model for mid-continental earthquakes; 5.7 Implications for earthquake hazards; Acknowledgements; 6 Seismogenesis of earthquakes occurring in the ancient rift basin of Kachchh, Western India; 6.1 Introduction; 6.2 Tectonic framework, structure, and tectonic evolution of Kachchh Rift basin; 6.2.1 Structure and tectonics; 6.2.2 Tectono-volcanic events; 6.2.3 Tectonic evolution and existing earthquake generation models of the Kachchh Rift zone. , 6.2.4 Identification of magmatic intrusive bodies.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    Call number: IASS 16.89860
    Type of Medium: Monograph available for loan
    Pages: 238 S. , graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9783896917683
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
    Monograph available for loan
    Monograph available for loan
    Washington, DC : US Government Printing Office
    Associated volumes
    Call number: 20/S 91.0908(2017)
    In: The astronomical almanac
    Type of Medium: Monograph available for loan
    Pages: getr. Zähl.
    Location: Reading room
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 74
    Call number: PIK N 070-17-90679
    Type of Medium: Monograph available for loan
    Pages: 47 Seiten , Illustrationen, Diagramme
    Series Statement: Hamburger Gespräche für Naturschutz
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Monograph available for loan
    Monograph available for loan
    Chicago [u.a.] : The University of Chicago Press
    Call number: IASS 16.90032
    Type of Medium: Monograph available for loan
    Pages: XLVI, 217 S.
    Edition: 4. ed., 50th anniversary ed.
    ISBN: 0226458113 (cloth) , 9780226458113 (cloth) , 0226458121 (paperback) , 9780226458120 (paperback)
    Language: English
    Note: Introductory essay / by Ian Hacking -- Preface -- Introduction: a role for history -- The route to normal science -- The nature of normal science -- Normal science as puzzle-solving -- The priority of paradigms -- Anomaly and the emergence of scientific discoveries -- Crisis and the emergence of scientific theories -- The response to crisis -- The nature and necessity of scientific revolutions -- Revolutions as changes of world view -- The invisibility of revolutions -- The resolution of revolutions -- Progress through revolutions -- Postscript-1969..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    GFZ publications
    GFZ publications
    Potsdam : Deutsches GeoForschungsZentrum
    Associated volumes
    Call number: 21/STR 16/06
    In: Scientific technical report
    Type of Medium: GFZ publications
    Pages: vii, 150 Seiten , Illustrationen
    Series Statement: Scientific technical report / Deutsches GeoForschungsZentrum GFZ 16/06
    Note: Zugl.: Technische Universität, Wien, Disseratation, 2016
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Monograph available for loan
    Monograph available for loan
    Oslo : University Of Oslo
    Call number: M 17.90798
    Type of Medium: Monograph available for loan
    Pages: 196 S. , Illustrationen, graphische Darstellungen
    ISSN: 1501-7710
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    Call number: PIK D 029-17-90802
    Description / Table of Contents: Examines how knowledge regimes are organized, operate, and have changed over the last thirty years in the United States, France, Germany, and Denmark. They show how there are persistent national differences in how policy ideas are produced. Some countries do so in contentious, politically partisan ways, while others are cooperative and consensus oriented. They find that while knowledge regimes have adopted some common practices since the 1970s, tendencies toward convergence have been limited and outcomes have been heavily shaped by national contexts.
    Type of Medium: Monograph available for loan
    Pages: XVIII, 401 Seiten , graph. Darst.
    ISBN: 9780691161167 (pbk) , 9780691150314 (cloth)
    Language: English
    Note: Contents: Preface ; Chapter 1: Knowledge Regimes and the National Origins of Policy Ideas ; Part I: The Political Economy of Knowledge Regimes ; Chapter 2: The Paradox of Partisanship in the United States ; Chapter 3: The Decline of Dirigisme in France ; Chapter 4: Coordination and Compromise in Germany ; Chapter 5: The Nature of Negotiation in Denmark ; Reprise: Initial Reflections on the National Cases ; Part II: Issues of Similarity and Impact ; Chapter 6: Limits of Convergence ; Chapter 7: Questions of Influence ; Part III: Conclusions ; Chapter 8: Summing Up and Normative Implications ; Postscript: An Agenda for Future Research ; Appendix: Research Design and Methods
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
    Call number: S 05.0369(2016,3)
    In: Report / United Nations University, Geothermal Training Programme
    Type of Medium: Series available for loan
    Pages: 53 Seiten , Illustrationen
    ISBN: 9789979684077
    Series Statement: Report / United Nations University Geothermal Training Programme 2016, 3
    Classification:
    Geothermal Energy
    Note: Zugl.: Univ. of Iceland, Reykjavík, MSc thesis, 2016
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 80
    Call number: S 05.0369(2016,5)
    In: Report / United Nations University, Geothermal Training Programme
    Type of Medium: Series available for loan
    Pages: VIII, 64 Seiten , Illustrationen
    ISBN: 9789979684091
    Series Statement: Report / United Nations University Geothermal Training Programme 2016, 5
    Classification:
    Geothermal Energy
    Note: Zugl.: Univ. of Iceland, Reykjavík,MSc thesis, 2016
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Call number: S 05.0369(2016,6)
    In: Report / United Nations University, Geothermal Training Programme
    Type of Medium: Series available for loan
    Pages: VIII, 75 Seiten , Illustrationen
    ISBN: 9789979684107
    Series Statement: Report / United Nations University Geothermal Training Programme 2016, 6
    Classification:
    Geothermal Energy
    Note: Zugl.: Univ. of Iceland, Reykjavík, MSc thesis, 2016
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Series available for loan
    Series available for loan
    Reykjavík : Orkustofnun
    Associated volumes
    Call number: S 05.0369(2016,7)
    In: Report
    Type of Medium: Series available for loan
    Pages: IV, 55 Seiten , Illustrationen
    ISBN: 9789979680114
    Series Statement: Report / United Nations University Geothermal Training Programme 2016, 7
    Classification:
    Geothermal Energy
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Monograph available for loan
    Monograph available for loan
    Berlin [u.a.] : Springer
    Call number: IASS 16.90416
    Type of Medium: Monograph available for loan
    Pages: XV, 319 Seiten , Illustrationen
    Edition: 2., rev. and enl. ed., softcover repr. of the hardcover 2. ed.
    ISBN: 9783642783265 , 9783642783241 (electronic)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Monograph available for loan
    Monograph available for loan
    Berlin ; New York : Walter de Gruyter
    Call number: M 15.0091 / Büro 00.10
    Description / Table of Contents: Basiswissen RDA bietet eine Einführung in das neue, aus der angloamerikanischen Tradition stammende Katalogisierungsregelwerk RDA (Resource Description and Access), das das bisherige deutsche Regelwerk RAK ablöst. In verständlicher Sprache geschrieben und mit zahlreichen Beispielen illustriert, leistet dieses Lehrbuch praktische Hilfestellung, um den Schritt von der Theorie in die Umsetzung zu unterstützen.
    Type of Medium: Monograph available for loan
    Pages: XII, 300 S. : z.T. farb. Ill.
    ISBN: 9783110311464
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Monograph available for loan
    Monograph available for loan
    Princeton, NJ : Princeton Univ. Press
    Call number: PIK B 100-15-0144
    Type of Medium: Monograph available for loan
    Pages: 179 S.
    Edition: 1. Princeton paperback print.
    ISBN: 0691059691 (pbk.) , 9780691164168
    Series Statement: A Henry Spearman mystery
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    Monograph available for loan
    Monograph available for loan
    Princeton : Princeton University Press
    Call number: PIK D 020-15-0143 ; IASS 15.89713
    Description / Table of Contents: Complexity science-made possible by modern analytical and computational advances-is changing the way we think about social systems and social theory. Unfortunately, economists' policy models have not kept up and are stuck in either a market fundamentalist or government control narrative. While these standard narratives are useful in some cases, they are damaging in others, directing thinking away from creative, innovative policy solutions. Complexity and the Art of Public Policy outlines a new, more flexible policy narrative, which envisions society as a complex evolving system that is uncont
    Type of Medium: Monograph available for loan
    Pages: VIII, 310 S.
    ISBN: 9780691152097
    Language: English
    Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; PART I. THE COMPLEXITY FRAME FOR POLICY; Chapter 1. Twin Peaks; Chapter 2. Government With, Not Versus, the Market; Chapter 3. I Pencil Revisited: Beyond Market Fundamentalism; Chapter 4. The Complexity Policy Frame; PART II. EXPLORING THE FOUNDATIONS; Chapter 5. How Economics Lost the Complexity Vision; Chapter 6. How Macroeconomics Lost the Complexity Vision; Chapter 7. Complexity: A New Kind of Science?; Chapter 8: A New Kind of Complexity Economics?; Chapter 9. Nudging toward a Complexity Policy Frame. , PART III. LAISSEZ-FAIRE ACTIVISM IN PRACTICEChapter 10. The Economics of Influence; Chapter 11. Implementing Influence Policy; Chapter 12. Laissez-Faire Activism; Chapter 13. Getting the Ecostructure of Government Right; PART IV. THE LOST AGENDA; Chapter 14. Getting the Ecostructure of Social Science Education Right; Chapter 15. The Lost Agenda; Notes; Bibliography; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Monograph available for loan
    Monograph available for loan
    New York, NY : Cambridge Univ. Press
    Call number: AWI A11-15-89031
    Description / Table of Contents: Thermodynamics, Kinetics and Microphysics of Clouds presents a unified theoretical foundation that provides the basis for incorporating cloud microphysical processes in cloud and climate models. In particular, the book provides: • a theoretical basis for understanding the processes of cloud particle formation, evolution and precipitation, with emphasis on spectral cloud microphysics based on numerical and analytical solutions of the kinetic equations for the drop and crystal size spectra along with the supersaturation equation; • the latest detailed theories and parameterizations of drop and crystal nucleation suitable for cloud and climate models derived from the general principles of thermodynamics and kinetics; • a platform for advanced parameterization of clouds in weather prediction and climate models; • the scientific foundation for weather and climate modification by cloud seeding. This book will be invaluable for researchers and advanced students engaged in cloud and aerosol physics, and air pollution and climate research.
    Type of Medium: Monograph available for loan
    Pages: XVIII, 782 S. : graph. Darst., Kt.
    ISBN: 978-1-107-01603-3
    Language: English
    Note: Contents: Preface. - 1. Introduction. - 1.1. Relations among Thermodynamics, Kinetics, and Cloud Microphysics. - 1.2. The Correspondence Principle. - 1.3. Structure of the Book. - 2. Clouds and Their Properties. - 2.1. Cloud Classification. - 2.2. Cloud Regimes and Global Cloud Distribution. - 2.2.1. Large-Scale Condensation in Fronts and Cyclones. - 2.2.2. Sc-St Clouds and Types of Cloud-Topped Boundary Layer. - 2.2.3. Convective Cloudiness in the Intertropical Convergence Zone. - 2.2.4. Orographic Cloudiness. - 2.3. Cloud Microphysical Properties. - 2.4. Size Spectra and Moments. - 2.4.1. Inverse Power Laws. - 2.4.2. Lognormal Distributions. - 2.4.3. Algebraic Distributions. - 2.4.4. Gamma Distributions. - 2.5. Cloud Optical Properties. - Appendix A.2. Evaluation of the Integrals with Lognormal Distribution. - 3. Thermodynamic Relations. - 3.1. Thermodynamic Potentials. - 3.2. Statistical Energy Distributions. - 3.2.1. The Gibbs Distribution. - 3.2.2. The Maxwell Distribution. - 3.2.3. The Boltzmann Distribution. - 3.2.4. Bose–Einstein Statistics. - 3.2.5. Fermi–Dirac Statistics. - 3.3. Phase Rules. - 3.3.1. Bulk Phases. - 3.3.2. Systems with Curved Interfaces. - 3.4. Free Energy and Equations of State. - 3.4.1. An Ideal Gas. - 3.4.2. Free Energy and the van der Waals Equation of State for a Non-Ideal Gas. - 3.5. Thermodynamics of Solutions. - 3.6. General Phase Equilibrium Equation for Solutions. - 3.6.1. General Equilibrium Equation. - 3.6.2. The Gibbs–Duhem Relation. - 3.7. The Clausius–Clapeyron Equation. - 3.7.1. Equilibrium between Liquid and Ice Bulk Phases. - 3.7.2. Equilibrium of a Pure Water Drop with Saturated Vapor. - 3.7.3. Equilibrium of an Ice Crystal with Saturated Vapor. - 3.7.4. Humidity Variables. - 3.8. Phase Equilibrium for a Curved Interface - The Kelvin Equation. - 3.9. Solution Effects and the Köhler Equation. - 3.10. Thermodynamic Properties of Gas Mixtures and Solutions. - 3.10.1. Partial Gas Pressures in a Mixture of Gases. - 3.10.2. Equilibrium of Two Bulk Phases around a Phase Transition Point. - 3.10.3. Raoult’s Law for Solutions. - 3.10.4. Freezing Point Depression and Boiling Point Elevation. - 3.10.5. Relation of Water Activity and Freezing Point Depression. - 3.11. A diabatic Processes. - 3.11.1. Dry Adiabatic Processes. - 3.11.2. Wet Adiabatic Processes. - Appendix A.3. Calculation of Integrals with the Maxwell Distribution. - 4. Properties of Water and Aqueous Solutions. - 4.1. Properties of Water at Low Temperatures and High Pressures. - 4.1.1. Forms of Water at Low Temperatures. - 4.1.2. Forms of Water at High Pressures. - 4.2. Theories of Water. - 4.3. Temperature Ranges in Clouds and Equivalence of Pressure and Solution Effects. - 4.4. Parameterizations of Water and Ice Thermodynamic Properties. - 4.4.1. Saturated Vapor Pressures. - 4.4.2. Heat Capacity of Water and Ice. - 4.4.3. Latent Heats of Phase Transitions. - 4.4.4. Surface Tension between Water and Air or Vapor. - 4.4.5. Surface Tension between Ice and Water or Solutions. - 4.4.6. Surface Tension between Ice and Air or Vapor. - 4.4.7 Density of Water. - 4.4.8. Density of Ice. - 4.5. Heat Capacity and Einstein-Debye Thermodynamic Equations of State for Ice. - 4.6. Equations of State for Ice in Terms of Gibbs Free Energy. - 4.7. Generalized Equations of State for Fluid Water. - 4.7.1. Equations of the van der Waals Type and in Terms of Helmholtz Free Energy. - 4.7.2. Equations of State Based on the Concept of the Second Critical Point. - Appendix A.4. Relations among Various Pressure Units. - 5. Diffusion and Coagulation Growth of Drops and Crystals. - 5.1. Diffusional Growth of Individual Drops. - 5.1.1. Diffusional Growth Regime. - 5.1.2. The Kinetic Regime and Kinetic Corrections to the Growth Rate. - 5.1.3. Psychrometric Correction Due to Latent Heat Release. - 5.1.4. Radius Growth Rate. - 5.1.5. Ventilation Corrections. - 5.2. Diffusional Growth of Crystals. - 5.2.1. Mass Growth Rates. - 5.2.2. Axial Growth Rates. - 5.2.3. Ventilation Corrections. - 5.3. Equations for Water and Ice Supersaturations. - 5.3.1. General Form of Equations for Fractional Water Supersaturation. - 5.3.2. Supersaturation Relaxation Times and Their Limits. - 5.3.3. E quation for Water Supersaturation in Terms of Relaxation Times. - 5.3.4. Equivalence of Various Forms of Supersaturation Equations. - 5.3.5. Equation for Fractional Ice Supersaturation. - 5.3.6. Equilibrium Supersaturations over Water and Ice. - Liquid Clouds. - Ice Clouds. - Mixed Phase Clouds. - 5.3.7. A diabatic Lapse Rates with Non zero Supersaturations. - 5.4. The Wegener–Bergeron–Findeisen Process and Cloud Crystallization. - 5.5. Kinetic Equations of Condensation and Deposition in the Adiabatic Process. - 5.5.1. Derivation of the Kinetic Equations. - 5.5.2. Some Properties of Regular Condensation. - 5.5.3. Analytical Solution of the Kinetic Equations of Regular Condensation. - 5.5.4. Equation for the Integral Supersaturation. - 5.6. Kinetic Equations of Coagulation. - 5.6.1. Various Forms of the Coagulation Equation. - 5.6.2. Collection Kernels for Various Coagulation Processes. - Brownian Coagulation. - Gravitational Coagulation. - 5.7. Thermodynamic and Kinetic Equations for Multidimensional Models. - 5.8. Fast Algorithms for Microphysics Modules in Multidimensional Models. - 6. Wet Aerosol Processes. - 6.1. Introduction. - 6.1.1. Empirical Parameterizations of Hygroscopic Growth. - 6.1.2. Empirical Parameterizations of Droplet Activation. - 6.2. Equilibrium Radii. - 6.2.1. Equilibrium Radii at Subsaturation. - 6.2.2. Equilibrium Radii of Interstitial Aerosol in a Cloud. - 6.3. Critical Radius and Supersaturation. - 6.4. Aerosol Size Spectra. - 6.4.1. Lognormal and Inverse Power Law Size Spectra. - 6.4.2. Approximation of the Lognormal Size Spectra by the Inverse Power Law. - 6.4.3. Examples of the Lognormal Size Spectra, Inverse Power Law, and Power Indices. - 6.4.4. Algebraic Approximation of the Lognormal Distribution. - 6.5. Transformation of the Size Spectra of Wet Aerosol at Varying Humidity. - 6.5.1. Arbitrary Initial Spectrum of Dry Aerosol. - 6.5.2. Lognormal Initial Spectrum of Dry Aerosol. - 6.5.3. Inverse Power Law Spectrum. - 6.5.4. Algebraic Size Spectra. - 6.6. CCN Differential Supersaturation Activity Spectrum. - 6.6.1. A rbitrary Dry Aerosol Size Spectrum. - 6.6.2. Lognormal Activity Spectrum. - 6.6.3. Algebraic Activity Spectrum. - 6.7. Droplet Concentration and the Modified Power Law for Drops Activation. - 6.7.1. Lognormal and Algebraic CCN Spectra. - 6.7.2. Modified Power Law for the Drop Concentration. - 6.7.3. Supersaturation Dependence of Power Law Parameters. - Appendix A.6. Solutions of Cubic Equations for Equilibrium and Critical Radii. - 7. Activation of Cloud Condensation Nuclei into Cloud Drops. - 7.1. Introduction. - 7.2. Integral Supersaturation in Liquid Clouds with Drop Activation. - 7.3. Analytical Solutions to the Supersaturation Equation. - 7.4. Analytical Solutions for the Activation Time, Maximum Supersaturation, and Drop Concentration. - 7.5. Calculations of CCN Activation Kinetics. - 7.6. Four Analytical Limits of Solution. - 7.7. Limit #1: Small Vertical Velocity, Diffusional Growth Regime. - 7.7.1. Lower Bound. - 7.7.2. Upper Bound. - 7.7.3. Comparison with Twomey’s Power Law. - 7.8. Limit #2: Small Vertical Velocity, Kinetic Growth Regime. - 7.8.1. Lower Bound. - 7.8.2. Upper Bound. - 7.9. Limit #3: Large Vertical Velocity, Diffusional Growth Regime. - 7.9.1. Lower Bound. - 7.9.2. Upper Bound. - 7.10. Limit #4: Large Vertical Velocity, Kinetic Growth Regime. - 7.10.1. Lower Bound. - 7.10.2. Upper Bound. - 7.11. Interpolation Equations and Comparison with Exact Solutions. - Appendix A.7. Evaluation of the Integrals J2 and J3 for Four Limiting Cases. - 8. Homogeneous Nucleation. - 8.1. Metastable States and Nucleation of a New Phase. - 8.2. Nucleation Rates for Condensation and Deposition. - 8.2.1. Application of Boltzmann Statistics. - 8.2.2. The Fokker–Planck
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Monograph available for loan
    Monograph available for loan
    Princeton, NJ [u.a.] : Princeton Univ. Press
    Call number: PIK D 020-15-0141
    Description / Table of Contents: "Rethinking Private Authority examines the role of non-state actors in global environmental politics, arguing that a fuller understanding of their role requires a new way of conceptualizing private authority. Jessica Green identifies two distinct forms of private authority--one in which states delegate authority to private actors, and another in which entrepreneurial actors generate their own rules, persuading others to adopt them.Drawing on a wealth of empirical evidence spanning a century of environmental rule making, Green shows how the delegation of authority to private actors has played a small but consistent role in multilateral environmental agreements over the past fifty years, largely in the area of treaty implementation. This contrasts with entrepreneurial authority, where most private environmental rules have been created in the past two decades. Green traces how this dynamic and fast-growing form of private authority is becoming increasingly common in areas ranging from organic food to green building practices to sustainable tourism. She persuasively argues that the configuration of state preferences and the existing institutional landscape are paramount to explaining why private authority emerges and assumes the form that it does. In-depth cases on climate change provide evidence for her arguments.Groundbreaking in scope, Rethinking Private Authority demonstrates that authority in world politics is diffused across multiple levels and diverse actors, and it offers a more complete picture of how private actors are helping to shape our response to today's most pressing environmental problems"--
    Description / Table of Contents: Rethinking Private Authority examines the role of non-state actors in global environmental politics, arguing that a fuller understanding of their role requires a new way of conceptualizing private authority. Jessica Green identifies two distinct forms of private authority--one in which states delegate authority to private actors, and another in which entrepreneurial actors generate their own rules, persuading others to adopt them.Drawing on a wealth of empirical evidence spanning a century of environmental rule making, Green shows how the delegation of authority to private actors has played a small but consistent role in multilateral environmental agreements over the past fifty years, largely in the area of treaty implementation. This contrasts with entrepreneurial authority, where most private environmental rules have been created in the past two decades. Green traces how this dynamic and fast-growing form of private authority is becoming increasingly common in areas ranging from organic food to green building practices to sustainable tourism. She persuasively argues that the configuration of state preferences and the existing institutional landscape are paramount to explaining why private authority emerges and assumes the form that it does. In-depth cases on climate change provide evidence for her arguments.Groundbreaking in scope, Rethinking Private Authority demonstrates that authority in world politics is diffused across multiple levels and diverse actors, and it offers a more complete picture of how private actors are helping to shape our response to today's most pressing environmental problems.
    Type of Medium: Monograph available for loan
    Pages: XII, 215 S. , graph. Darst.
    ISBN: 9780691157580 (hardback) , 9780691157597 (paperback)
    Language: English
    Note: A theory of private authorityAgents of the state : a century of delegation in international environmental lawGovernors of the market : the evolution of entrepreneurial authorityAtmospheric police : delegated authority in the clean development mechanismAtmospheric accountants : entrepreneurial authority and the greenhouse gas protocol..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Monograph available for loan
    Monograph available for loan
    Amsterdam [u.a.] : Elsevier
    Description / Table of Contents: The Geologic Time Scale 2012, winner of a 2012 PROSE Award Honorable Mention for Best Multi-volume Reference in Science from the Association of American Publishers, is the framework for deciphering the history of our planet Earth. The authors have been at the forefront of chronostratigraphic research and initiatives to create an international geologic time scale for many years, and the charts in this book present the most up-to-date, international standard, as ratified by the International Commission on Stratigraphy and the International Union of Geological Sciences. This 2012 geologic time scale is an enhanced, improved and expanded version of the GTS2004, including chapters on planetary scales, the Cryogenian-Ediacaran periods/systems, a prehistory scale of human development, a survey of sequence stratigraphy, and an extensive compilation of stable-isotope chemostratigraphy.
    Type of Medium: Monograph available for loan
    ISBN: 9780444594259 (Set)
    Parallel Title: The Geologic time scale 2012
    Language: English
    Note: Erschienen: 1 - 2
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Series available for loan
    Series available for loan
    Kjeller
    Associated volumes
    Call number: S 99.0085(2-2014)
    In: Semiannual technical summary
    In: NORSAR Scientific Report
    Type of Medium: Series available for loan
    Pages: 82 S. : farb. Ill., graph. Darst., Kt.
    Series Statement: 2-2014
    Classification:
    Seismology
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Call number: PIK N 071-15-89232
    Type of Medium: Monograph available for loan
    Pages: XII, 277 S , Ill. , 24 cm
    ISBN: 0857939246 (hbk.) , 9780857939241 (hbk.) , 9781783472840 (pbk.)
    Language: English
    Note: PART I: THEORETICAL PERSPECTIVES ON MULTILEVEL GOVERNANCE ; 1. Introduction ; 2. Too Many Levels or Just About Right? Multilevel Governance and Environmental Performance ; PART II: MULTILEVEL GOVERNANCE OF WATER RESOURCES ; 3. Subsidiarity as a ‘Scaling Device’ in Environmental Governance: The Case of the European Union ; 4. Multilevel Governance and the Politics of Environmental Water Recoveries ; 5. Playing a Zero Sum Game: Sharing Water between Jurisdictions in Federations ; PART III: MULTILEVEL GOVERNANCE OF CLIMATE CHANGE MITIGATION ; 6. Climate Governance in the European Union Multi-level System: The Role of the Cities ; 7. Bottom-up versus Top-down: The Evolving American Climate Policy Odyssey ; 8. Institutional Strength, Intergovernmental Relations, and National Climate Policy Coordination: Australia and Canada Compared ; 9. Allocating Greenhouse Gas Emission Reductions Amongst Sectors and Jurisdictions in Federated Systems: The European Union, Germany and Canada ; PART IV: FINDINGS ON EFFECTIVENESS AND GOVERNANCE PATTERNS ; 10. Ensuring the Effectiveness of European Union Environmental Law: From Supranational Lawmaking to Multilevel Enforcement ; 11. What is Multilevel Environmental Governance? When Does It Work?
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    Call number: PIK N 071-16-89635
    Type of Medium: Monograph available for loan
    Pages: 101 S. : Ill.
    Series Statement: Benediktbeurer Gespräche der Allianz Umweltstiftung 19
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Monograph available for loan
    Monograph available for loan
    London [u.a.] : Verso
    Call number: IASS 16.90268
    Description / Table of Contents: "The financial crisis keeps us on edge and creates a diffuse sense of helplessness. Well-nigh unfathomable problems lead to measures that seem like emergency operations on the open heart of the Western world, performed with no knowledge of the patient's clinical history. The gravity of the situation is matched by the paucity of our understanding of it, and of how it came about in the first place. In this book, compiled from his Adorno Lectures given in Frankfurt, Wolfgang Streeck lays bare the roots of the present financial, fiscal and economic crisis, seeing it as part of the long neoliberal transformation of postwar capitalism that began in the 1970s. Linking up with the crisis theories of that decade, he analyses the subsequent tensions and conflicts involving states, governments, voters and capitalist interests--a process in which the defining focus of the European state system has shifted from taxation through debt to budgetary "consolidation." The book then ends by exploring the prospects for a restoration of social and economic stability. Buying Time is a model of enlightenment. It shows that something deeply disturbing underlies the current situation: a metamorphosis of the whole relationship between democracy and capitalism"--
    Description / Table of Contents: "The financial and economic crisis that began in 2008 still has the world on tenterhooks. The gravity of the situation is matched by a general paucity of understanding about what is happening and how it started. In this book, based on his 2012 Adorno Lectures given in Frankfurt, Wolfgang Streeck places the crisis in the context of the long neoliberal transformation of postwar capitalism that began in the 1970s. He analyses the subsequent tensions and conflicts involving states, governments, voters and capitalist interests, as expressed in inflation, public debt, and rising private indebtedness. Streeck traces the transformation of the tax state into a debt state, and from there into the consolidation state of today. At the centre of the analysis is the changing relationship between capitalism and democracy, in Europe and elsewhere, and the advancing immunization of the former against the latter"--
    Type of Medium: Monograph available for loan
    Pages: XVIII, 220 S. , graph. Darst. , 21 cm
    ISBN: 1781685495 (hbk) , 9781781685495 (hbk) , 1781685487 (pbk) , 9781781685488 (pbk) , 9781781685501 (electr.; US) , 9781781685518 (electr.; UK)
    Uniform Title: Gekaufte Zeit. 〈engl.〉
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    Call number: PIK P 037-15-89078
    In: Elbegebiet, Teil I ; Von der Grenze zur CR bis zur Havelmündung
    Type of Medium: Series available for loan
    Pages: 222 S., 1 Karte
    ISSN: 0948-9126
    Series Statement: Elbegebiet, Teil I Von der Grenze zur CR bis zur Havelmündung
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Call number: M 15.89082
    Type of Medium: Monograph available for loan
    Pages: 460 S , Ill , 24 cm
    Edition: 1. Aufl
    ISBN: 3836226154 (kart.) , 9783836226158 (kart.)
    Series Statement: SAP press
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    Monograph available for loan
    Monograph available for loan
    Wien : Mandelbaum
    Call number: IASS 16.89858
    Type of Medium: Monograph available for loan
    Pages: 147 S. , 21 x 14 cm
    Edition: 1. Aufl.
    ISBN: 9783854764014
    Series Statement: Journal für Entwicklungspolitik - JEP 28.2012,3
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Call number: IASS 16.89938
    Description / Table of Contents: Unverändert gilt die Einschätzung von O. Kaptein zur 1. Auflage (ID-B 29/11), dass dieses Buch weniger einen touristischen Sinn erfüllt, sondern vielmehr als Hilfsmittel zur Projektplanung oder zu schulischen Zwecken dienen kann, für alle, die auf der Suche nach Vorzeigeprojekten der verschiedenen Formen von erneuerbaren Energien in einer bestimmten Gegend sind. Viele Kaufinteressenten hatten dies unter dem Label "Baedeker" missverstanden, was entsprechend säuerliche Bewertungen im Internet zur Folge hatte. Daher ist dieser Führer definitiv besser im Bestand zu den erneuerbaren Energien als bei der Reiseliteratur aufgehoben und rechtfertigt dort durchaus die breite Empfehlung für die genannte Zielgruppe. Gegenüber der 1. Auflage wurden die Touren herausgenommen und durch "Specials" zu Metropolregionen ersetzt, rund 30 neue Ziele wurden aufgenommen und die Angaben aktualisiert. Wo die Vorauflage gut genutzt wird, sollte sie um die vorliegende ergänzt werden. (2 A) (LK/LEV: Junker)
    Description / Table of Contents: Vorstellung von rund 190 in Deutschland umgesetzten Projekten zu erneuerbaren Energien, mit Basisinformationen, Wegbeschreibungen und Weblinks. Nützlich für thematisch Interessierte, die Praxisbeispiele in einer bestimmten Region besichtigen möchten. (LK/LEV: Junker)
    Type of Medium: Monograph available for loan
    Pages: 195 S. , zahlr. Ill. (farb.), graph. Darst., Kt. , 19 cm
    Edition: 2. Aufl., Red.-Schluss: 12/2013
    ISBN: 9783829714952
    Series Statement: Baedeker
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Monograph available for loan
    Monograph available for loan
    Princeton [u.a.] : Princeton Univ. Press
    Call number: PIK M 490-16-89502
    Description / Table of Contents: Agent-based modeling is a new technique for understanding how the dynamics of biological, social, and other complex systems arise from the characteristics and behaviors of the agents making up these systems. This innovative textbook gives students and scientists the skills to design, implement, and analyze agent-based models. It starts with the fundamentals of modeling and provides an introduction to NetLogo, an easy-to-use, free, and powerful software platform. Nine chapters then each introduce an important modeling concept and show how to implement it using NetLogo. The book goes on to present strategies for finding the right level of model complexity and developing theory for agent behavior, and for analyzing and learning from models. Agent-Based and Individual-Based Modeling features concise and accessible text, numerous examples, and exercises using small but scientific models. The emphasis throughout is on analysis--such as software testing, theory development, robustness analysis, and understanding full models--and on design issues like optimizing model structure and finding good parameter values. The first hands-on introduction to agent-based modeling, from conceptual design to computer implementation to parameterization and analysis Filled with examples and exercises, with updates and supplementary materials at www.railsback-grimm-abm-book.com Designed for students and researchers across the biological and social sciences Written by leading practitioners.
    Type of Medium: Monograph available for loan
    Pages: XVIII, 329 S. , Ill., graph. Darst.
    ISBN: 9780691136745 (pbk.) , 9780691136738 (hardback)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Monograph available for loan
    Monograph available for loan
    Harlow [u.a.] : Pearson/Prentice Hall
    Call number: PIK M 390-16-89504
    Type of Medium: Monograph available for loan
    Pages: VIII, 184 S. , graph. Darst.
    Edition: 5. ed.
    ISBN: 9780273728894 (pbk.)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...