ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • 2015-2019  (22)
  • 2010-2014  (1,089,997)
  • 2005-2009  (428,287)
  • 1970-1974  (8)
  • 2012  (652,999)
  • 2010  (437,019)
  • 2006  (428,279)
Collection
Language
Years
Year
  • 1
    Monograph available for loan
    Monograph available for loan
    Footscray, Vic. : Lonely Planet
    Call number: 1.8/M 10.0326
    Type of Medium: Monograph available for loan
    Pages: 392 S.
    Edition: 7th ed.
    ISBN: 9781741049985
    Series Statement: Lonely planet
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    Monograph available for loan
    Monograph available for loan
    Footscray, VIc. : Lonely Planet
    Call number: 1.8/M 10.0343
    Type of Medium: Monograph available for loan
    Pages: 636 S.
    Edition: 11th ed.
    ISBN: 9781741048872
    Series Statement: Lonely planet
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
  • 4
    Monograph available for loan
    Monograph available for loan
    Footscray, VIc. : Lonely Planet
    Call number: 1.8/M 10.0347
    Type of Medium: Monograph available for loan
    Pages: 1216 S.
    Edition: 6th ed.
    ISBN: 9781741792355
    Series Statement: Lonely planet
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    Monograph available for loan
    Monograph available for loan
    München : Frederking & Thaler
    Call number: 4/M 06.0499
    Type of Medium: Monograph available for loan
    Pages: 311 S. : überw. farb. Ill., Kt.
    ISBN: 3894056703
    Uniform Title: Planet earth
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    Call number: M 06.0581
    Description / Table of Contents: Contents: 1. Spectroscopic measurements of tropospheric composition from satellite measurements in the ultraviolet and visible: Steps toward continuous pollution monitoring from space. 2. ESA spectroscopy studies in support of spaceborne atmospheric composition sounding.- 3. The MIPAS experiment aboard ENVISAT: remote sensing of atmospheric composition.- 4. Performance of the operational retrieval code for MIPAS on ENVISAT and possible improvements of retrieval techniques for environment and climate.- 5. New measurements of trace species in the upper troposphere from infra-red spectra of the atmosphere.- 6. Remote sensing of the Non-LTE atmosphere.- 7. Quantitative spectroscopy and atmospheric measurements.- 8. Quantitative laboratory spectroscopy of atmospheric trace gases.- 9. Global modeling of high-resolution spectra of linear molecules CO2, N2O and C2H2.- 10. CDSD-296, the high-precision carbon dioxide spectroscopic databank: version for atmospheric applications.- 11. Theoretical quantitative spectroscopy: computer simulation of molecular spectra.- 12. Recent results on infrared molecular line broadening and shift parameters.- 13. Half-widths and line shifts of water vapor for atmospheric applications: measurement and theory.- 14. Quantitative rotational spectroscopy for atmospheric research.- 15. Pressure-broadening of the 22.2 GHz line of water: basic results for remote sensing of the atmosphere.- 16. Rotational spectroscopy at the Jet Propulsion Laboratory.- 17. Correlation between precipitable water and rainfall using Global Positioning System (GPS) technique.- 18. Extreme variability of aerosol optical properties: the Cairo aerosol characterization experiment case study.- 19. Urban air pollution and its photochemistry studied by laser spectroscopic.
    Type of Medium: Monograph available for loan
    Pages: VII, 353 S.
    ISBN: 1402050895
    Series Statement: NATO security through science series : C, Environmental security
    Classification:
    Photogrammetry, Remote Sensing
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Call number: M 16.89641
    Type of Medium: Monograph available for loan
    Pages: 320 S. , graph Darst., Tab. , 168 mm x 240 mm
    Edition: 1. Aufl.
    ISBN: 9783836217187
    Series Statement: SAP PRESS
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Call number: IASS 16.89650
    Type of Medium: Monograph available for loan
    Pages: 128 S , überw. Ill , 245 mm x 190 mm
    Edition: 1. Aufl.
    ISBN: 9783852566078
    Language: German , Italian , English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    Call number: IASS 16.89646
    Type of Medium: Monograph available for loan
    Pages: 812 S , graph. Darst. , 23 cm
    Edition: 2., überarb. und erw. Aufl
    ISBN: 3895188654 (Geb.) , 9783895188657 (Geb.)
    Series Statement: Grundlagen der Wirtschaftswissenschaft 15
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Call number: S 00.0063(48)
    In: Schriftenreihe der Deutschen Gesellschaft für Geowissenschaften
    Type of Medium: Series available for loan
    Pages: 158 S.
    ISBN: 3932537440
    Series Statement: Schriftenreihe der Deutschen Gesellschaft für Geowissenschaften 48
    Classification:
    E.7.
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    Call number: 13/ZSP-166(194)
    In: Proceedings of the ocean drilling program [Elektronische Ressource]
    Type of Medium: Series available for loan
    Pages: 1 CD-ROM , Booklet (XV, 21 S.) , 12 cm
    Series Statement: Proceedings of the ocean drilling program [Elektronische Ressource] : Scientific results 194.2001
    Classification:
    Oceanology
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 13
    Call number: PIK D 025-16-89988
    Type of Medium: Monograph available for loan
    Pages: XXVIII, 186 Seiten , 21 cm
    ISBN: 9780262019125 (hardcover)
    Series Statement: Belfer center studies in international security
    Uniform Title: Interviews. Selections
    Language: English
    Note: The future of China -- The future of the United States -- The future of U.S.-China relations -- The future of India -- The future of Islamic extremism -- The future of national economic growth -- The future of geopolitics and globalization -- The future of democracy -- How Lee Kuan Yew thinks -- Conclusion..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 14
    Call number: IASS 16.89651
    Description / Table of Contents: Ein- und Zweifamilienhäuser bilden vor allem in Westdeutschland einen großen und wichtigen Teil des Wohnungsbestandes. Insbesondere die Einfamilienhausgebiete der 1950er bis 1970er Jahre haben damals einen wesentlichen Beitrag zur quantitativen und qualitativen Verbesserung der Wohnsituation geleistet. In den kommenden Jahren stehen diese Bestände vor erheblichen Veränderungsprozessen.
    Type of Medium: Monograph available for loan
    Pages: 303 S. , zahlr. Ill., graph. Darst., Kt.
    ISBN: 9783933249791
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Monograph available for loan
    Monograph available for loan
    Washington, DC : The National Academies Press
    Call number: IASS 16.89655
    Type of Medium: Monograph available for loan
    Pages: XXIII, 573 S. , graph. Darst. , 23 cm
    ISBN: 9780309255516 (softcover)
    Series Statement: Comparative innovation policy
    Language: English
    Note: Chapter 1: The innovation challenge: America's innovation challenges -- New trends in global innovation -- The pillars of U.S. innovative strength -- Responding to the innovation challenge -- Chapter 2: Sustaining leadership in innovation: Improving framework conditions, substantially increasing R&D funding, institutional support for applied research -- Strengthening manufacturing -- Providing early stage finance -- Developing twenty-first century universities -- Investing in modern S&T parks -- Growing innovation clusters -- Hunting for global talent, the way forward -- Chapter 3: Findings -- Chapter 4: Recommendations -- Chapter 5: The new global competitive environment: Emerging powers -- Newly industrialized economies -- Industrialized nation case studies -- Chapter 6: National support for emerging industries: Seminconductors -- The photovoltaic industry -- Advanced batteries -- Pharmaceuticals and biopharmaceuticals -- In closing -- Chapter 7: Clusters and regional initiatives: The innovation challenge, policies to foster innovation, regional innovation clusters -- Twenty-first century research and industry -- In closing..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    Call number: IASS 16.90356
    Type of Medium: Monograph available for loan
    Pages: xviii, 1140 Seiten , Illustrationen
    ISBN: 9781849712354
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
    Call number: 9/90.0095(407)
    Type of Medium: Monograph available for loan
    Pages: X, 359 S. , Ill., graph. Darst., Kt. , 28 cm
    ISBN: 0813724074 , 9780813724072
    Series Statement: Special paper / Geological Society of America 407
    Language: English
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 18
    Monograph available for loan
    Monograph available for loan
    Chicago [u.a.] : The University of Chicago Press
    Call number: IASS 16.90032
    Type of Medium: Monograph available for loan
    Pages: XLVI, 217 S.
    Edition: 4. ed., 50th anniversary ed.
    ISBN: 0226458113 (cloth) , 9780226458113 (cloth) , 0226458121 (paperback) , 9780226458120 (paperback)
    Language: English
    Note: Introductory essay / by Ian Hacking -- Preface -- Introduction: a role for history -- The route to normal science -- The nature of normal science -- Normal science as puzzle-solving -- The priority of paradigms -- Anomaly and the emergence of scientific discoveries -- Crisis and the emergence of scientific theories -- The response to crisis -- The nature and necessity of scientific revolutions -- Revolutions as changes of world view -- The invisibility of revolutions -- The resolution of revolutions -- Progress through revolutions -- Postscript-1969..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 19
    Monograph available for loan
    Monograph available for loan
    New York : Columbia University Press
    Call number: IASS 16.90522
    Type of Medium: Monograph available for loan
    Pages: IX, 294 S.
    ISBN: 9780231137416 (pbk) , 9780231137409 (cloth) , 9780231510448 (e-book)
    Series Statement: Columbia studies in political thought, political history
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 20
    Monograph available for loan
    Monograph available for loan
    Novato, Calif. :New World Library,
    Call number: IASS 16.90550
    Type of Medium: Monograph available for loan
    Pages: xiv, 272 p. : , ill. ; , 22 cm.
    ISBN: 9781577319726 (pbk. : alk. paper)
    Language: English
    Note: Three stories of our time -- Trusting the spiral -- Coming from gratitude -- Honoring our pain for the world -- A wider sense of self -- A different kind of power -- A richer experience of community -- A larger view of time -- Catching an inspiring vision -- Daring to believe it is possible -- Building support around you -- Maintaining energy and enthusiasm -- Strengthened by uncertainty.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 21
    Monograph available for loan
    Monograph available for loan
    Amsterdam [u.a.] : Elsevier
    Call number: 9/M 16.90207
    Description / Table of Contents: "The geochemistry and chemistry of sulfur, iron and iron sulfides in sedimentary systems is reviewed. Sulfur microbiology is described and the microbial ecology of sulfidic sediments is discussed. Sulfur and iron stable isotope biochemistry is addressed against the background of recent advances in this field with respect to sedimentary and microbial systems. Environmental aspects of the present sedimentary sulfur cycle are considered with special references to the development of euxinia and global anoxic events. The biogeochemistry of ancient sulphur-rich sediments is considered and the evolution of the sedimentary sulfur system is discussed against the background of the evolution of the Earth surface environment. The evolution of the sulfur biome and its impact of the early development of life on Earth are discussed."--Cover
    Type of Medium: Monograph available for loan
    Pages: IX, 801 Seiten , Ill., graph. Darst. , 24 cm
    ISBN: 9780444529893
    Series Statement: Developments in sedimentology 65
    Classification:
    Sedimentology
    Language: English
    Note: Introduction -- Sulfur chemistry in aqueous solutions -- Sedimentary iron biogeochemistry -- Aqueous metal-sulfide chemistry: complexes, clusters and nanoparticles -- Metastable sedimentary iron sulfides -- Sedimentary pyrite -- Metal sequestration by sedimentary iron sulfides -- Microbial sulfate reduction in sediments -- Microbial sulfide oxidation in sediments -- Microbial ecology of sulfidic sediments -- Sedimentary sulfur isotope biogeochemistry -- Iron isotope fractionation in sedimentary sulfides -- Euxinic systems -- Sedimentary sulfides -- The geochemistry of sulfidic sedimentary rocks -- Fossil bacteria: evidence for the evolution of the sulfur biome -- The evolution of the sedimentary sulfur cycle..
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    Monograph available for loan
    Monograph available for loan
    Göttingen : Optimus-Verl.
    Call number: M 17.90710
    Type of Medium: Monograph available for loan
    Pages: V, 162 S. , Ill., graph. Darst. , 21 cm, 290 g
    Edition: 2. Aufl.
    ISBN: 9783863760175
    Series Statement: Espresso-Tutorials
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
    Call number: PIK N 076-17-90558
    Description / Table of Contents: Extreme weather and climate events, interacting with exposed and vulnerable human and natural systems, can lead to disasters. This Special Report explores the social as well as physical dimensions of weather- and climate-related disasters, considering opportunities for managing risks at local to international scales. SREX was approved and accepted by the Intergovernmental Panel on Climate Change (IPCC) on 18 November 2011 in Kampala, Uganda
    Type of Medium: Monograph available for loan
    Pages: X, 582 S. , graph. Darst., Kt.
    Edition: 1. publ.
    ISBN: 9781107607804 ((pbk.)) , 9781107025066 ((hbk.))
    Parallel Title: Online-Ausg. Managing the risks of extreme events and disasters to advance climate change adaptation
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 24
    Monograph available for loan
    Monograph available for loan
    Berlin [u.a.] : Springer
    Call number: IASS 16.90416
    Type of Medium: Monograph available for loan
    Pages: XV, 319 Seiten , Illustrationen
    Edition: 2., rev. and enl. ed., softcover repr. of the hardcover 2. ed.
    ISBN: 9783642783265 , 9783642783241 (electronic)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Monograph available for loan
    Monograph available for loan
    Baden-Baden : Nomos
    Call number: IASS 16.90460
    Type of Medium: Monograph available for loan
    Pages: 444 S. , graph. Darst.
    Edition: 1. Aufl.
    ISBN: 3832978097 , 9783832978099
    Series Statement: Forum Umweltrecht 63
    Language: German
    Note: Zugl.: Hamburg, Univ., FB Rechtswiss., Diss., 2011
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    Call number: IASS 16.90470
    Type of Medium: Monograph available for loan
    Pages: V, 279 S.
    ISBN: 047052426X (hbk) , 9780470524268 (hbk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Call number: M 17.91120
    Type of Medium: Monograph available for loan
    Pages: 609 S.
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    Call number: IASS 17.91131
    Type of Medium: Monograph available for loan
    Pages: XV, 585 S
    ISBN: 9789004202436 (hardback) , 9789004202443 (electronic; ebook)
    Language: English
    Note: Aldo Chircop ... [et al.] / Law of the sea and ocean governance : straits used for international navigation : some recent developments -- Tommy Koh / Law, economics, and politics : Trinidad and Tobago/Grenada maritime boundary delimitation -- Carlyle L. Mitchell / Regulation of high seas fisheries in the Northwest Atlantic, 1976-2010 -- A. William Moreira / The reasonable bond and the jurisprudence of the international tribunal for the law of the sea : some brief remarks -- L. Dolliver M. Nelson / Do we need a new convention on piracy and armed robbery against ships? -- Robert C. Beckman / Piracy across maritime law : is there a problem of definition? -- Aref Fakhry / Governance in the Arctic Ocean : a commentary on the Great Arctic melt and its potential impact on global shipping patterns -- Brian Flemming / Russia's northern sea route - much to do -- R. Douglas Brubaker with Claes Lykke Ragner / The polluter pays principle : preventing ship-source pollution in the Arctic -- Kenneth A. MacInnis / Regional cooperation in the South China Sea and the Arctic : lessons to be learned? -- David L. VanderZwaag and Hai Dang Vu / Shipping and international maritime law : the treaty-making work of the legal committee of the international maritime organization -- Alfred Popp / Will insurance cover that? a review of the challenges faced by coastal states seeking to recoup costs for removal of wrecks under the Nairobi wreck removal convention -- Eric Machum and Frank Metcalf / The urgency of reducing air pollution from global shipping -- Sherry P. Broder and Jon M. Van Dyke / Maritime cabotage : international market issues in the liberalization of domestic shipping -- Mary R. Brooks / Safer ships and cleaner seas : the insurer's role -- Kjetil Eivindstad and Christopher Petrie / Economic losses and environmental damage in the law of ship-source pollution -- Proshanto K. Mukherjee / Marine oil and gas pollution spills in Australian waters -- Vincent Cogliati-Bantz ... [et al.] / Forging or foregoing the 'Genuine Link'? a reflection on the maritime labour convention, 2006 and other approaches -- Moira L. McConnell / Seafaring and maritime labour law : perceptions and attitudes of seafarers towards maritime regulations : an historical perspective -- Alastair Couper / The continuing criminalization of seafarers : where to go from here? -- Sarah M. Kirby / Seafarers' welfare development in Southeast Asia : a commentary -- Nien-Tsu Alfred Hu / Reflections on a changing industry and the seafaring profession -- Angus McDonald / Future sea captains : environmentally responsible global citizens -- Arthur J. Hanson / Canadian maritime law : Canada's vessel traffic management regime : an overview in the context of international law -- McDorman / Forum shopping comes to Canada : the recognition of foreign maritime liens -- Norman G. Letalik / The continuing evolution of maritime law : jurisdiction in Canada -- Aldo Chircop / "Change my way of thinking" : Canadian maritime law and the Supreme Court of Canada, The Edgar Gold years -- Wylie Spicer / Selected publications of Edgar Gold..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
    Monograph available for loan
    Monograph available for loan
    London : Penguin Books
    Type of Medium: Monograph available for loan
    ISBN: 9780141985206
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 30
    Monograph available for loan
    Monograph available for loan
    München : Elsevier, Spektrum Akad. Verl.
    Call number: AWI Bio-18-91524
    Type of Medium: Monograph available for loan
    Pages: XVIII, 700 S. , Ill., zahlr. graph. Darst. , 270 mm x 196 mm
    Edition: 6. Aufl.
    ISBN: 3827415616 (Gb.) , 9783827415615 (Gb.)
    Language: German
    Note: Inhaltsverzeichnis: Vorwort. - 1 Theoretische Grundlagen und Zielsetzung der Physiologie. - 1.1 Das Selbstverständnis der Physiologie. - 1.2 Gesetzesaussagen in der Biologie. - 1.3 Systemtheorie. - 1.4 Prinzipien wissenschaftlichen Arbeitens. - 1.5 Das Kausalitätsprinzip in der Physiologie. - 1.6 Das Problem der Komplexität. - 1.7 Formulierung von Sätzen. - 1.8 Merkmale und Variabilität. - 1.9 Maßsystem und Bezugsgrößen. - 1.10 Darstellung von Daten. - 2 Die Zelle als morphologisches System. - 2.1 Die meristematische Pflanzenzelle. - 2.1.1 Strukturelle Gliederung. - 2.1.2 Endoplasmatisches Reticulum. - 2.1.3 Zellkern (Nucleus). - 2.1.4 Golgi-Apparat. - 2.1.5 Peroxisomen. - 2.1.6 Mitochondrien und Piastiden. - 2.1.7 Cytoskelett. - 2.1.8 Zellwand. - 2.2 Zellteilung. - 2.2.1 Cytokinese und Karyokinese. - 2.2.2 Regulation des Zellcyclus. - 2.2.3 Determination der Teilungsebene. - 2.3 Zelldifferenzierung. - 2.4 Zeil- und Organpolarität. - 2.5 Die Evolution der Pflanzenzelle. - 2.6 Vom einzelligen zum vielzelligen Organismus. - 3 Die Zelle als energetisches System. - 3.1 Der 1. Hauptsatz der Thermodynamik. - 3.2 Der 2. Hauptsatz der Thermodynamik. - 3.3 Die Zelle als offenes System, Fließgleichgewicht. - 3.4 Chemisches Potenzial. - 3.5 Chemisches Potenzial von Wasser. - 3.6 Anwendung des Wasserpotenzialkonzepts auf den Wasserzustand der Zelle. - 3.6.1 Die Zelle als osmotisches System. - 3.6.2 Das Osmometermodell. - 3.6.3 Die Zelle als Osmometeranalogon. - 3.6.4 Das Matrixpotenzial. - 3.6.5 Nomenklatorische Schwierigkeiten. - 3.6.6 Das osmotische Zustandsdiagramm der Zelle (Höfler-Diagramm). - 3.6.7 Die experimentelle Messung von π und ψ. - 3.6.8 Regulation des Wasserzustandes. - 3.7 Chemisches Potenzial von Ionen. - 3.8 Membranpotenzial. - 3.9 Energetik biochemischer Reaktionen. - 3.10 Phosphatübertragung und Phosphorylierungspotenzial. - 3.11 Redoxsysteme und Redoxpotenzial. - 4 Die Zelle als metabolisches System. - 4.1 Biologische Katalyse. - 4.1.1 Aktivierungsenergie. - 4.1.2 Enzymatische Katalyse. - 4.1.3 Enzymkinetik. - 4.1.4 Messung der Enzymaktivität. - 4.1.5 Modulation der Enzymaktivität. - 4.2 Metabolische Kompartimentierung der Zelle. - 4.3 Transportmechanismen an Biomembranen. - 4.3.1 Diffusion und Permeation. - 4.3.2 Spezifität des Membrantransports, Transportkatalyse. - 4.3.3 Transporter, Ionenpumpen und Ionenkanäle. - 4.3.4 Aquaporine. - 4.3.5 Passiver und aktiver Transport. - 4.3.6 Shuttle-Transport. - 4.4 ATP-Synthese an energietransformierenden Biomembranen. - 4.5 Stoffaufnahme in die Zelle. - 4.5.1 Ionenaufnahme. - 4.5.2 Aufnahme von Anelektrolyten. - 4.5.3 Akkumulation von Metaboliten und anorganischen Ionen in der Vacuole. - 4.6 Prinzipien der metabolischen Regulation. - 4.6.1 Ebenen der Regulation. - 4.6.2 Regulation des Enzymgehalts. - 4.6.3 Regulation des Aktivitätszustands bei konstantem Enzymgehalt. - 4.6.4 Intrazelluläre und interzelluläre Signaltransduktion. - 4.6.5 Die Integration der Regulationsmechanismen zum Kontrollsystem. - 5 Die Zelle als wachstumsfähiges System. - 5.1 Biophysikalische Grundlagen des Zellwachstums. - 5.1.1 Hydraulisches Zellwachstum. - 5.1.2 Messung der physikalischen Wachstumsparameter. - 5.2 Wachstum und Zeliwandveränderungen. - 5.2.1 Die strukturelle Dynamik der Primärwand. - 5.2.2 Diffuses Wachstum der Zellwand. - 5.2.3 Lokales Wachstum der Zellwand. - 5.3 Integration des Zellwachstums in vielzelligen Systemen. - 5.3.1 Die Epidermiswand als zellübergreifende Organwand. - 5.3.2 Streckungs-und Kontraktionswachstum bei Wurzeln. - 5.4 Zur Beziehung zwischen Zellwachstum und Zellteilung. - 5.5 Regulation des Streckungswachstums. - 6 Die Zelle als gengesteuertes System. - 6.1 Das Gen - die Einheit der genetischen Information. - 6.2 Die Organisation des Genoms. - 6.2.1 Die drei Genome der Pflanzenzelle. - 6.2.2 Genomstruktur im Zellkern. - 6.2.3 Das plastidäre Genom. - 6.2.4 Das mitochondriale Genom. - 6.3 Die Transkriptionspromotoren, RNA-Polymerasen und RNA-Reifung. - 6.3.1 Transkription nucleärer Gene. - 6.3.2 Transkription plastidärer Gene. - 6.3.3 Transkription mitochondrialer Gene. - 6.3.4 KNA-editing. - 6.4 Proteinsynthese (Translation) und Protein-turnover. - 6.4.1 Translation und Protein-turnover im Cytoplasma. - 6.4.2 Translation und Protein-turnover in Piastiden. - 6.4.3 Translation und Protein-turnover in Mitochondrien. - 6.5 Die Zelle als regulatorisches Netzwerk der Genexpression. - 6.5.1 Regulation nucleärer Gene. - 6.5.2 Regulation plastidärer Gene. - 6.5.3 Regulation mitochondrialer Gene. - 6.5.4 Evolutionäre Adaption von Regulationsstrukturen. - 7 Intrazelluläre Proteinverteilung und Entwicklung der Organellen. - 7.1 Proteinsortierung in der Pflanzenzelle. - 7.1.1 Prinzipien der Proteinsortierung. - 7.1.2 Proteinexport aus der Zelle und Import in die Vacuole. - 7.1.3 Proteintransport in die Mitochondrien. - 7.1.4 Proteintransport in die Piastiden. - 7.1.5 Isosorting - das gleiche Protein für Cytoplasma, Mitochondrien und Piastiden. - 7.1.6 Evolution der Proteintransportsysteme in Mitochondrien und Piastiden. - 7.1.7 Proteintransport in die Peroxisomen. - 7.1.8 Proteintransport in den Zellkern. - 7.2 Entwicklung der Mitochondrien. - 7.3 Entwicklung der Piastiden. - 7.4 Entwicklung der Peroxisomen. - 8 Photosynthese als Funktion des Chloroplasten. - 8.1 Photosynthese als Energiewandlung. - 8.2 Energiewandlung im Chloroplasten. - 8.2.1 Struktur der Chloroplasten. - 8.2.2 Struktur der Thylakoide. - 8.2.3 Photosynthesepigmente. - 8.2.4 Quantenmechanische Grundlagen der Lichtabsorption. - 8.2.5 Funktion der Pigmente. - 8.2.6 Energietransfer in den Pigmentkollektiven. - 8.2.7 Bildung von chemischem Potenzial. - 8.2.8 Funktionelle Verknüpfung der beiden Photosysteme. - 8.3 Die Pigmentsysteme der Rot- und Blaualgen. - 8.4 Photosynthetischer Elektronentransport. - 8.4.1 Offenkettiges System. - 8.4.2 Cyclisches System. - 8.5 Mechanismus der Photophosphorylierung. - 8.6 Der biochemische Bereich. - 8.6.1 Stoffwechselleistungen der Chloroplasten. - 8.6.2 Fixierung und Reduktion von CO2. - 8.6.3 Reduktion und Fixierung von Nitrat und Sulfat. - 8.6.4 Photosynthetische H2-Produktion. - 8.6.5 Photosynthetische N2-Fixierung. - 8.7 Regulation der photosynthetischen Teilprozesse. - 8.7.1 Regulation der Energieverteilung zwischen PSI und PSII. - 8.7.2 Regulation der ATP-Synthase-Aktivität. - 8.7.3 Regulation der CO2-Assimilation im Calvin-Cyclus. - 8.7.4 Koordination von C- und N-Assimilation. - 8.7.5 Fluoreszenzlöschung als Indikatorreaktion für die Effektivität der Photosynthese. - 8.8 Ein kurzer Blick auf die anoxygene Photosynthese der phototrophen Bakterien. - 9 Dissimilation. - 9.1 Energiegewinnung bei der Dissimilation. - 9.2 Dissimilation der Kohlenhydrate. - 9.2.1 Freisetzung chemischer Energie. - 9.2.2 Glycolyse. - 9.2.3 Fermentation (alkoholische Gärung und Milchsäuregärung). - 9.2.4 Citratcyclus und Atmungskette. - 9.2.5 Cyanidresistente Atmung. - 9.2.6 Oxidative Phosphorylierung. - 9.2.7 Elektronentransport an der Plasmamembran. - 9.2.8 Oxidativer (dissimilatorischer) Pentosephosphatcyclus. - 9.3 Photorespiration. - 9.3.1 Lichtatmung und Dunkelatmung. - 9.3.2 Photosynthese von Glycolat. - 9.3.3 Metabolisierung des photosynthetischen Glycolats im C2-Cyclus. - 9.3.4 Glycolatstoffwechsel bei Grün- und Blaualgen. - 9.4 Mobilisierung von Speicherstoffen in Speichergeweben. - 9.4.1 Natur und Lokalisierung der Speicherstoffe. - 9.4.2 Umwandlung von Fett in Kohlenhydrat. - 9.4.3 Metabolismus von Speicherpolysacchariden. - 9.4.4 Metabolismus von Speicherproteinen. - 9.5 Regulation des dissimilatorischen Gaswechsels. - 9.5.1 Atmung: CO2-Abgabe und O2-Aufnahme. - 9.5.2 Der Respiratorische Quotient. - 9.5.3 Regulation des Kohlenhydratabbaus durch Sauerstoff. - 9.5.4 Induktion der Fermentation durch Enzy
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 31
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Ulmer
    Call number: IASS 16.91046
    Description / Table of Contents: M. Latif, renommierter Meteorologe und Klimaforscher vom Helmholtz-Zentrum für Ozeanforschung Kiel, beschäftigt sich in diesem schmalen Bändchen mit den wissenschaftlichen Grundlagen, d.h. vor allem mit der Physik des Klimawandels und knüpft dabei an sein Lehrbuch der Klimaforschung "Klimawandel und Klimadynamik" (ID 36/09) an. Im Vergleich zu mancher Publikation zur Klima(wandel)debatte erörtert er ausgesprochen sachgerecht und differenziert einzelne Aspekte der globalen Erwärmung (u.a. Treibhausklima, Klimaschwankungen, Klimamodelle, Meeresspiegel, Meeresversauerung). Dabei nimmt er immer wieder Bezug auf Methoden und Weiterentwicklung der (interdisziplinären) Klimawissenschaft. Als hilfreich erweisen sich seine unter "Fazit" jeweils fett gedruckten zusammenfassenden Aussagen am Ende jeden Kapitels sowie die gut integrierten schematischen Darstellungen. Sehr empfohlen, neben L. Spandau: "Klima" (BA 8/08), für Leser, die solide, grundlegende Informationen suchen, um die komplexen Zusammenhänge des Klimas im Wandel, speziell die Bedingungen für die Erderwärmung besser zu verstehen. (2) (Helga Lüdtke)
    Description / Table of Contents: Informationen über die wissenschaftlichen Grundlagen, insbesondere die Physik des Klimawandels: Aspekte der globalen Erwärmung (u.a. Treibhausklima, Klimaschwankungen, Klimamodelle, Klimamoden, Meeresspiegel, Meeresversauerung), mit Bezug auf Methoden und die Weiterentwicklung der Klimawissenschaft. (Helga Lüdtke)
    Type of Medium: Monograph available for loan
    Pages: 119 S. , graph. Darst., Kt. , 19 cm
    ISBN: 3825235866 (UTB : Pb.) , 9783825235864 (UTB : Pb.) , 9783800129423 (Ulmer)
    Series Statement: UTB 3586
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Call number: IASS 16.91047
    Type of Medium: Monograph available for loan
    Pages: XX, 408 S. , graph. Darst , 235 mm x 155 mm
    ISBN: 9789048199044 , 9789048199051 (eBook)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Monograph available for loan
    Monograph available for loan
    [London] : Penguin Books
    Associated volumes
    Call number: IASS 17.91050
    In: Incerto
    Type of Medium: Monograph available for loan
    Pages: xxxiii, 444 Seiten , Illustrationen, Diagramme
    Edition: revised edition
    ISBN: 9780141034591
    Series Statement: Incerto / Nassim Nicholas Taleb
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Monograph available for loan
    Monograph available for loan
    New York [u.a.] : Routledge
    Call number: IASS 17.91217
    Type of Medium: Monograph available for loan
    Pages: 242 S. , graph. Darst. , 23cm
    ISBN: 0714682772 , 9780714682778 , 0714653357 (cloth)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Call number: IASS 17.91215
    Type of Medium: Monograph available for loan
    Pages: 320 S., 48 Sp. , Ill., Kt. , 26 cm
    ISBN: 3899750772 (Pp.) , 9783899750775 (Pp.)
    Series Statement: CGL studies 3
    Language: German , English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Monograph available for loan
    Monograph available for loan
    Minneapolis [u.a.] : Univ. of Minnesota Press
    Call number: IASS 18.91835
    Type of Medium: Monograph available for loan
    Pages: VIII, 299 S. , 22x14x2 cm
    ISBN: 9780816656875 , 9780816656868 , 0816656878
    Series Statement: Posthumanities 9
    Uniform Title: Cosmopolitiques 〈engl.〉
    Language: English
    Note: Aus dem Franz. übers.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    Monograph available for loan
    Monograph available for loan
    London [u.a.] : Zed Books
    Call number: IASS 18.91776
    Type of Medium: Monograph available for loan
    Pages: VIII, 254 S. , 24 cm
    ISBN: 9781780320069 (pb) , 9781780320076 (hb)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
    Monograph available for loan
    Monograph available for loan
    Berlin : Heinrich-Böll-Stiftung
    Call number: IASS 18.91696
    Type of Medium: Monograph available for loan
    Pages: 55 S , Ill.
    ISBN: 9783869280745
    Series Statement: Schriftenreihe zu Bildung und Kultur 10
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 39
    Call number: AWI S6-18-91800
    Type of Medium: Monograph available for loan
    Pages: 176 S. , zahlr. Ill.
    ISBN: 5-7696-2541-4
    Language: Russian
    Note: In kyrill. Schr.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
    Call number: M 19.92235
    Type of Medium: Monograph available for loan
    Pages: 383 S. , zahlr. Ill. , 300 mm x 240 mm
    ISBN: 9783942422017
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 41
    Journal available for loan
    Journal available for loan
    München : Altop Verlag ; 2007 -
    Call number: Z 19.92410
    Type of Medium: Journal available for loan
    Pages: 30 cm
    ISSN: 1865-4266
    Former Title: Vorg. Nachhaltiges Wirtschaften in Deutschland
    Language: German
    Note: Ungezählte Beil. ab 2010: Special , Ersch. jährl. 4x
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    Call number: AWI G7-19-92167
    Type of Medium: Monograph available for loan
    Pages: 34 Seiten , Illustrationen
    Edition: Stand: Juni 2012
    Language: German
    Note: Inhaltsverzeichnis: Vorwort. - 1. Gletscherrückgang – eine dramatische Folgereaktion des Klimawandels in den Alpen. - 2. Methoden der Gletscherforschung. - 3. Einflussfaktoren auf die Entwicklung von Gletschern in den Alpen. - 4. Bedeutung der Alpengletscher im Wasserkreislauf. - 5. Gletscher in Bayern heute – eine Bestandsaufnahme. - Nördlicher Schneeferner. - Südlicher Schneeferner. - Höllentalferner. - Watzmanngletscher. - Blaueis. - 6. Entwicklung der Gletscher in Bayern. - Historische Aufzeichnungen seit dem 18. Jahrhundert. - Systematische Erfassung der bayerischen Gletscher ab 1950. - Ausblick in die Zukunft der bayerischen Gletscher. - 7. Ein Blick nach Europa: Haben die Gletscher der Alpen eine Zukunft?. - Alpengletscher im Überblick. - Schweizer Alpengletscher. - Österreichische Alpengletscher. - Zusammenfassung. - Glossar. - Fachliteratur und Quellen. - Allgemeine Literatur zum Thema Gletscher. - Internetquellen. - Impressum.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
    Monograph available for loan
    Monograph available for loan
    Frankfurt, Main : Campus-Verlag
    Call number: IASS 19.92582
    Type of Medium: Monograph available for loan
    Pages: 320 Seiten , grafische Darstellungen , 22 cm
    ISBN: 9783593395852 (Pp.) , 3593395851
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 44
    Call number: S 94.0398(35)
    In: Abhandlungen und Berichte für Naturkunde
    Type of Medium: Series available for loan
    Pages: 130 Seiten
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
    Call number: AWI A3-20-93434-2
    In: Meteorologische Abhandlungen / Institut für Meteorologie und Geophysik der Freien Universität Berlin, Band XXXII, Heft 2
    Type of Medium: Series available for loan
    Pages: 218 Seiten , Illustrationen
    Series Statement: Meteorologische Abhandlungen / Institut für Meteorologie und Geophysik der Freien Universität Berlin 32,2
    Language: German
    Note: Zugleich: Dissertation, Freie Unversität Berlin, [ca. 1963] , INHALTSVERZEICHNIS PROBLEMSTELLUNG UND ZIELSETZUNG 1. BEMERKUNGEN ZUM BEOBACHTUNGSGELÄNDE UND ZUM BEOBACHTUNGSMATERIAL 1.1 Das Beobachtungsgelände 1.2 Das Beobachtungsmaterial 2. HOMOGENITÄTSBETRACHTUNGEN 2.1 Temperatur 2.2 Niederschlag 2.3 Wind 2.4 Sonnenschein und Bewölkung 3. TEMPERATURVERHÄLTNISSE 3.1 Monats- und Jahreswerte 3.2 Tageswerte 3.3 Pentadenwerte 3.4 Häufigkeitsbetrachtungen 3.5 Interdiurne Veränderlichkeit 3.6 Der tägliche Gang 3.7 Vorkommen bestimmter Schwellenwerte 3.71 Frost- und Eistage 3.72 Sommer- und Tropentage 4. DER WASSERGEHALT DER LUFT 4.1 Monats- und Jahreswerte 4.2 Tageswerte 4.3 Häufigkeitsbetrachtungen 4.4 Interdiurne Veränderlichkeit 4.5 Der tägliche Gang 5. BEWÖLKUNGSVERHÄLTNISSE 5.1 Monats- und Jahreswerte 5.2 Tageswerte 5.3 Häufigkeitsbetrachtungen 5.4 Der tägliche Gang 5.5 Heitere und trübe Tage 5.6 Nebel 6. SONNENSCHEIN 6.1 Monats- und Jahreswerte 6.2 Tageswerte 6.3 Der tägliche Gang 7. NIEDERSCHLAGSVERHÄLTNISSE 7.1 Monats- und Jahreswerte 7.2 Niederschlagsbereitschaft 7.3 Tageswerte 7.4 Der tägliche Gang 7.5 Häufigkeitsbetrachtungen 7.6 Niederschlags- und Trockenperioden 7.7 Niederschlag und Wind· 7.8 Schneeverhältnisse 7.81 Schneefall und Schneedecke 7.82 Schneehöhe 7.9 Gewitter 8. WINDVERHÄLTNISSE 8.1 Windrichtung 8.2 Windgeschwindigkeit 8.21 Der jährliche Gang 8.22 Häufigkeitsbetrachtungen 8.23 Sturmtage und Windstillen 8.24 Der tägliche Gang 9.ZUSAMMENFASSUNG VERZEICHNIS DER TEXTTABELLEN VERZEICHNIS DER ABBILDUNGEN LITERATURVERZEICHNIS TABELLENANHANG
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 46
  • 47
    Call number: S 03.0074(18)
    In: Abhandlungen und Berichte des Museums der Natur Gotha
    Type of Medium: Series available for loan
    Pages: 144 Seiten , Illustrationen
    Series Statement: Abhandlungen und Berichte des Museums der Natur Gotha 18
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    Monograph available for loan
    Monograph available for loan
    Berlin : VDE Verlag GmbH
    Call number: IASS 19.93028
    Type of Medium: Monograph available for loan
    Pages: XXI, 441 Seiten , graphische Darstellungen , 1 CD-ROM (12 cm) , 24 cm
    Edition: 4., revised edition
    ISBN: 9783800732425 (kart.)
    Uniform Title: OPC 〈engl.〉
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    Call number: AWI A3-20-93434
    In: Meteorologische Abhandlungen / Institut für Meteorologie und Geophysik der Freien Universität Berlin, Band XXXII, Heft 1
    Type of Medium: Series available for loan
    Pages: 121 Seiten , Illustrationen
    Series Statement: Meteorologische Abhandlungen / Institut für Meteorologie und Geophysik der Freien Universität Berlin 32,1
    Language: German
    Note: Zugleich: Dissertation, Freie Unversität Berlin, [ca. 1963] , INHALTSVERZEICHNIS PROBLEMSTELLUNG UND ZIELSETZUNG 1. BEMERKUNGEN ZUM BEOBACHTUNGSGELÄNDE UND ZUM BEOBACHTUNGSMATERIAL 1.1 Das Beobachtungsgelände 1.2 Das Beobachtungsmaterial 2. HOMOGENITÄTSBETRACHTUNGEN 2.1 Temperatur 2.2 Niederschlag 2.3 Wind 2.4 Sonnenschein und Bewölkung 3. TEMPERATURVERHÄLTNISSE 3.1 Monats- und Jahreswerte 3.2 Tageswerte 3.3 Pentadenwerte 3.4 Häufigkeitsbetrachtungen 3.5 Interdiurne Veränderlichkeit 3.6 Der tägliche Gang 3.7 Vorkommen bestimmter Schwellenwerte 3.71 Frost- und Eistage 3.72 Sommer- und Tropentage 4. DER WASSERGEHALT DER LUFT 4.1 Monats- und Jahreswerte 4.2 Tageswerte 4.3 Häufigkeitsbetrachtungen 4.4 Interdiurne Veränderlichkeit 4.5 Der tägliche Gang 5. BEWÖLKUNGSVERHÄLTNISSE 5.1 Monats- und Jahreswerte 5.2 Tageswerte 5.3 Häufigkeitsbetrachtungen 5.4 Der tägliche Gang 5.5 Heitere und trübe Tage 5.6 Nebel 6. SONNENSCHEIN 6.1 Monats- und Jahreswerte 6.2 Tageswerte 6.3 Der tägliche Gang 7. NIEDERSCHLAGSVERHÄLTNISSE 7.1 Monats- und Jahreswerte 7.2 Niederschlagsbereitschaft 7.3 Tageswerte 7.4 Der tägliche Gang 7.5 Häufigkeitsbetrachtungen 7.6 Niederschlags- und Trockenperioden 7.7 Niederschlag und Wind· 7.8 Schneeverhältnisse 7.81 Schneefall und Schneedecke 7.82 Schneehöhe 7.9 Gewitter 8. WINDVERHÄLTNISSE 8.1 Windrichtung 8.2 Windgeschwindigkeit 8.21 Der jährliche Gang 8.22 Häufigkeitsbetrachtungen 8.23 Sturmtage und Windstillen 8.24 Der tägliche Gang 9.ZUSAMMENFASSUNG VERZEICHNIS DER TEXTTABELLEN VERZEICHNIS DER ABBILDUNGEN LITERATURVERZEICHNIS TABELLENANHANG
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    Monograph available for loan
    Monograph available for loan
    Darmstadt : WBG, Wiss. Buchges.
    Call number: M 20.93926
    Description / Table of Contents: Das Abschmelzen der Polkappen und der Anstieg des Meeresspiegels sowie die daraus resultierenden Veränderungen des Planeten gehören zu den Hauptängsten der Menschheit im 21. Jahrhundert. Umso erstaunlicher ist es, dass sich Philosophie und Ethik bislang noch nicht intensiver mit der Problematik beschäftigt haben. James Garvey liefert mit seinem nun auch auf Deutsch vorliegenden Werk eine grundlegende philosophische Auseinandersetzung mit dem Thema Klimawandel. Eindringlich beschreibt er zunächst die ökologischen Probleme, die uns in den nächsten Jahrzehnten beschäftigen werden, sowie die daraus resultierenden philosophisch-ethischen Fragen. Dann entwickelt er mit zahlreichen Beispielen eine Ethik, die den neuen Herausforderungen gerecht werden kann. Auf lebendige und stilistisch ansprechende Weise zeigt er, dass ein Wandel im gesellschaftlichen Denken und Handeln auch und gerade von der Philosophie ausgehen muss, um nachhaltige Wirkung zeigen zu können.
    Type of Medium: Monograph available for loan
    Pages: 176 Seiten , Illustrationen
    ISBN: 978-3-534-23540-7
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
    Monograph available for loan
    Monograph available for loan
    Cambridge, Mass. [u.a.] : Harvard Univ. Press
    Call number: M 21.94578
    Description / Table of Contents: Elegant data and ideas deserve elegant expression, argues Helen Sword in this lively guide to academic writing. For scholars frustrated with disciplinary conventions, and for specialists who want to write for a larger audience but are unsure where to begin, here are imaginative, practical, witty pointers that show how to make articles and books a pleasure to read -- and to write. Dispelling the myth that you cannot get published without writing wordy, impersonal prose, Sword shows how much journal editors and readers welcome work that avoids excessive jargon and abstraction. Sword's analysis of more than a thousand peer-reviewed articles across a wide range of fields documents a startling gap between how academics typically describe good writing and the turgid prose they regularly produce. Stylish Academic Writing showcases a range of scholars from the sciences, humanities, and social sciences who write with vividness and panache. Individual chapters take up specific elements of style, such as titles and headings, chapter openings, and structure, and close with examples of transferable techniques that any writer can master. - Publisher
    Description / Table of Contents: Includes bibliographical references and index
    Type of Medium: Monograph available for loan
    Pages: 215 Seiten , graph. Darst.
    ISBN: 9780674064485
    Language: English
    Note: Rules of engagementOn being disciplined -- A guide to the style guides -- Voice and echo -- Smart sentencing -- Tempting titles -- Hooks and sinkers -- The story net -- Show and tell -- Jargonitis -- Structural designs -- Points of reference -- The big picture -- The creative touch..
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 52
    Monograph available for loan
    Monograph available for loan
    Moskva : Iževsk
    Call number: AWI G3-22-94851
    Description / Table of Contents: В книге рассматриваются два природных объекта, определяющие многие особенности природы России - климат и вечная мерзлота. Представлена сложная многоплановая связь вечной мерзлоты ( ее температуры, распространения, криогенных процессов) с климатом, динамика мерзлоты под влиянием неоднократных изменений климата на протяжении последних этапов геологической истории Земли и в наше время. Изложены современные представления об изменениях климата и его причинах (естественного и антропогенного характера), периодичности колебаний. Исследуется реакция вечной мерзлоты на изменения климата - естественные (колебательные, с разными периодами колебаний) и антропогенные, включая техногенное воздействие (направленного характера). Книга написана для широкого круга специалистов - географов, геологов, инженеров, преподавателей, студентов, чья профессиональная деятельность связана с районами распространения вечной мерзлоты, а также для всех тех, кто интересуется науками о Земле.
    Description / Table of Contents: Translation of the abstract: The book deals with two natural objects that determine many of the features of Russia's nature - climate and permafrost. The complex multifaceted relationship of permafrost (its temperature, distribution, cryogenic processes) with climate is presented, the dynamics of permafrost under the influence of repeated climate changes during the last stages of the geological history of the Earth and in our time. Present-day ideas about climate change and its causes (natural and anthropogenic) and periodicity of fluctuations are presented. The reaction of permafrost to climate change - natural (oscillatory, with different periods of fluctuations) and anthropogenic, including technogenic impact (directional nature) is being studied. The book is written for a wide range of specialists - geographers, geologists, engineers, teachers, students whose professional activities are related to permafrost areas, as well as for all those who are interested in the Earth sciences.
    Type of Medium: Monograph available for loan
    Pages: 198 Seiten , Illustrationen
    ISBN: 978-5-93972-864-5
    Series Statement: Serija "Nauki o zemle"
    Language: Russian
    Note: ОГЛАВЛЕНИЕ Предисловие Глава 1. СОВРЕМЕННЫЕ ЗАКОНОМЕРНОСТИ РАСПРОСТРАНЕНИЯ ВЕЧНОЙ МЕРЗЛОТЫ (КРИОЛИТОЗОНЫ) КАК СЛЕДСТВИЕ СОВРЕМЕННОГО КЛИМАТА 1.1. Общие закономерности распространения мерзлоты 1.2. Внутрирегиональные закономерности распространения мерзлоты 1.2.1. Теплообмен между горными породами и атмосферой. Годовой тепловой баланс 1.2.2. Тепловой баланс земной поверхности и криолитозона Забайкалья 1.2.3. Тепловой баланс земной поверхности и криолитозона Западной Сибири Глава 2. СОВРЕМЕННЫЕ ПРЕДСТАВЛЕНИЯ О ГЛОБАЛЬНЫХ ИЗМЕНЕНИЯХ КЛИМАТА И ИХ ПРИЧИНАХ 2.1. Изменения климата под влиянием естественных факторов 2.2. Изменения климата под влиянием антропогенных факторов Глава 3. ДИНАМИКА КРИОЛИТОЗОНЫ КАК СЛЕДСТВИЕ ГЛОБАЛЬНЫХ ИЗМЕНЕНИЙ КЛИМАТА 3.1. Реакция вечной мерзлоты на изменения климата. Проникновение колебаний температуры воздуха в горные породы 3.2. Реакция мерзлоты на изменения климата в плейстоцене 3.3. Реакция мерзлоты на современные изменения климата 3.4. Влияние климата и его изменений на криогенные процессы 3.5. Влияние климата и его изменений на устойчивость ландшафтов криолитозоны к техногенным нагрузкам 3.6. Влияние колебаний климата на субгляциальную криолитозону Заключение Литература ПРИЛОЖЕНИЕ 1. Таблица. Средние многолетние данные метеорологических наблюдений в Забайкалье ПРИЛОЖЕНИЕ 2. Графики. Средняя месячная и средняя годовая температура грунта на склонах Центрального Забайкалья. Режимные измерения в скважинах ПРИЛОЖЕНИЕ 3. Графики. Средняя месячная и средняя годовая температура грунта в долинах рек Центрального Забайкалья. Режимные измерения в скважинах ПРИЛОЖЕНИЕ 4. Графики. Средняя месячная и средняя годовая температура грунта в Восточном Забайкалье. Режимные измерения в скважинах ПРИЛОЖЕНИЕ 5. Графики. Средняя месячная и средняя годовая температура грунта в Юго-Восточном Забайкалье. Наблюдения в скважинах ПРИЛОЖЕНИЕ 6. Таблица. Тепловой баланс поверхности и его составляющие для Западной Сибири ПРИЛОЖЕНИЕ 7. Таблица. Радиационный баланс на склонах Западной Сибири ПРИЛОЖЕНИЕ 8. Словарь терминов ПРИЛОЖЕНИЕ 9. Предметный указатель
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 53
    Call number: IASS 22.95033
    Type of Medium: Monograph available for loan
    Pages: 378 S , 225 mm x 135 mm
    ISBN: 3899421876 , 978-3-89942-187-3
    Series Statement: Edition panta rei
    Language: German
    Note: Zugl.: Marburg (Lahn), Univ., Habil.-Schr., 2004 u.d.T.: Gutmann, Mathias: Die Medialität des Erfahrens
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
    Call number: 9783034803960 (e-book)
    Type of Medium: 12
    Pages: 1 Online-Ressource (XI, 220 Seiten) , Illustrationen
    ISBN: 9783034803960 (e-book) , 978-3-0348-0396-0
    Language: English
    Note: Contents 1 High elevation treelines 1.1 The task 1.2 Previous works 2 Definitions and conventions 2.1 The life form ‘tree’ 2.2 Lines and transitions 2.3 Limitation, stress and disturbance 2.4 Altitude-related and other environmental drivers 2.5 Treeline nomenclature 3 Treeline patterns 3.1 Treeline taxa 3.2 The summit syndrome and other treeline depressions 3.3 Mass elevation effect 3.4 Treeline elevation 3.5 Time matters 3.6 Forest structure near treeline 4 Treeline climate 4.1 Specific aspects of treeline climatology 4.2 Criteria to define temperature regimes at treeline 4.3 Treeline temperatures in different bioclimatic regions 4.3.1 Subarctic and boreal zone (45–68° N) 4.3.2 Cool temperate zone (45–47° N, 44° S) 4.3.3 Warm temperate zone (28–42° N, 36° S) 4.3.4 Subtropical zone (19° S, 19° N) 4.3.5 Equatorial tropics (6° N to 3° S) 4.3.6 Mediterranean ‘treelines’ (38–42° N) 4.3.7 The Nothofagus and Metrosideros case 4.3.8 Treeline temperatures across bioclimatic zones 4.4 Seedbed and branch temperatures 4.5 Whole forest temperatures 5 Global mountain statistics based on treeline elevation 5.1 Mountain geostatistics 5.2 Elevational belts 5.3 Global treeline ecotones 6 Structure and stature of treeline trees 6.1 Foliage properties 6.2 Wood properties 6.3 Bark properties 6.4 Root traits 6.5 Tree stature 6.6 Dry matter allocation in treeline trees 7 Growth and development 7.1 Tree growth near the treeline 7.1.1 In situ growth of seedlings 7.1.2 In situ growth of saplings and adult trees 7.2 Xylogenesis at the treeline 7.2.1 In situ cambial activity 7.2.2 Apical growth dynamics 7.3 Root growth 7.4 Phenology at the treeline 8 Evolutionary adjustments to life at the treeline 8.1 Phylogenetic selection 8.2 Genotypic responses of growth and development 8.3 Genotypic responses of physiological traits 9 Reproduction, early life stages and tree demography 9.1 Amount and quality of seeds at high elevation 9.2 Germination, seedling and sapling stage 9.3 Tree demography at the treeline 10 Freezing and other forms of stress 10.1 Stress at the treeline in a fitness context 10.2 Mechanisms and principles of freezing resistance 10.3 Freezing resistance in treeline trees 10.4 Other forms of stress at the treeline 10.4.1 Freeze-thaw cycles and hydraulic failure 10.4.2 Winter desiccation 11 Water, nutrient and carbon relations 11.1 Tree water relations during the growing season 11.2 Nutrient relations 11.3 Carbon relations 12 Treeline formation - currently, in the past and in the future 12.1 Causes of current treelines 12.2 Treelines in the recent past 12.3 Treelines in the distant past (Holocene) 12.4 Treelines in the future References Subject Index Taxonomic Index
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 55
    Monograph available for loan
    Monograph available for loan
    Dordrecht : Springer
    Call number: PIK N 319-16-89764
    Type of Medium: Monograph available for loan
    Pages: IX, 242 S. , Ill., graph. Darst., Kt
    ISBN: 1402043317 , 9781402043314
    Language: English
    Note: The Sun. The formation of the stars and the Sun ; The characteristics of the Sun ; A representation of the Sun ; The internal structure of the Sun ; The photosphere, solar radiation, the solar wind ; The thermal profile of the solar atmosphere ; Solar dynamics ; The Sun: the source of space weather -- The Earth. The Earth within the solar system ; The internal structure of the Earth : the geomagnetic field ; The atmosphere of the Earth ; The magnetosphere -- Toward a space weather. The consequences of solar agressions on our technological environment ; Other impacts of solar activity ; Space weather in order to forecast -- Appendices..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 56
    Call number: S 99.0121(90)
    In: Mitteilungen
    Type of Medium: Series available for loan
    Pages: xii, 164 S. , graph. Darst.
    ISBN: 3906467600
    Series Statement: IGP Mitteilungen 90
    Classification:
    Cartography, Geographical Information Systems, GIS
    Note: Zugl.: Zürich, Eidgenössische Techn. Hochsch., Diss., 2006, No. 16474
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
    Call number: IASS 15.89494
    Type of Medium: Monograph available for loan
    Pages: Losebl.-Ausg.
    Edition: Stand: Oktober 2010
    ISBN: 9783768501828
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 58
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 91.0021(34)
    In: Mainzer geowissenschaftliche Mitteilungen
    Type of Medium: Series available for loan
    Pages: 340 S.
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 59
    Monograph available for loan
    Monograph available for loan
    Amsterdam [u.a.] : Elsevier
    Description / Table of Contents: The Geologic Time Scale 2012, winner of a 2012 PROSE Award Honorable Mention for Best Multi-volume Reference in Science from the Association of American Publishers, is the framework for deciphering the history of our planet Earth. The authors have been at the forefront of chronostratigraphic research and initiatives to create an international geologic time scale for many years, and the charts in this book present the most up-to-date, international standard, as ratified by the International Commission on Stratigraphy and the International Union of Geological Sciences. This 2012 geologic time scale is an enhanced, improved and expanded version of the GTS2004, including chapters on planetary scales, the Cryogenian-Ediacaran periods/systems, a prehistory scale of human development, a survey of sequence stratigraphy, and an extensive compilation of stable-isotope chemostratigraphy.
    Type of Medium: Monograph available for loan
    ISBN: 9780444594259 (Set)
    Parallel Title: The Geologic time scale 2012
    Language: English
    Note: Erschienen: 1 - 2
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
    Monograph available for loan
    Monograph available for loan
    München : Beck
    Call number: M 16.89690
    Type of Medium: Monograph available for loan
    Pages: 128 S. , graph. Darst.
    Edition: 3. Aufl.
    ISBN: 9783406690150
    Series Statement: Beck kompakt
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 61
    Monograph available for loan
    Monograph available for loan
    Bonn ;Boston : Galileo Press
    Call number: M 16.89804
    Type of Medium: Monograph available for loan
    Pages: 432 Seiten , zahlreiche Illustrationen , 1 Referenzkarte , 25 cm
    Edition: 3., aktualisierte und erweiterte Auflage
    ISBN: 9783836217422 (Pp.)
    Series Statement: SAP Press
    Parallel Title: Früh. Aufl. u.d.T.: Hellberg, Torsten: Einkauf mit SAP MM
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 62
    Monograph available for loan
    Monograph available for loan
    Dordrecht : Springer Netherland
    Call number: (DE-101)HT014632238
    Type of Medium: Monograph available for loan
    Pages: 900 S.
    ISBN: 1402035144
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Monograph available for loan
    Monograph available for loan
    Cheltenham [u.a.] : Elgar
    Call number: IASS 16.90010
    Description / Table of Contents: In this challenging book, John King makes a sustained and comprehensive attack on the dogma that macroeconomic theory must have 'rigorous microfoundations'. He draws on both the philosophy of science and the history of economic thought to demonstrate the dangers of foundational metaphors and the defects of micro-reduction as a methodological principle. Strong criticism of the microfoundations dogma is documented in great detail, from some mainstream and many heterodox economists and also from economic methodologists, social theorists and evolutionary biologists. The author argues for the relative autonomy of macroeconomics as a distinct 'special science', cooperating with but most definitely not reducible to microeconomics. The Microfoundations Delusion will prove a stimulating and thought-provoking read for scholars, students and researchers in the fields of economics, heterodox economics and history of economic thought
    Type of Medium: Monograph available for loan
    Pages: V, 293 S.
    ISBN: 9781782540298
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
    Non-book medium
    Non-book medium
    Berlin : DIN Deutsches Institut für Normung e. V.
    Type of Medium: Non-book medium
    Pages: Online-Ressource
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 65
    Monograph available for loan
    Monograph available for loan
    New York, NY : Springer
    Call number: PIK N 531-16-90092
    Description / Table of Contents: Ecotones are dynamic over-lapping boundary areas where major terrestrial biomes meet.  As past studies have shown, and as the chapters in this book will illustrate, their structure, size, and scope have changed considerably over the millennia, expanding and shrinking as climate and/or other driving conditions, also changed.  Today, however, many of them are changing at a rate not seen for a long time, perhaps largely due to climate change and other human-induced factors.  Indeed ecotones are more sensitive to climate change than the biomes on either side, and thus may serve as critical early indicators of future climate change.  As ecotones change, they also redefine the limits of the biomes on either side by altering their distributions of species because, in addition to their own endemic species, any ecotone will also have species from both adjoining biomes.  Consequently, they may also be places of high levels of species interaction, serving as active evolutionary laboratories, which generate new species that then migrate back into adjacent biomes.Ecotones Between Forest and Grassland explores how these ecotones have changed in the past, how they are changing today, and how they are likely to change in the future. The book includes chapters from around the world with a special focus on South American and Neotropical ecotones. 
    Type of Medium: Monograph available for loan
    Pages: XIII, 327 Seiten , Ill., graph. Darst.
    ISBN: 9781461437963 (print)
    Language: English
    Note: Ecotones Between Forest and Grassland; Preface; Contents; Contributors; Chapter 1: Introduction; 1.1 Rationale; 1.2 Case Study: The Cross Timbers; 1.3 About This Book; References; Part I: Temperate Forest-Grassland Ecotones: Prairies, Steppes, and Pampas; Chapter 2: Woodland-Grassland Ecotonal Shifts in Environmental Mosaics: Lessons Learnt from the Environmental History of the Carpathian Basin (Central Europe) During the Holocene and the Last Ice Age Based on Investigation of Paleobotanical and Mollusk Remains; 2.1 Introduction. , 2.2 Modern Woodland-Grassland Ecotone in the Carpathian Basin and Controversies Around Definitions2.3 Profiles Selected and Methods Applied in Modeling Woodland-Grassland Ecotone Shifts in the Carpathian Basin; 2.3.1 The Climate-Zonal Hypothesis Put to the Test; 2.3.2 Testing the Model of Edaphic Ecological Factors; 2.3.3 Testing the Idea of Human-Induced Ecotone Development; 2.4 The Vegetation History of the Great Hungarian Plains as Inferred from the Evaluation of Quaternary Paleoecological and Environmental Historical Data; 2.4.1 Vegetation Development During Last Ice Age. , 2.4.2 Vegetation Development During the Terminal Part of the Last Ice Age2.4.3 Vegetation Development During the Pleistocene/Holocene Transition; 2.4.4 Vegetation History of the Carpathian Basin from the Settlement of the First Farmers; 2.5 Summary; References; Chapter 3: Ecotones as Complex Arenas of Disturbance, Climate, and Human Impacts: The Trans-Andean Forest-Steppe Ecotone of Northern Patagonia; 3.1 Introduction; 3.2 Physical and Biological Setting of Forest-Steppe Ecotone of Northern Patagonia; 3.2.1 Abiotic Transition; 3.2.2 Ecosystem Properties Across the Transition. , 3.2.3 Plant Communities and Plant Diversity Across the Transition3.3 Disturbance Variation and Forest Dynamics Across the Transition; 3.3.1 Fine-Scale Disturbances; 3.3.2 Coarse-Scale Disturbances; 3.4 Direct and Disturbances-Mediated In fl uences of Climate Variability Across the Transition; 3.5 Climate, Fire, Land Use, and Long-Term Vegetation Changes Across the Transition; 3.5.1 Xeric Steppe-Woodland Belt; 3.5.2 The Nothofagus Forest-Shrubland Belt; 3.5.3 The Wet Rainforest Belt; 3.6 Conclusions; References; Chapter 4: Woody-Herbaceous-Livestock Species Interaction; 4.1 Introduction. , 4.2 Woody-Herbaceous Species Interactions and Associated Models4.3 Woodland and Grassland Stable States and Conceptual Models; 4.4 Woody-Herbaceous Ecotones; 4.5 Rates and Patterns of Woody-Herbaceous Ecotone Shift; 4.6 Woody-Herbaceous-Livestock Species Dynamics; 4.7 Other Potential Factors In fl uencing Woody-Herbaceous Species Dynamics; 4.8 Current and Future Research on Woody-Herbaceous-Livestock Species Interaction; References; Chapter 5: Woody Plant Invasions in Pampa Grasslands: A Biogeographical and Community Assembly Perspective; 5.1 Introduction. , 5.2 Woody Invasions as Hierarchical Assembly Processes.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Monograph available for loan
    Monograph available for loan
    Wien : Mandelbaum
    Call number: IASS 16.89858
    Type of Medium: Monograph available for loan
    Pages: 147 S. , 21 x 14 cm
    Edition: 1. Aufl.
    ISBN: 9783854764014
    Series Statement: Journal für Entwicklungspolitik - JEP 28.2012,3
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    Call number: IASS 16.89860
    Type of Medium: Monograph available for loan
    Pages: 238 S. , graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9783896917683
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Monograph available for loan
    Monograph available for loan
    Harlow [u.a.] : Pearson/Prentice Hall
    Call number: PIK M 390-16-89504
    Type of Medium: Monograph available for loan
    Pages: VIII, 184 S. , graph. Darst.
    Edition: 5. ed.
    ISBN: 9780273728894 (pbk.)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    Monograph available for loan
    Monograph available for loan
    Princeton [u.a.] : Princeton Univ. Press
    Call number: PIK M 490-16-89502
    Description / Table of Contents: Agent-based modeling is a new technique for understanding how the dynamics of biological, social, and other complex systems arise from the characteristics and behaviors of the agents making up these systems. This innovative textbook gives students and scientists the skills to design, implement, and analyze agent-based models. It starts with the fundamentals of modeling and provides an introduction to NetLogo, an easy-to-use, free, and powerful software platform. Nine chapters then each introduce an important modeling concept and show how to implement it using NetLogo. The book goes on to present strategies for finding the right level of model complexity and developing theory for agent behavior, and for analyzing and learning from models. Agent-Based and Individual-Based Modeling features concise and accessible text, numerous examples, and exercises using small but scientific models. The emphasis throughout is on analysis--such as software testing, theory development, robustness analysis, and understanding full models--and on design issues like optimizing model structure and finding good parameter values. The first hands-on introduction to agent-based modeling, from conceptual design to computer implementation to parameterization and analysis Filled with examples and exercises, with updates and supplementary materials at www.railsback-grimm-abm-book.com Designed for students and researchers across the biological and social sciences Written by leading practitioners.
    Type of Medium: Monograph available for loan
    Pages: XVIII, 329 S. , Ill., graph. Darst.
    ISBN: 9780691136745 (pbk.) , 9780691136738 (hardback)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Monograph available for loan
    Monograph available for loan
    Amsterdam [u.a.] : Elsevier
    Associated volumes
    Call number: 9/M 16.89731
    Type of Medium: Monograph available for loan
    Pages: XVIII, 435 S. , Ill., graph. Darst. , 1 Kt.
    ISBN: 9780444593900
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Monograph available for loan
    Monograph available for loan
    Amsterdam [u.a.] : Elsevier
    Associated volumes
    Call number: 9/M 16.89732
    Type of Medium: Monograph available for loan
    Pages: X S., S. 437 - 1144 , Ill., graph. Darst., Kt.
    ISBN: 9780444594341
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    Monograph available for loan
    Monograph available for loan
    Frankfurt am Main [u.a.] : Lang
    Call number: PIK B 050-16-89736
    Type of Medium: Monograph available for loan
    Pages: 319 S. , graph. Darst. , 210 mm x 148 mm
    ISBN: 9783631620618 (Gb.)
    Series Statement: Institutionelle und Sozial-Ökonomie 20
    Language: German
    Note: Contents: I. Grundlagen des Modell-Platonismus ; 1. Einleitung ; 2. Hans Alberts Modell-Platonismus-Vorwurf ; 3. Zur logischen Struktur neoklassischer Theorie ; 4. Das Marktmodell vollkommener Konkurrenz ; 5. Varianten der Charakterisierung neoklassischer Ökonomie ; II. Erweiterungen des Modell-Platonismus ; 6. Realitätsbezug und Informationsgehalt: Zur Grenzenlosigkeit neoklassischer Ökonomie ; 7. Axiomatische Variationen: Zur Flexibilität neoklassischer Theorie ; 8. Institutionelle Aspekte: Die Ökonomie als soziales Feld ; 9. Empirie und Evidenz: Zur Rolle von Ökonometrie und Experiment ; 10. Abschließende Bemerkungen
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
    Monograph available for loan
    Monograph available for loan
    Basingstoke, England : Palgrave Macmillan
    Call number: PIK B 160-16-90200
    Description / Table of Contents: This updated and revised edition outlines strategies and models for how to use technology and knowledge to improve performance, create jobs and increase income. It shows what skills will be required to produce, sell and manage performance over time, and how manual jobs can contribute to reduce the consumption of non-renewable resources
    Type of Medium: Monograph available for loan
    Pages: XXIII, 349 Seiten , graph. Darst.
    Edition: 2nd edition
    ISBN: 0230584667 (hbk.) , 9781349369195 (pbk.) , 9780230584662 (hbk.)
    Language: English
    Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 74
    Monograph available for loan
    Monograph available for loan
    Cheltenham [u.a.] : Elgar
    Call number: IASS 17.90839
    Type of Medium: Monograph available for loan
    Pages: XVII, 541 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 9781849809405 , 1849809402 , 9781781005446
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Monograph available for loan
    Monograph available for loan
    Berkeley, Calif : Evolver Editions
    Call number: IASS 17.90846
    Type of Medium: Monograph available for loan
    Pages: XXII, 256 S
    ISBN: 9781583945001 (pbk.)
    Language: English
    Note: Preface -- Manifesto: a call to establish a legitimate, wise, powerful collective voice of the people -- Democracy is about power and the people -- Direct democracy, representative democracy, and their shadows -- Why we need public wisdom -- Public wisdom: its role, its sources and its limitations -- Citizenship and the random selection of ad hoc mini publics -- Citizen deliberative councils: their character, variety and history -- How citizen deliberative councils could and should be used -- Public empowerment, public engagement, and the role of journalism -- Polarization, transpartisanship, and public wisdom -- Wisdom councils in 100 cities; with study circles, world cafes, and open space to engage the public with the results -- Deliberation for direct democracy -- Empowered public wisdom rising from the grassroots -- A new branch of government? -- Protecting the power and integrity of public wisdom -- What role will you play? -- Appendices -- An annotated list of powerful participatory processes, with links -- Some areas for research and development..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    Call number: IASS 17.91087
    Type of Medium: Monograph available for loan
    Pages: 253 S.
    ISBN: 3837620212 (pbk.) , 9783837620214 (pbk.)
    Series Statement: Edition Moderne Postmoderne
    Language: German
    Note: Zugl.: München, Univ., Diss., 2011
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Monograph available for loan
    Monograph available for loan
    Singapore [u.a.] : World Scientific
    Call number: M 17.91135
    Type of Medium: Monograph available for loan
    Pages: XVI, 479 S. , Ill., graph. Darst. , 24 cm
    Edition: Rev. ed.
    ISBN: 1848168950 (pbk. : £45.00) , 9781848168954 (pbk. : £45.00) , 1848168942 (hbk. : £84.00) , 9781848168947 (hbk. : £84.00)
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    Monograph available for loan
    Monograph available for loan
    Oslo : University Of Oslo
    Call number: M 17.90798
    Type of Medium: Monograph available for loan
    Pages: 196 S. , Illustrationen, graphische Darstellungen
    ISSN: 1501-7710
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
    Call number: DIN EN 806-5
    Type of Medium: 12
    Pages: Online-Ressource
    Edition: April 2012
    Series Statement: DIN EN 806-5
    Language: English
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 80
    Monograph available for loan
    Monograph available for loan
    Oxford [u.a.] : Oxford Univ. Press
    Call number: IASS 17.91071
    Type of Medium: Monograph available for loan
    Pages: 296 S , Ill., Kt , 24 cm
    ISBN: 0195183681 , 9780195183689
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Monograph available for loan
    Monograph available for loan
    Berlin : Suhrkamp
    Call number: IASS 18.91432
    Type of Medium: Monograph available for loan
    Pages: 498 S.
    Edition: 1. Aufl.
    ISBN: 9783518585412 (GB.)
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Call number: PIK P 113-18-91627
    Type of Medium: Monograph available for loan
    Pages: 558 Seiten , Ill., graph. Darst., Kt.
    ISBN: 926410951X
    Series Statement: Energy efficiency policy profiles
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Call number: IASS 17.91236
    Type of Medium: Monograph available for loan
    Pages: XVI, 237 S , graph. Darst.
    Edition: 1. ed
    ISBN: 9780415779319 (hbk) , 9780415779326 (pbk) , 9780203864302 (ebk) , 0415779316 (hbk) , 0415779324 (pbk) , 0203864301 (ebk)
    Language: English
    Note: Thinking differently for an age of complexity -- How can theory improve practice? -- Stories from the field -- The praxis of collaboration -- Dialogue as a community of inquiry -- Knowledge into action : the role of dialogue -- Using local knowledge for justice and resilience -- Beyond collaboration : democratic governance for a resilient society..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Monograph available for loan
    Monograph available for loan
    Opladen [u.a.] : Budrich Publ.
    Call number: IASS 17.91240
    Description / Table of Contents: Although the concept of power is central to the study of politics, there is no agreement as to what exactly power is. Power is often viewed negatively, as domination, though it is also the case that power is created by people acting in concert, in which case it can have positive effects. Making sense of this puzzle is one of the aims of this book, which provides the reader with a clear and coherent way of understanding the various forms and manifestations of power, and it does so by bringing together the most important and influential perspectives on power within the political and social sciences.
    Type of Medium: Monograph available for loan
    Pages: 230 S. , graph. Darst.
    ISBN: 3866491050 (Pb.) , 9783866491052 (Pb.) , 9783866495169 (electronic; ebook)
    Series Statement: The World of political science - The development of the discipline
    Language: English
    Note: Introduction / Mark Haugaard and Kevin Ryan -- Power in social and political theory / Mark Haugaard and Kevin Ryan -- Power in political anthropology / John Gledhill -- Foundations of organizational power / Stewart Clegg -- Gendering power : feminist approaches / Jill Vickers -- The political sociology of power / John A. Hall and Siniša Malešević -- Power and international relations / Phillip G. Cerny -- Concluding reflections / Kevin Ryan and Mark Haugaard..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: PIK N 185-18-91538
    Type of Medium: Monograph available for loan
    Pages: xxxi, 676 Seiten , Diagramme
    Edition: 10th anniversary edition
    ISBN: 9781107002173
    Language: English
    Note: Fundamental Concepts -- Introduction and overview -- Introduction to quantum mechanics -- Introduction to computer science -- Quantum Computation -- Quantum circuits -- The quantum Fourier transform and its applications -- Quantum search algorithms -- Quantum computers: physical realisation -- Quantum Information -- Quantum noise, open quantum systems, and quantum operations -- Distance measurement for quantum information -- Quantum error-correction -- Entropy and information -- Quantum information theory -- Notes on basic probability theory -- Group theory -- Approximating quantum gates: the Solovay-Kitaev theorem -- Number theory -- Public-key cryptography and the RSA cryptosystem -- Proof of Lieb's theorem.
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    Monograph available for loan
    Monograph available for loan
    Leningrad : Gidrometeorolog. Izd.
    Call number: MOP 33767
    Type of Medium: Monograph available for loan
    Pages: 663 S.
    Language: Russian
    Note: In kyrill. Schr., russ.
    Location: MOP - must be ordered
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Monograph available for loan
    Monograph available for loan
    Ann Arbor, Mich. : Open Humanities Press
    Call number: IASS 18.91839
    Description / Table of Contents: The writers in the volume ask, implicitly, how the 21st century horizons that exceed any political, economic, or conceptual models alters or redefines a series of key topoi. These range through figures of sexual difference, bioethics, care, species invasion, war, post-carbon thought, ecotechnics, time, and so on. As such, the volume is also a dossier on what metamorphoses await the legacies of -humanistic- thought in adapting to, or rethinking, the other materialities that impinge of contemporary -life as we know it.- With essays by Robert Markley, J. Hillis Miller, Bernard Stiegler, Justin Read, Timothy Clark, Claire Colebrook, Jason Groves, Joanna Zylinska, Catherine Malabou, Mike Hill, Martin McQuillan, Eduardo Cadava and Tom Cohen
    Type of Medium: Monograph available for loan
    Pages: 312 Seiten
    ISBN: 9781607852377
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Call number: AWI A3-18-91446
    Type of Medium: Monograph available for loan
    Pages: XV, 554 S. , Ill., graph. Darst., Kt. , 24 cm
    Edition: 12., überarb. Aufl. neu bearb. von Frank-Michael Chmielewski ...
    ISBN: 3835100963 , 9783835100961
    Language: German
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Monograph available for loan
    Monograph available for loan
    Oxford : Oxford University Press
    Call number: PIK N 071-18-91451
    Type of Medium: Monograph available for loan
    Pages: xviii, 319 Seiten , 24 cm
    ISBN: 9780199587087 , 9780199682225
    Language: English
    Note: Conceptualizing climate change-related movement -- The relevance of international refugee law -- Climate change-related movement and international human rights law : the role of complementary protection -- State practice on protection from disasters and related harms -- "Disappearing states", statelessness, and relocation -- Moving with dignity : responding to climate change-related mobility in Bangladesh -- "Protection" or "Migration"? The "climate refugee" treaty debate -- Institutional governance -- Overarching normative principles..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Call number: AWI G2-18-91973
    Type of Medium: Monograph available for loan
    Pages: 49 Seiten , Illustrationen
    Language: English
    Note: Table of Contents: Introduction. - Contact information. - List of participants. - Guidelines for presenters. - Registration. - Workshop program. - Hotel and workshop venues. - Travel information. - Abstracts. - Public lecture.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Call number: IASS 18.91779
    Type of Medium: Monograph available for loan
    Pages: XIX, 313 S.
    ISBN: 9780857935632
    Series Statement: New horizons in environmental and energy law
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Schweizerbart Science Publishers ; Volume 1, number 1 (1978)-
    Call number: M 18.91571
    Type of Medium: Monograph available for loan
    Pages: 134 Seiten
    ISSN: 2363-7196
    Series Statement: Global tectonics and metallogeny : special issue Vol. 10/2-4
    Classification:
    Tectonics
    Parallel Title: Erscheint auch als Global tectonics and metallogeny
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Call number: 9784887041400 (ebook)
    Description / Table of Contents: PREFACE The characteristics of natural disasters in modern mega-cities have been complicated and diversified since the end of 20th century and originated not only from geo-physical and global changes of natural hazards, such as earthquakes, tsunami, floods, storms, landslides, and drought, but also from the recent structural changes of our post-industrial societies. In fact, the Japanese urban area has become more and more vulnerable to newly emerging risks of low probability but high consequence type (LPHC type), which have been induced technologically and socially in modern society. For example, the estimated damage exposed by the floods has increased five times during the past 20 years in terms of unit-exposed space (inundated area in the case of flooding). This is due to the high concentration of both population and social infrastructures in residential districts, in spite of the success in decreasing the total number of human casualties of flood disasters, thanks to the tremendous amount of investment in constructing such physical structural facilities as dams, dikes, banks, etc. In return, we unfortunately face the soaring marginal cost of reducing disaster risk up to an acceptable level. In addition, we have such a new type of multi-disasters in modern mega-cities that a single small-scale hazard episode in an urban area might trigger a series of "catastrophic disasters" in a cascading manner under current interwoven and complicated urban water systems, such as from a small-scale river channel up to a large-scale river embankment. There seems to be many cases in which "natural disasters with totally different characteristics may happen before people forget about the previous disasters", in contrast with the famous expression "natural disasters occur when people are not thinking about them". Until very recently, people used to take precautionary steps against storms and/or inundation disasters at their homes in accordance with the amount of rainfall or the rise of water in adjacent rivers, and would listen to radio or TV news reports that predicted the routes of typhoons, and would standby at their homes or work places. Nowadays, such self-help practices to reduce possible damage of disasters have waned, reflecting a public relience on the remarkable improvements in basic social infrastructure to prevent disasters. Our country seems to have been transformed into a "hands-off society of leaving the management responsibility to regulatory authorities" in which people wait until they receive warning information or evacuation orders from the local government who are specialized in disaster prevention. However, when we face unexpected or surprise conditions, ordinary citizens become unable to understand the nature of risks, partly due to the complex processes of the regulatory management systems specialized in current disaster prevention schemes. They stop making their own choices regarding proactive responses to the emerging risks that have been so-called socio-technologically or socioculturally constructed in our post-industrial society. In fact, newcomers who have migrated and settled in newly developed lowland areas that used to be flood plains tend to be unable to inherit past disaster experiences. They tend to claim more and more "safety measures of intensified structural facilities" as well as an expansion of the "disaster relief measures" in cases where local residents become victims. But they prefer to leave management judgment regarding distinction between "safety and danger" to governmental institutions, as indicated in our recent case studies on a series of catastrophic flood disasters, such as the 2000 Tokai Floods in Nagoya and the 2004 Niigata-Fukui Floods. This also leads to another management issue of the increase in social costs to deal with the unexpected nature of risks, even by taking a proper combination of both structural and non-structural measures depending on which level of risks the community and residents may accept in long-term. Moreover, we are concerned about this kind of emerging disaster risks growing larger and continuing to increase, as suggested by the recent IPCC reports of global and regional climate changes. Here appears an integrated risk management approach to deal with natural disasters as social risk phenomena in terms of enhancing a variety of proactive or participatory ways that governmental institutions, communities, and residents could jointly carry out proper risk management against newly emerging disaster risks. To make our modern societies sustainable in terms of our lives, socio-cultural assets, and environmental resources in this risk society, it is vital to create a kind of societal governance system resilient to unexpected or surprise disasters not only by promoting a proper understanding of the nature of "risks" in their community but also by strengthening their preparedness to "risks" in the whole cycle of disaster prevention, from the normal, emergency, and recovery phases . Japan's National Research Institute for Earth Science and Disaster Prevention (NIED) has launched a five-year research project (2001-2005) with the aim of making modern societies resilient, not only to a traditional flood but also to possible catastrophic disasters of low probability but high consequence (LPHC). The approach that NIED has tried to explore is necessarily a new type of integrated risk management that should be tailored to the emerging disaster risks of the LPHC type. This includes (1) shifting the management strategy from "disaster prevention with zero risk" to "disaster reduction with an acceptable risk", (2) integrating both structure and non-structure measures (hard and soft measures), and (3) creating a social platform to call for a wide range of stakeholders (governments, communities, residents, corporations, local groups, and NPOs) in planning, designing and implementing an integrated risk management plan resilient to LPHC disasters in both short- and long-term perspectives. In order to tackle these urgent tasks, a new team was formed on the basis of social and human sciences by adding fellows and guest researchers, unlike the conventional team of disaster scientists at the NIED. Then, the team began operations through close cooperation with outside research institutions such as the Disaster Prevention Research Institute of Kyoto University. Our research group has been developing such a participatory platform of disaster risk communication, called the Participatory Flood Risk Communication Support System (Pafrics), that can facilitate community-based participation in planning, designing and implementing processes for a better integrated flood risk management. Pafrics has been particularly developed by taking a number of research outcomes based on the social scientific studies concerning local people's flood risk perception and disaster prevention activities in their community through questionnaire surveys conducted by NIED. Currently, we believe that Pafrics has been developed to such a sufficient level as to be released on the Web, but it is still being repeatedly modified through trials and experiences with new aspects and episodes in new areas. This book intends to provide outcomes of those studies in three parts. The first part expresses some of the important conceptual and methodological issues associated with the "integrated approach of disaster risk management" toward resilient society to emerging disaster risks in mega-cities in Japan. Four types of "integration" are taken into consideration in most of the papers. They are (1) integration of hard (structural control facilities) and soft (institutions and information) measures for shifting the concept of "zero risk" to "an acceptable level of risk", (2) integration of precaution and emergency relief measures, (3) integration of governmental and local community activities toward residents' informed choice of disaster risks, and (4) integration of individual risk management programs towards handling multiple sources of hazards. All papers focus on both the natural and socio-cultural factors of integrated risk management and their uncertainties involved in our modern society, reflecting the recent inter disciplinary development in "risk analysis", "disaster sciences", "resource economics", and "public policy analysis". In the second part, all contributed papers are more or less associated with outcomes of case studies or the social surveys which NIED conducted since the start of the project. Those involved include the 2000 Tokai flood disaster, 2004 Fukui, Niigata Typhoon 23 disasters in Japan, as well as the 2005 Hurricane Catrena in the USA. Many important research topics are addressed in terms of public understanding or perception of disaster risks, public preparedness for reducing risks, attitude of local government officers engaging in disaster prevention, the role of volunteers in disaster prevention or relief activities, based on social scientific disciplines in relation to social psychology, disaster sociology, and disaster insurance and economics, etc. Those contributions are particularly important for the NIED project to look forward to making modern societies resilient to disasters of LPHC type by facilitating residents' participation to risk governance in local communities towards the informed choice of disaster risks. The final part presents a set of papers which illustrate the development of "Pafrics", and some of the lessons we learned from several trials of using Pafrics in workshops, meetings, and lectures. In order to disseminate our model of "Pafrics", several internet-accessible versions are already open on theWeb (http://www.pafrics.org), which is in Japanese for local residents, but a short English version is also available at the same Web site. Finally, we should stress again that all contributions in this book are, more or less, the outcome of joint efforts conducted by all members of the project. However, final responsibility of the views expressed in these chapters lies with the individual authors themselves. We are very grateful for a number of invaluable comments and suggestions provided by the members of advisory body to our project; Dr. Sachio Kubo (Pasco Corporation), Mr. Nobuyuki Kurita (NPO: Rescue Stock Yard), Dr. Kimio Meguro (Tokyo University), Mr. Yukiji Nishida (NPO: Rescue Stock Yard), Dr. Norio Okada (Kyoto University), Dr. Yugo Ono (Hokkaido University), Dr. Isao Takagi (Keio University), and Dr. Kentaro Yoshida (Tsukuba University). We also express our deep gratitude forMs. Reiko Shibakami, Ms. Reiko Kawamura, and other assistants for their sincere and endless effort to support our studies and preparation of these manuscripts during period of the project. We should be very pleased if this book could make a valuable contribution towards a new perspective of "integrated disaster risk management" and "disaster risk governance" in the future.
    Type of Medium: 12
    Pages: Online-Ressource (XIV, 227 Seiten) , Diagramme
    ISBN: 9784887041400
    URL: Cover
    Language: English
    Note: Part I: An integrated framework of disaster risk management --- An Integrated Risk Analysis Framework for Emerging Disaster Risks: Toward a better risk management of flood disaster in urban communities / S. Ikeda / pp. 1-21 --- Fundamental Characteristics of Flood Risk in Japan's Urban Areas / T. Sato / pp. 23-40 --- Integration Framework of Flood Risk Management: What should be integrated? / K. Seo / pp. 41-56 --- Public Preference and Willingness to Pay for Flood Risk Reduction / G. Zhai / pp. 57-87 --- New Mode of Risk Governance Enhanced by an e-community Platform / T. Nagasaka / pp. 89-107 --- Part II: Interdisciplinary studies of flood risk --- Uncertainty in Flood Risks and Public Understanding of Probable Rainfall / S. Shimokawa and Y. Takeuchi / pp. 109-119 --- Public Perception of Flood Risk and Community-based Disaster Preparedness / T. Motoyoshi / pp. 121-134 --- Residents' Perception about Disaster Prevention and Action for Risk Mitigation: The case of the Tokai flood in 2000 / K. Takao / pp. 135-151 --- Roles of Volunteers in Disaster Prevention: Implications of questionnaire and interview surveys / I. Suzuki / pp. 153-163 --- Issues and Attitudes of Local Government Officials for Flood Risk Management / K. Terumoto / pp. 165-176 --- The Niigata Flood in 2004 as a Flood Risk of "Low Probability but High Consequence" / T. Sato, T. Fukuzono, and S. Ikeda / pp. 177-192 --- Insurance Issues of Catastrophic Disasters in Japan: Lessons from the 2005 Hurricane Katrina Disaster / H. Tsubokawa / pp. 193-198 --- Part III: Pilot studies of implementing social platform of risk management in local community: Participatory flood risk communication support system (Pafrics) --- Participatory Flood Risk Communication Support System (Pafrics) / T. Fukuzono, T. Sato, Y. Takeuchi, K. Takao, S. Shimokawa, I. Suzuki, G. Zhai, K. Terumoto, T. Nagasaga, K. Seo, and S. Ikeda / pp. 199-211 --- Flood Risk Communication with Pafrics / Y. Takeuchi and I. Suzuki / pp. 213-224
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Monograph available for loan
    Monograph available for loan
    Frankfurt/Main : Campus-Verl.
    Call number: IASS 19.92371
    Description / Table of Contents: Die ExpertInnen des Wandels leben und arbeiten in Wissenschaft und Kunst. Ihre Beiträge hätten wir bitter nötig in einer Zeit, in der sich die Umrisse der Wissensgesellschaft erst herauszuschälen beginnen, in der unser Land vor vielfältigen Problemen des Wandels, etwa auf dem Arbeitsmarkt, steht. Doch die Grenzen zwischen Politik und Kultur sind wie eingefroren. Adrienne Goehler fordert:Verflüssigen wir sie, damit mehr Bewegung in den Wandel kommt!
    Type of Medium: Monograph available for loan
    Pages: 276 Seiten , Illustrationen , 22 cm
    ISBN: 3593378124 (Gb.) , 9783593378121 (Gb.)
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    Monograph available for loan
    Monograph available for loan
    Leiden : Nijhoff
    Associated volumes
    Call number: IASS 17.92082/2
    In: The yearbook of polar law, volume 2
    Type of Medium: Monograph available for loan
    Pages: x, 346 Seiten , Illustrationen
    ISBN: 9789004187870
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Monograph available for loan
    Monograph available for loan
    Leiden : Nijhoff
    Associated volumes
    Call number: IASS 17.92082/4
    In: The yearbook of polar law, volume 4
    Type of Medium: Monograph available for loan
    Pages: viii, 758 Seiten , Illustrationen
    ISBN: 9789004233966
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    Call number: IASS 19.92502
    Type of Medium: Monograph available for loan
    Pages: 137 Seiten , 18 cm
    Edition: Deutsche Erstausgabe, 2. Auflage
    ISBN: 9783518126110
    Series Statement: Edition Suhrkamp 2611
    Uniform Title: Démocratie, dans quel état?
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Monograph available for loan
    Monograph available for loan
    New Haven : Yale University Press
    Call number: PIK B 140-19-92433
    Type of Medium: Monograph available for loan
    Pages: XVII, 124 Seiten
    Edition: 3. ed.
    ISBN: 9780300179316
    Series Statement: Monograph / Cowles Foundation for Research and Economics 12
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Call number: PIK B 010-19-92409
    Description / Table of Contents: Wie in seinen Büchern zu Wasser ("Wenn die Flüsse versiegen", BA 7/07) und Klimawandel ("Das Wetter von morgen", BA 1/08) geht es dem englischen Wissenschaftsjournalisten auch hier um ein aktuelles Thema, den Ausverkauf landwirtschaftlicher Flächen in armen Ländern an finanzstarke ausländische Investoren. Erneut nähert er sich dem Problem, indem er viele Länder bereist und vor Ort in Begegnungen mit den Protagonisten - Investoren wie Kleinbauern - Nachforschungen betreibt. In einer Fülle, vielleicht sogar Überfülle, von Gesprächen, Fakten und Meinungen entsteht ein Situationsbericht, in dem viele Fragen aufgeworfen werden: Vor- und Nachteile industrieller Landwirtschaft, Interessen des Agrobusiness gegen Interessen von örtlichen Kleinbauern und Viehzüchtern, Fragen der Welternährung gegenüber Belangen des Umweltschutzes sowie Verdacht des Neokolonialismus. Die entstandenen Reportagen sind mit denen von S. Liberti: "Landraub" (ID-B 24/12) vergleichbar, während W. Bommert: "Bodenrausch" (ID-A 24/12) und T. Kaphengst: "Land Grabbing" (ID-A 24/12) analytischer und politisch akzentuiert sind. (2) (Reinhild Khan)
    Description / Table of Contents: Reportagen aus der Welt des globalen Aufkaufs von Ackerland durch finanzstarke ausländische Investoren. (Reinhild Khan)
    Type of Medium: Monograph available for loan
    Pages: 397 Seiten , Karten , 22 cm
    ISBN: 9783888977831 , 3888977835
    Uniform Title: The land grabbers 〈dt.〉
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Call number: AWI A4-19-20532
    Type of Medium: Monograph available for loan
    Pages: 36 Seiten , Illustrationen
    Language: German
    Note: Inhalt Vorwort Einleitung: Unser Klima aus der Polarperspektive Verbessertes Verständnis arktischer Klimaänderungen durch Messungen und Modellierung Physikalische Prozesse in der polaren Atmosphäre Langzeit-Messreihen zeigen: Ozonschicht über der Antarktis konnte sich noch nicht erholen Arktischer Meereisrückgang verursacht Anomalien in Ozean und Atmosphäre HAFOS erfasst längerfristige Veränderungen im Ozean Meereisspiegel im Nordatlantik in nur 15 Jahren um 6 cm gestiegen Eis im Klimawandel Erderwärmung gefährdet die Permafrost-regionen und damit das globale Klimasystem Marine Klimaarchive – Aus der Vergangenheit lernen, um den Blick in die Zukunft zu schärfen Paläoklimamodelle: Zurück in die Zukunft Marines Plankton beeinflusst das globale Klima Die regionalen Auswirkungen des Klimawandels rücken in den Blickpunkt Das World Radiation Monitoring Center am AWI: weltweite Datenzentrale der Erdsystemforschung Klimaberatung: regionalspezifisch, verständlich, solide – das Helmholtz-Klimabüro am AWI Die stationären und mobilen Infrastrukturen des Alfred-Wegener-Instituts in Arktis und Antarktis Ansprechpartner im AWI, Impressum
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...