ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • 2015-2019  (22)
  • 2010-2014  (1,127,266)
  • 2005-2009  (844,364)
  • 2013  (690,268)
  • 2010  (437,019)
  • 2009  (416,106)
  • 2006  (428,279)
Collection
Language
Years
Year
  • 1
    Call number: 9/M 05.0597
    Type of Medium: Monograph available for loan
    Pages: XI, 272 S. : zahlr. farb. Ill. und graph. Darst. + 1 CD-ROM
    ISBN: 354029144X
    Classification:
    Regional Geology
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 2
    Call number: 7/M 06.0248
    In: Remote sensing and digital image processing
    Description / Table of Contents: 1. Remote Sensing and the Science, Monitoring, and Management of Aquatic Coastal Ecosystems / Richardson, LeDrew.- Section I. Science Applications.- 2. Extreme Events and Perturbations of Coastal Ecosystems / Skirving, Strong, Liu, Arzayus, Liu Sapper.- 3. Optical Remote Sensing Techniques to Estimate Phytoplankton Chlorophyll A Concentrations in Coastal Waters with Varying Suspended Matter and Cdom Concentrations / Schalles.- 4. A Tool for Inverse Modeling of Spectral Measurements in Deep and Shallow Waters / Gege, Albert.- 5. Integration of Coral Reef Ecosystem Process Studies and Remote Sensing / Brock, Yates, Halley.- Section II. Monitoring Applications.- 6. Infrastructure and Capabilities of a Near Real-Time Meteorological and Oceanographic in Situ Instrumented Array, and its Role in Marine Environmental Decision Support / Hendee, Stabenau, Florit, Manzello, Jeffris.- 7. Airborne Laser Altimetry for Predictive Modeling of Coastal Storm-Surge Flooding / Webster, Forbes.- 8. Integration of New Data Types with Historical Archives to Provide Insight into Coastal Change and Variability / Gebelein.- Section III. Management Applications.- 9. Observing Coastal Waters with Spaceborne Sensors / Whitehouse, Hutt.- 10. The Role of Integrated Information Acquisition and Management in the Analysis of Coastal Ecosystem Change / Phinn, Joyce, Scarth, Roelfsema.- 11. Mapping of Coral Reefs for Management of Marine Protected Areas in Developing Nations Using Remote Sensing / Newman, LeDrew, Lim.- 12. Data Synthesis for Coastal and Coral Reef Ecosystem Management at Regional and Global Scales / Robinson, Andréfouët, Burke.- 13. Recommendations for Scientists and Managers for Application of Remote Sensing to Coastal Waters / LeDrew, Richardson.
    Type of Medium: Monograph available for loan
    Pages: XVII, 324 S. : Ill., graph. Darst. + 1 CD-ROM
    ISBN: 1402039670
    Series Statement: Remote sensing and digital image processing 9
    Classification:
    Photogrammetry, Remote Sensing
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 3
    Monograph available for loan
    Monograph available for loan
    Offenburg : Verlag Praktisches Wissen GmbH
    Associated volumes
    Call number: PIK B 531-06-0008
    In: Die Super-Personal-Tabelle
    Type of Medium: Monograph available for loan
    ISBN: 3935745834
    Series Statement: Die Super-Personal-Tabelle
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 4
    Call number: 18/M 06.0091
    Type of Medium: Monograph available for loan
    Pages: 1215 S. + 1 CD-ROM , Ill., graph. Darst. , 25 cm
    Edition: 2., aktualisierte und erw. Aufl.
    ISBN: 3898427498
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 5
    Monograph available for loan
    Monograph available for loan
    Berlin [u.a.] : Springer
    Call number: AWI S2-06-0012
    Type of Medium: Monograph available for loan
    Pages: 250 S.
    ISBN: 3540256741
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 6
    Call number: PIK D 024-06-0103 ; AWI A2-20-86604
    Type of Medium: Monograph available for loan
    Pages: 396 Seiten , Illustrationen
    ISBN: 310021109X
    Uniform Title: The weathermakers 〈dt.〉
    Language: German
    Note: INHALT Vorwort Karte Das langsame Erwachen I. Teil GAIAS REPERTOIRE 1. Gaia Die Atmosphäre einer Großtante. Wallace' erstaunlicher Luftozean. Lovelocks Ketzerei: Die Daten sind dürftig, aber sie lebt. Das Eis überschreitet eine Grenze - bis das Plankton den Thermostat verstellt. Die wichtige Albedo. Kohle machen - eine weitere Selbstjustierung von Gaia? 2. Der große Luftozean Die vier Atmosphärenschichten und das große Rätsel, warum Berggipfel, obwohl der Sonne näher, kalt sind. Das Fenster in der Mauer aus Gasen. Die irdischen Zusammenhänge - und wie die Luftverschmutzung sie verändert. Ein Mitsornmernachts-Albtraum in New York. Vom Mauna Loa aus der Erde beim Atmen zusehen. 3. Das gasförmige Treibhaus Anfangszweifel an der Macht des CO2. Ein ziemlich knappes Kohlenstoff-Budget. Dreißig Gase, die die Welt aufheizen. Methan: Sümpfe, Fürze und Rülpser. CFKs - Frankenstein'sche Schöpfungen menschlichen Erfindungsreichtums. Wohin mit all den Gigatonnen? Die Kohlenstoff-Lungen, -Speicher und -Nieren der Erde - und die Kohlenstoff-Gaia. Die Lehre einer Dose Limonade. Der irreführende Mississippi. 4. Die Weisen und die Zwiebelschale Kohlenstoff wirft die Frage nach des Menschen Stellung im Weltall auf. Fumifugium und die Vororte der Hölle. Fouriers frierende Erde. Svante Arrhenius rettet sich vor einer gescheiterten Ehe in Berechnungen und entdeckt den Klimawandel. Orthodoxe ignorieren den weitsichtigen Callendar. Milankovic' Gefängnis-Zyklen triumphieren. Flecken auf der Sonne? Die falsche mittelalterliche Warmzeit. 5. Zeitpassagen Stille Trinker bemächtigen sich der geologischen Formationen. Schlüssel zu Zeitpassagen. Lieber zwischen den Zeiten leben als am Ende aller Zeiten. Die Pianolarolle der Sedimente, auf Sauerstoffund Kohlenstoffisotopen gespielt. Eine Zeit wie die Gegenwart? Norweger entdecken die Fischbraterei des Paläozäns. Das Klima als Tempomat der Evolution: Jede Veränderung verändert das Leben an sich. 6. Im Kühlhaus geboren Vor dem Hintergrund des Klimawandels von der Wiege in Afrika zur Welteroberung. Geheimnisse in Holz und Eis. Die warmen Felsen Grönlands und der Riesenkern von Dome C. Zehn Jahrtausende eines Achterbahn-Klimas läuten die Modeme ein. Ein paar Sverdrups könnten uns hinwegspülen. 7. Der lange Sommer Das Anthropozän - unsere eigene geologische Epoche. Hält sie aber schon 200 oder 8000 Jahre an? Keine Feldbestellung vor dem Sommer. Ruddimans Gase entmachten Milankovic' Zyklus - oder doch nicht? Als es in Uruk eng wurde. Fagans Hungersnöte und Ruddimans Pest. Eine abgewürgte Eiszeit? 8. Die Toten ausgraben Big Bill Neidjies Weisheit. Kohle, Gas und Öl: Die Reiter der Kohlenstoff-Apokalypse. Vergrabener Sonnenschein und Kohlenstoffgehalt. Eine kurze Geschichte der Kohle. In Newcomens Ära ist Kohle der Universaltreibstoff. Ein Texaner läutet das Kohlenwasserstoff-Jahrhundert ein. Glitschiges Öl und glückliche Herrscherhäuser. Das Dilemma des Negativhaushalts, die wachsende Familie und die unersättliche Abhängigkeit. II. Teil EINE VON ZEHNTAUSEND 9. Die entzauberte Welt Magische Tore passieren. Der Methusalem unter den Korallen. 1976 drehte das Wetter durch - und trieb die Evolution voran. Und noch einmal 1998, diesmal mit El-Niño-Turbo. Wie wichtig wenig gelesene Zeitschriften sind. Scheckenschmetterlinge unter Druck setzen und die Natur in Richtung der Pole peitschen. Von Eichen und Frostspannern. Den Tanganjikasee entvölkern. Den globalen Fingerabdruck der Katastrophe identifizieren. Das verbrannte Nong-Tal. 10. Alarm an den Polen Antarktisches Gras kündet vom Tod der Kryosphäre. Das beständig schmelzende Eis. Pinguine folgen dem verschwindenden Krill, und Salpen übernehmen die Weltmeere. Das Sterben der Lemminge: Mord, nicht Selbstmord. Das Werk des Fichtenborkenkäfers. Wälder erobern die Tundra. Magere Eisbären bekommen keine Drillinge. Das vereiste Pressen der Rentiere. 11. 2050: Das Große Stummelriff? Nichts ist so schön wie ein Korallenriff. Fossile Fische bei Verona. Erstaunliche Vielfalt - in Abwässern erstickt. Die Dornenkrone der Schönheit. Das Los des jungfräulichen Myrmidon Reef. Warum bleichen sie aus? Die meisten sind halb tot, der Rest ist zum Sterben verdammt. Hoffnung auf Migration oder Adaption? Die Lektion des Gobiodon. 12. Eine Warnung von der Goldkröte Marty Crump, die Frau der Stunde. Meist im Untergrund und höchst gefährdet. Die letzte Krötenorgie. Die Parabel vom Quetzal und vom Fischtukan. Sterbende Eidechsen und eine zufällig dastehende Wetterstation. Zwölf Jahre später kennt man den Grund. Der Bauchbrütende Frosch ist verschwunden. Eine globale Entwicklung? 13. flüssiges Gold: Veränderte Niederschläge Die Tragödie im Sahel - auch ein moralisches Desaster. Der Westen Amerikas und der Süden Australiens: Neue Saharas? Der große Durst von Perth. Erlösen Entsalzungsanlagen Sydney? Der dürre Westen - ein Zyklus oder das neue Klima? 14. Eine energiegeladene Zwiebelschale Woher nehmen Stürme ihre Kraft? Von Hitze, Wasser und Hurrikan-Treibstoff. Vom Schwitzen zu Zyklonen: Eine Erklärung für die Wucht von Mitch. Dem Golf von Bengalen bleibt einiges erspart. Europas todbringender Sommer. Rekordhalter USA. Die Kontinente schrumpfen. 15. Mit dem Blanken Hans spielen Wir Küstenbewohner. Wärme: Leichter aus den Ozeanen herauszuholen als hineinzustecken. Der Panzer und der VW-Käfer. Der plötzliche Tod der schnellen Gletscher von Larsen B. Und was ist mit Grönland? Immer wieder die magische Sieben. Ein Schwergewicht kommt in Schwung. Zu 67 Metern verdammt? III. Teil WEISSAGEN ALS WISSENSCHAFT 16. Modellwelten Captain Fitzroy und die Wettervorhersage. Die Welt als rotierende Schüssel. Schon 1975 hatten sie Recht - fälschlicherweise. Pinatubo-Prognosen. Eine schwarze Kugel und der Aufstand der Skeptiker. Zehn globale Zirkulationsmodelle und wie Wolken das Problem vernebeln. Spuckende Ahnen. Können wir mehr Gewissheit haben - und können 90 000 PCs sich irren? Was ist mit mir? Fragen ist menschlich - oder man lässt es lieber. Regionalprognosen und Rückkopplung. Das Ende des englischen Gartens? 17. Extremer Gefahr ausgeliefert? Ein Nachlauf von 50 Jahren und die wahren Kosten von Heckflossen-Chevrolets. Der Ozean lebt in den siebziger Jahren - und auch die Industrie. Das Treibhausrad lässt sich nicht zurückdrehen. Die Schwelle zu extremer Gefahr: 400 oder 1200 Teile pro Million? Oder haben wir sie bereits überschritten? 18. Die Berge ebnen Adieu, Schnee des Kilimandscharo. Inseln im Himmel. Auf dem Gipfel geht es nicht mehr weiter. Ein schreckliches Maß an Gewissheit. Von Paradiesvögeln, Ringelschwanzbeutlern und Baumkängurus. Verlorenes Weltnaturerbe. Nur Anopheles freut sich. 19. Wohin geht die Reise? Von Florida nach Montreal-Bäume auf Wanderschaft. Eucalyptus - das Schicksal von 819 Arten. Abschied von Fynbos und Karru, den schönsten Blumengärten der Welt. In die Ecke gedrängt: Der Südwesten Australiens. Wer weiterziehen kann, hat es gut. Naturschutzgebiete werden zu Todesfallen. Megastudie prophezeit Massensterben - aber werden es eine von fünf oder sechs von zehn Arten sein? 20. Unendliche Tiefen Warum sterben sie, wenn wir sie erblicken? Eine Welt unerforschter Absonderlichkeiten. Von Zungenkiemern, Großmaulhaien und Laternenanglern. Saures Meer und schalenlose Kammmuscheln. Die letzte Auster? 21. Eine Hand voll Joker Die Bedeutung positiver Rückkopplungsschleifen. Das Konzert der drei Szenarien. Das Pentagon kümmert sich um den Golfstrom - und sieht in seinem Versiegen den Untergang der Zivilisation. Genügend viele Sverdrup. Die Geschichte von HadCM3LC und TRIFFID. Wenn Stomata sich schließen: Tod am Amazonas. Die Clathrate sind los! Die Zeitbombe vor Ihrem Strand. Die positive Rückkopplung der Klimaanlagen. 22. Zivilisation: Mit einem Wimmern vorbei? Der Kern der globalen Gesellschaft. Städte sind wie Regenwälder. Eine wie große Klimawelle kann eine Stadt hinwegfegen? Nahrungsmittelproduktion - so spezialisiert wie ein Säbelzahntiger. Schlechte Ernten in einer Welt voll CO2. »Anpassung« als Genozid und
    Location: A 18 - must be ordered
    Location: AWI Reading room
    Branch Library: PIK Library
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 7
    Call number: AWI S1-06-0049
    In: Lecture Notes in Computational Science and Engineering
    Type of Medium: Monograph available for loan
    Pages: XII, 482 S.
    ISBN: 3540290761
    Series Statement: Lecture Notes in Computational Science and Engineering 51
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 8
    Call number: A4 43
    Type of Medium: Monograph available for loan
    Pages: 48 Sp.
    ISBN: 9967232315
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 9
    Monograph available for loan
    Monograph available for loan
    Frankfurt am Main : Fischer, S
    Call number: PIK N 074-06-0147
    Type of Medium: Monograph available for loan
    Pages: 432 S. , 57 Abb
    Edition: 1. Aufl.
    ISBN: 3596171261
    Series Statement: Fischer Sachbücher 17126
    Note: Erscheinungsjahr in Vorlageform:2006
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 10
    Call number: S 99.0056(2006/01)
    In: Terra nostra
    Type of Medium: Series available for loan
    Pages: 90 S. , Ill., graph. Darst., Kt.
    Series Statement: Terra Nostra 2006,1
    Classification:
    Sedimentology
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 11
    Monograph available for loan
    Monograph available for loan
    Boston [u.a.] : Artech House
    Call number: 6/M 06.0295
    Description / Table of Contents: Contents: Fundamentals of Satellite Navigation. - GPS System Segments. - GPS Satellite Signal Characteristics. - Satellite Signal Acquisition and Tracking. - Effects of RF Interference on GPS Satellite Signal Receiver Tracking. - Performance of Standalone GPS. - Differential GPS. - Integration of GPS With Other Sensors. - The Russian GLONASS System. - INMARSAT Civil Navigation Satellite Overlay. - GPS Markets and Applications.
    Type of Medium: Monograph available for loan
    Pages: xvii, 703 S. , Ill., graph. Darst. , 24 cm
    Edition: 2nd ed.
    ISBN: 1580538940
    Series Statement: The Artech House mobile communications series
    Classification:
    Reference Systems
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 12
    Monograph available for loan
    Monograph available for loan
    Paris : IEA
    Call number: PIK P 113-06-0292
    Type of Medium: Monograph available for loan
    Pages: 158 S. , graph. Darst., Kt.
    ISBN: 9264109811
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 13
    Monograph available for loan
    Monograph available for loan
    Philadelphia : SIAM
    Call number: M 06.0305
    Description / Table of Contents: Offers an introduction to the use of computational methods, particularly finite element methods, in the simulation of fluid flows in porous media. This book covers a variety of flows, including single-phase, two-phase, black oil, volatile, compositional, nonisothermal, and chemical compositional flows in ordinary porous and fractured porous media.
    Type of Medium: Monograph available for loan
    Pages: xxix, 531 S.
    ISBN: 0898716063
    Series Statement: Computational science and engineering 2
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 14
    Monograph available for loan
    Monograph available for loan
    Oxford : Oxford University Press
    Call number: PIK B 100-06-0295
    Type of Medium: Monograph available for loan
    Pages: 1088 S.
    ISBN: 0199272220
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 15
    Call number: 18/M 06.0294
    Type of Medium: Monograph available for loan
    Pages: XLI, 1160 S. , graph. Darst. , 235 mm x 155 mm
    Edition: 1. Aufl.
    ISBN: 3540292365
    Classification:
    Informatics
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 16
    Call number: 21/STR 06/04
    In: Scientific technical report
    Type of Medium: GFZ publications
    Pages: 157 S.
    Series Statement: Scientific technical report / Geoforschungszentrum Potsdam 06/04
    Classification:
    Seismology
    Note: Zugl.: Bochum, Univ., Habil.-Schr., 2005
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 17
    Series available for loan
    Series available for loan
    Leiden : Nationaal Natuurhistorisch Museum Naturalis
    Associated volumes
    Call number: S 93.0422(131)
    In: Scripta geologica
    Type of Medium: Series available for loan
    Pages: 211 S. , Ill., graph. Darst., Kt.
    Series Statement: Scripta geologica 131
    Note: Zugl.: Amsterdam, Univ., Diss., 2006
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 18
    Call number: S 97.0506(545-2)
    In: Forschungsbericht
    Type of Medium: Monograph non-lending collection
    Pages: III, 86, A-68 S.
    Edition: Als Ms. gedr.
    ISBN: 3936418519
    Series Statement: DGMK-Forschungsbericht 545-2
    Classification:
    Sedimentology
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 19
    Series available for loan
    Series available for loan
    Warszawa : Inst. Geofizyki Polskiej Akad. Nauk
    Associated volumes
    Call number: S 91.0236(C-97) / Regal 35
    In: Publications of the Institute of Geophysics, Polish Academy of Sciences
    Type of Medium: Series available for loan
    Pages: 110 S.
    ISBN: 8388765655
    Series Statement: Publications of the Institute of Geophysics, Polish Academy of Sciences : C, Geomagnetism 97 = 393
    Location: Magazine - must be ordered
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 20
    Call number: 21/STR 06/03
    In: Scientific technical report
    Type of Medium: GFZ publications
    Pages: 98 S. : graph. Darst.
    Series Statement: Scientific technical report / Geoforschungszentrum Potsdam 06/03
    Note: Berlin, Techn. Univ., Diss., 2006
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 21
    Call number: PIK W 511-06-0201
    In: Berichte aus dem Nationalpark
    Type of Medium: Monograph available for loan
    Pages: 20 S. : graph. Darst , 1 Beil
    Series Statement: Berichte aus dem Nationalpark 3
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 22
    Call number: S 00.0063(45)
    In: Schriftenreihe der Deutschen Gesellschaft für Geowissenschaften
    Type of Medium: Series available for loan
    Pages: 259 S. , graph. Darst.
    ISBN: 3932537416
    Series Statement: Schriftenreihe der Deutschen Gesellschaft für Geowissenschaften 45
    Classification:
    Sedimentology
    Note: Beitr. teilw. engl., teilw. dt.
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 23
    Call number: S 98.0095(2006-1)
    In: Tagungsbericht / Deutsche Wissenschaftliche Gesellschaft für Erdöl, Erdgas und Kohle
    Type of Medium: Series available for loan
    Pages: VI, 544 S. + 1 CD-ROM
    Edition: Als Ms. gedr.
    ISBN: 3936418489
    Series Statement: Tagungsbericht / Deutsche Wissenschaftliche Gesellschaft für Erdöl, Erdgas und Kohle 2006-1
    Classification:
    Deposits
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 24
    Series available for loan
    Series available for loan
    Warszawa : Inst. Polskiej Akad. Nauk
    Associated volumes
    Call number: S 91.0236(C-94) / REgal 35
    In: Publications of the Institute of Geophysics, Polish Academy of Sciences
    Type of Medium: Series available for loan
    Pages: 113 S.
    ISBN: 8388765531
    Series Statement: Publications of the Institute of Geophysics, Polish Academy of Sciences : C, Geomagnetism 94 = 381
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 25
    Series available for loan
    Series available for loan
    Warszawa : Inst. Geofizyki Polskiej Akad. Nauk
    Associated volumes
    Call number: S 91.0236(D-70) / Regal 35
    In: Publications of the Institute of Geophysics, Polish Academy of Sciences
    Type of Medium: Series available for loan
    Pages: 67 S.
    ISBN: 8388765612
    Series Statement: Publications of the Institute of Geophysics, Polish Akademie of Sciences : D, Physics of the atmosphere 70 = 389 : monograph volume
    Classification:
    Geochemistry
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 26
    Call number: S 98.0095(2006-2)
    In: Tagungsbericht / Deutsche Wissenschaftliche Gesellschaft für Erdöl, Erdgas und Kohle
    Type of Medium: Series available for loan
    Pages: IV, 320 S. , Ill., graph. Darst
    Edition: Als Ms. gedr.
    ISBN: 3936418497
    Series Statement: Tagungsbericht / Deutsche Wissenschaftliche Gesellschaft für Erdöl, Erdgas und Kohle 2006-2
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 27
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge University Press
    Call number: PIK N 630-06-0316
    Type of Medium: Monograph available for loan
    Pages: 412 S.
    ISBN: 0521029953
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 28
    Monograph available for loan
    Monograph available for loan
    Sèvres : BIPM
    Call number: M 06.0375
    Type of Medium: Monograph available for loan
    Pages: 180 S. , graph. Darst. , 3 Beil.
    Edition: 8. éd.
    ISBN: 9282222136
    Classification:
    Engineering
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 29
    Series available for loan
    Series available for loan
    Bremerhaven : Alfred-Wegener-Inst. für Polar- und Meeresforschung
    Associated volumes
    Call number: ZS-090(525) ; ZSP-168-525
    In: Berichte zur Polar- und Meeresforschung
    Type of Medium: Series available for loan
    Pages: VI, 137 S. , Ill., graph. Darst., Kt.
    ISSN: 1618-3193
    Series Statement: Berichte zur Polar- und Meeresforschung 525
    Note: Zugl.: Bremen, Univ., Diss., 2005
    Location: Lower compact magazine
    Location: AWI Reading room
    Branch Library: GFZ Library
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 30
    Series available for loan
    Series available for loan
    Bremerhaven : Alfred-Wegener-Institut
    Associated volumes
    Call number: AWI ZSP-994(2004/2005)
    In: Das AWI in den Jahren, 2004/2005
    Type of Medium: Series available for loan
    Pages: 358 Seiten , Illustrationen
    ISSN: 1618-3703
    Series Statement: Das AWI in den Jahren 2004/2005
    Language: German , English
    Note: Inhalt = Content 1. Vorwort = Introduction 2. Ausgewählte Forschungsthemen = Selected research topics Algen im Klimawandel: Neue Messmethoden zeigen den Gasaustausch der Zellen in Echtzeit = Algae and climate change: new methods show the gas exchange of cells in real time / Björn Rost, Klaus-Uwe Richter Arktische Klimaprozesse und globale atmo-sphärische Auswirkungen = Arctic climate processes and global atmo-spheric impacts / Klaus Dethloff, Annette Rinke, Elena Sokolova, Subodh Kumar Saha Das Klima der letzten 10 000 Jahre: Eine Verknüpfung aus Beobachtungsdaten, Umweltarchiven und Modellstudien = The climate of the last 10 000 years: Combining observational data with environ-mental archives and model studies / Gerrit Lohmann Chemische Ökologie mariner Protisten - Bedeutung für die Dynamik mariner Nahrungsketten = Chemical ecology of marine protists - implications for marine food web dynamics / Allan Cembella, Uwe John, Bernd Krock, Tilman Alpermann, Urban Tillmann Nährstoffbelastung des Wattenmeeres: Besserung in Sicht = Eutrophication of the Wadden Sea: Signs of improvement / J. E. E. van Beusekom, M. Loebl, K. Reise, A. Schanz Planktonregen im Südpolarmeer: Das europä-ische Eisendüngungsexperiment EIFEX (Euro-pean Iron Fertilization Experiment) = Plankton rain in the Southern Ocean: The Euro-pean Iron Fertilization Experiment EIFEX / Philipp Assmy, Boris Cisewski, Joachim Henjes, Christine Klaas, Oliver Sachs Sind Lebensgemeinschaften polarer Meere Verlierer der Klimaveränderung? = Does global warming pose a threat to polar ecosystems? / Gisela Lannig, Ute Jacob, Thomas Brey, Rainer Knust, Hans-O. Pörtner Marine Genomik – Von den Genen zur Evolution und Ökologie mariner Organismen = Marine Genomics – through genomes to evolution and ecology of marine organisms / Klaus Valentin Frostblumen: Salzige Kristalle auf dünnem Eis = Frost flowers: salty crystals on thin ice / Hans-Werner Jacobi, Sandra Lehmann Gemeinsam in den Hausgarten: Deutsch-französische Kooperation in der Tiefseeforschung = Together ‘en route‘ for HAUSGARTEN:Franco-German co-operation in deep-sea research / Thomas Soltwedel, Michael Klages Fernerkundung in arktischen Periglazial-landschaften – Auf den Spuren der Permafrost-dynamik = Remote sensing in Arctic periglacial landscapes – The tracing of permafrost dynamics / Guido Große, Dirk Wagner, Lutz Schirrmeister Frühling im Weddellmeer: Biologisch-physikalische Wechselwirkungen zwischen Atmosphäre, Eis und Ozean = Go with the floe: biological-physical interac-tions between atmosphere, ice and ocean in the Weddell Sea / Christian Haas, Gerhard Dieckmann, Hartmut Hellmer, Michael Schröder 3. Forschung = Research MARCOPOLI 3.1 MARINE 3.2 COAST 3.3 POLAR 3.4 Neue Themen = Additional funding 4. Entwicklungen in den Fachbereichen = Progresses in the Scientific Divisions 5. Neue Technologien = New technologies 6. Logistik und Forschungsplattformen = Logistics and research platforms 7. Nationale und internationale Zusammenarbeit = National and international cooperation 8. Mariner Umweltschutz = Marine environmental protection 9. Informationszentrum = Information centre 10. Bibliothek = Library 11. Technologietransfer = Technology transfer 12. Presse- und Öffentlichkeitsarbeit = Public relations department 13. Personeller Aufbau und Haushaltsentwicklung = Personnel structure and budget trends 14. Veröffentlichungen, Patente = Publications, patents Anhang = Annex
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 31
    Call number: 21/STR 06/07
    In: Scientific technical report
    Type of Medium: GFZ publications
    Pages: 12 S. , farb. Ill., graph. Darst., Kt.
    Series Statement: Scientific technical report / Geoforschungszentrum Potsdam 06/07
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 32
    Call number: S 90.0002(1656-B)
    In: Professional paper
    Type of Medium: Series available for loan
    Pages: IX, 66 S. , Ill., graph. Darst., Kt.
    ISBN: 1411309561
    Series Statement: U.S. Geological Survey professional paper 1656-B
    Classification:
    Hydrology
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 33
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: ZS-017(23)
    In: Annual report
    Type of Medium: Series available for loan
    Pages: 215 S.
    Series Statement: 23
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 34
    Monograph available for loan
    Monograph available for loan
    Potsdam : Alfred-Wegener-Institut für Polar- und Meeresforschung
    Call number: AWI G5-06-0495
    Type of Medium: Monograph available for loan
    Pages: 158 S.
    Note: Potsdam, Univ., Diss., 2006
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 35
    Monograph available for loan
    Monograph available for loan
    Oxford [u.a.] : Chandos Publ.
    Call number: 2/M 06.0454
    Type of Medium: Monograph available for loan
    Pages: xvii, 243 S.
    ISBN: 1843342030
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 36
    Monograph available for loan
    Monograph available for loan
    Berlin : Huss-Medien ; 1. Aufl.
    Call number: M 06.0496
    Type of Medium: Monograph available for loan
    Pages: 128 S. , zahlr. Ill., graph. Darst.
    ISBN: 3349011004
    Series Statement: Arbeit und Arbeitsrecht 61.2006 : Sonderausg.
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 37
    Monograph available for loan
    Monograph available for loan
    Northampton, Mass. : Edward Elgar Publishing
    Call number: PIK B 160-06-0276
    Type of Medium: Monograph available for loan
    Pages: p. cm.
    ISBN: 1845428471
    Series Statement: Fondazione Eni Enrico Mattei (FEEM) series on economics and the environment
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 38
    Call number: 1.7/M 06.0532
    In: dtv
    Type of Medium: Monograph available for loan
    Pages: XXXII, 713 S.
    Edition: 58., überarb. Aufl., Stand: 25. Juli 2006, Sonderausg.
    ISBN: 3423050012
    Series Statement: Dtv 5001 : Beck-Texte im Dtv
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 39
    Monograph available for loan
    Monograph available for loan
    Oxford [u.a.] : Blackwell Publ.
    Call number: PIK N 630-06-0326
    Type of Medium: Monograph available for loan
    Pages: X, 318 S. , Ill., graph. Darst.
    ISBN: 1405119063
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 40
    Call number: S 06.0528
    Type of Medium: Monograph available for loan
    Pages: Losebl.-Ausg. + 1 CD-ROM
    Edition: Stand: September 2006 [Grundwerk]
    ISBN: 3865861024 , 978-3-86586-102-3
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 41
    Call number: ZS-265(37)
    In: Meteorologische Arbeiten aus Leipzig
    Type of Medium: Series available for loan
    Pages: 163 S.
    Edition: 1. Aufl.
    ISBN: 3980882276
    Series Statement: 37
    Classification:
    Meteorology and Climatology
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 42
    Call number: PIK B 404-06-0304 ; M 06.0572
    Type of Medium: Monograph available for loan
    Pages: 116 S. + 1 CD-ROM
    Edition: 1. Auflage
    ISBN: 3448079014
    Location: A 18 - must be ordered
    Location: Upper compact magazine
    Branch Library: PIK Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 43
    Call number: S 00.0272(346)
    In: Nova acta Leopoldina
    Type of Medium: Series available for loan
    Pages: 277 S. , Ill., graph. Darst.
    ISBN: 3804723179
    Series Statement: Nova acta Leopoldina N.F., 346 = Bd. 94
    Classification:
    Geography and Geomorphology
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 44
    Call number: ZS-090(527) ; ZSP-168-527
    In: Berichte zur Polar- und Meeresforschung
    Type of Medium: Series available for loan
    Pages: V, 294, XXI S. , Ill., graph. Darst., Kt.
    ISSN: 1618-3193
    Series Statement: Berichte zur Polar- und Meeresforschung 527
    Classification:
    Oceanology
    Note: Zugl.: Bremen, Univ., Diss., 2005
    Location: Lower compact magazine
    Location: AWI Reading room
    Branch Library: GFZ Library
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 45
    Series available for loan
    Series available for loan
    Bremerhaven : Alfred-Wegener-Inst. für Polar- und Meeresforschung
    Associated volumes
    Call number: ZS-090(528) ; ZSP-168-528
    In: Berichte zur Polar- und Meeresforschung
    Type of Medium: Series available for loan
    Pages: 82 S. , Ill., graph. Darst., Kt.
    ISSN: 1618-3193
    Series Statement: Berichte zur Polar- und Meeresforschung 528
    Classification:
    Oceanology
    Note: Zugl.: Kiel, Univ., Dipl.-Arb., 2004
    Location: Lower compact magazine
    Location: AWI Reading room
    Branch Library: GFZ Library
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 46
    Monograph available for loan
    Monograph available for loan
    Chantilly, Va. : Mineralogical Society of America
    Associated volumes
    Call number: 11/M 06.0469
    In: Reviews in mineralogy & geochemistry
    Description / Table of Contents: The importance of sulfide minerals in ores has long been, and continues to be, a major reason for the interest of mineralogists and geochemists in these materials. Determining the fundamental chemistry of sulfides is key to understanding their conditions of formation and, hence, the geological processes by which certain ore deposits have formed. This, in turn, may inform the strategies used in exploration for such deposits and their subsequent exploitation. In this context, knowledge of structures, stabilities, phase relations and transformations, together with the relevant thermodynamic and kinetic data, is critical. As with many geochemical systems, much can also be learned from isotopic studies. The practical contributions of mineralogists and geochemists to sulfide studies extend beyond areas related to geological applications. The mining of sulfide ores, to satisfy ever increasing world demand for metals, now involves extracting very large volumes of rock that contains a few percent at most (and commonly less than one percent) of the metal being mined. This is true of relatively low value metals such as copper; for the precious metals commonly occurring as sulfides, or associated with them, the mineable concentrations (grades) are very much lower. The "as-mined" ores therefore require extensive processing in order to produce a concentrate with a much higher percentage content of the metal being extracted. Such mineral processing (beneficiation) involves crushing and grinding of the ores to a very fine grain size in order to liberate the valuable metal-bearing (sulfide) minerals which can then be concentrated. In some cases, the metalliferous (sulfide) minerals may have specific electrical or magnetic properties that can be exploited to enable separation and, hence, concentration. More commonly, froth flotation is used, whereby the surfaces of particles of a particular mineral phase are rendered water repellent by the addition of chemical reagents and hence are attracted to air bubbles pulsed through a mineral particle-water-reagent pulp. An understanding of the surface chemistry and surface reactivity of sulfide minerals is central to this major industrial process and, of course, knowledge of electrical and magnetic properties is very important in cases where those particular properties can be utilized. In the years since the publication of the first ever Reviews in Mineralogy volume (1974, at that time called MSA "Short Course Notes") which was entitled Sulfide Mineralogy, sulfides have become a focus of research interest for reasons centering on at least two other areas in addition to their key role in ore deposit studies and mineral processing technology. It is in these two new areas that much of the research on sulfides has been concentrated in recent years. The first of these areas relates to the capacity of sulfides to react with natural waters and acidify them; the resulting Acid Rock Drainage (ARD), or Acid Mine Drainage (AMD) where the sulfides are the waste products of mining, has the capacity to damage or destroy vegetation, fish and other aquatic life forms. These acid waters may also accelerate the dissolution of associated minerals containing potentially toxic elements (e.g., As, Pb, Cd, Hg, etc.) and these may, in turn, cause environmental damage. The much greater public awareness of the need to prevent or control AMD and toxic metal pollution has led to regulation and legislation in many parts of the world, and to the funding of research programs aimed at a greater understanding of the factors controlling the breakdown of sulfide minerals. We begin with a review of analytical methods for measuring and calibrating water contents in nominally anhydrous minerals by George Rossman. While infrared spectroscopy is still the most sensitive and most convenient method for detecting water in minerals, it is not intrinsically quantitative but requires calibration by some other, independent analytical method, such as nuclear reaction analysis, hydrogen manometry, or SIMS. A particular advantage of infrared spectroscopy, however, is the fact that it does not only probe the concentration, but also the structure of hydrous species in a mineral and in many cases the precise location of a proton in a mineral structure can be worked out based on infrared spectra alone. The methods and principles behind this are reviewed by Eugen Libowitzky and Anton Beran, with many illustrative examples. Compared to infrared spectroscopy, NMR is much less used in studying hydrogen in minerals, mostly due to its lower sensitivity, the requirement of samples free of paramagnetic ions such as Fe2+ and because of the more complicated instrumentation required for NMR measurements. However, NMR could be very useful under some circumstances. It could detect any hydrogen species in a sample, including such species as H2 that would be invisible with infrared. Potential applications of NMR to the study of hydrogen in minerals are reviewed by Simon Kohn. While structural models of "water" in minerals have already been deduced from infrared spectra several decades ago, in recent years atomistic modeling has become a powerful tool for predicting potential sites for hydrogen in minerals. The review by Kate Wright gives an overview over both quantum mechanical methods and classical methods based on interatomic potentials. Joseph Smyth then summarizes the crystal chemistry of hydrogen in high-pressure silicate and oxide minerals. As a general rule, the incorporation of hydrogen is not controlled by the size of potential sites in the crystal lattice; rather, the protons will preferentially attach to oxygen atoms that are electrostatically underbonded, such as the non-silicate oxygen atoms in some high-pressure phases. Moreover, heterovalent substitutions, e.g., the substitution of Al3+ for Si4+, can have a major effect on the incorporation of hydrogen. The second reason for even greater research interest in sulfide minerals arose initially from the discoveries of active hydrothermal systems in the deep oceans. The presence of life forms that have chemical rather than photosynthetic metabolisms, and that occur in association with newly-forming sulfides, has encouraged research on the potential of sulfide surfaces in catalyzing the reactions leading to assembling of the complex molecules needed for life on Earth. These developments have been associated with a great upsurge of interest in the interactions between microbes and minerals, and in the role that minerals can play in biological systems. In the rapidly growing field of geomicrobiology, metal sulfides are of major interest. This interest is related to a variety of processes including, for example, those where bacteria interact with sulfides as part of their metabolic activity and cause chemical changes such as oxidation or reduction, or those in which biogenic sulfide minerals perform a specific function, such as that of navigation in magnetotactic bacteria. The development of research in areas such as geomicrobiology and environmental mineralogy and geochemistry, is also leading to a greater appreciation of the role of sulfides (particularly the iron sulfides) in the geochemical cycling of the elements at or near the surface of the Earth. For example, the iron sulfides precipitated in the reducing environments beneath the surface of modern sediments in many estuarine areas may play a key role in the trapping of toxic metals and other pollutants. In our understanding of "Earth Systems," geochemical processes involving metal sulfides are an important part of the story. The main objective of the present text is to provide an up-to-date review of sulfide mineralogy and geochemistry. The emphasis is, therefore, on such topics as crystal structure and classification, electrical and magnetic properties, spectroscopic studies, chemical bonding, high and low temperature phase relations, thermochemistry, and stable isotope systematics. In the context of this book, emphasis is on metal sulfides sensu stricto where only the compounds of sulfur with one or more metals are considered. Where it is appropriate for comparison, there is brief discussion of the selenide or telluride analogs of the metal sulfides. When discussing crystal structures and structural relationships, the sulfosalt minerals as well as the sulfides are considered in some detail (see Chapter 2; also for definition of the term "sulfosalt"). However, in other chapters there is only limited discussion of sulfosalts, in part because there is little information available beyond knowledge of chemical composition and crystal structure. Given the dramatic developments in areas of research that were virtually non-existent at the time of the earlier reviews, major sections have been added here on sulfide mineral surface chemistry and reactivity, formation and transformation of metal-sulfur clusters and nanoparticles, modeling of hydrothermal precipitation, and on sulfides in biosystems. However, it should be emphasized that the growth in the literature on certain aspects of sulfide mineralogy over the past 20 years or so has been such that comprehensive coverage is not possible in a single volume. Thus, the general area of "sulfides in biosystems" is probably worthy of a volume in itself, and "environmental sulfide geochemistry" (including topics such as oxidative breakdown of sulfides) is another area where far more could have been written. In selecting areas for detailed coverage in this volume, we have been mindful of the existence of other relatively recent review volumes, including those in the RiMG series. It has also been our intention not to cover any aspects of the natural occurrence, textural or paragenetic relationships involving sulfides. This is published information that, although it may be supplemented by new observations, is likely to remain useful for a long period and largely not be superceded by later work. In the following chapters, the crystal structures, electrical and magnetic properties, spectroscopic studies, chemical bonding, thermochemistry, phase relations, solution chemistry, surface structure and chemistry, hydrothermal precipitation processes, sulfur isotope geochemistry and geobiology of metal sulfides are reviewed. Makovicky (Chapter 2) discusses the crystal structures and structural classification of sulfides and other chalcogenides (including the sulfosalts) in terms of the relationships between structural units. This very comprehensive survey, using a rather different and complementary approach to that used in previous review volumes, shows the great diversity of sulfide structures and the wealth of materials that remain to be characterized in detail. These materials include rare minerals, and synthetic sulfides that may represent as yet undescribed minerals. Pearce, Pattrick and Vaughan (Chapter 3) review the electrical and magnetic properties of sulfides, discussing the importance of this aspect of the sulfides to any understanding of their electronic structures (chemical bonding) and to applications ranging from geophysical prospecting and mineral extraction to geomagnetic and palaeomagnetic studies. Rapidly developing new areas of interest discussed include studies of the distinctive properties of sulfide nanoparticles. Wincott and Vaughan (Chapter 4) then outline the spectroscopic methods employed to study the crystal chemistry and electronic structures of sulfides. These range from UV-visible through infrared and Raman spectroscopies, to X-ray emission, photoemission and absorption, and to nuclear spectroscopies. Chemical bonding (electronic structure) in sulfides is the subject of the following chapter by Vaughan and Rosso (Chapter 5), a topic which draws on knowledge of electrical and magnetic properties and spectroscopic data as experimental input, as well as on a range of rapidly developing computational methods. Attention then turns to the thermochemistry of sulfides in a chapter by Sack and Ebel (Chapter 6) which is followed by discussion of phase equilibria at high temperatures in the review by Fleet (Chapter 7). Sulfides in aqueous systems, with emphasis on solution complexes and clusters, forms the subject matter of the chapter written by Rickard and Luther (Chapter 8). Sulfide mineral surfaces are the focus of the next two chapters, both by Rosso and Vaughan. The first of these chapters (Chapter 9) addresses characterization of the pristine sulfide surface, its structure and chemistry; the second (Chapter 10) concerns surface reactivity, including redox reactions, sorption phenomena, and the catalytic activity of sulfide surfaces. Reed and Palandri (Chapter 11) show in the next chapter how much can now be achieved in attempting to predict processes of sulfide precipitation in hydrothermal systems. The final chapters deal with two distinctive areas of sulfide mineralogy and geochemistry. Seal (Chapter 12) presents a comprehensive account of the theory and applications of sulfur isotope geochemistry; sulfur isotope fractionation can provide the key to understanding the natural processes of formation of sulfide deposits. In the final chapter, Posfai and Dunin-Borkowski (Chapter 13) review the rapidly developing area of sulfides in biosystems, discussing aspects of both sulfide mineral-microbe interactions and biomineralization processes involving sulfides.
    Type of Medium: Monograph available for loan
    Pages: XIII, 714 S. , Ill., graph. Darst., Tab.
    ISBN: 0-939950-73-1 , 978-0-939950-73-7
    ISSN: 1529-6466
    Series Statement: Reviews in mineralogy & geochemistry 61
    Classification:
    Mineralogy
    Note: Chapter 1. Sulfide Mineralogy and Geochemistry: Introduction and Overview by David J. Vaughan, p. 1 - 6 Chapter 2. Crystal Structures of Sulfides and other Chalcogenides by Emil Makovicky, p. 7 - 126 Chapter 3. Electrical and Magnetic Properties of Sulfides by Carolyn I. Pearce, Richard A.D. Pattrick, and David J. Vaughan, p. 127 - 180 Chapter 4. Spectroscopic Studies of Sulfides by Paul L. Wincott and David J. Vaughan, p. 181 - 230 Chapter 5. Chemical Bonding in Sulfide Minerals by David J. Vaughan and Kevin M. Rosso, p. 231 - 264 Chapter 6. Thermochemistry of Sulfide Mineral Solutions by Richard O. Sack and Denton S. Ebel, p. 265 - 364 Chapter 7. Phase Equilibria at High Temperatures by Michael E. Fleet, p. 365 - 420 Chapter 8. Metal Sulfide Complexes and Clusters by David Rickard and George W. Luther, III, p. 421 - 504 Chapter 9. Sulfide Mineral Surfaces by Kevin M. Rosso and David J. Vaughan, p. 505 - 556 Chapter 10. Reactivity of Sulfide Mineral Surfaces by Kevin M. Rosso and David J. Vaughan, p. 557 - 608 Chapter 11. Sulfide Mineral Precipitation from Hydrothermal Fluids by Mark H. Reed and James Palandri, p. 609 - 632 Chapter 12. Sulfur Isotope Geochemistry of Sulfide Minerals by Robert R. Seal, II, p. 633 - 678 Chapter 13. Sulfides in Biosystems by Mihaly Posfai and Rafal E. Dunin-Borkowski, p. 679 - 714
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 47
    Monograph available for loan
    Monograph available for loan
    New York : Simon & Schuster
    Call number: PIK D 024-06-0299
    Type of Medium: Monograph available for loan
    Pages: p. cm.
    ISBN: 0743274717
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 48
    Monograph available for loan
    Monograph available for loan
    Glasgow : HarperCollins
    Call number: 1.1/M 06.0482
    Type of Medium: Monograph available for loan
    Pages: 1872 S.
    Edition: 8th ed., complete & unabridged
    ISBN: 0007232306
    Classification:
    E.5.
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 49
    Call number: Z 06.0500
    Type of Medium: Journal available for loan
    Pages: 30 cm
    ISSN: 1824-7741
    Former Title: Vorgänger Geologisch-paläontologische Mitteilungen, Innsbruck
    Language: German , English
    Note: Ersch. unregelmäßig , Beiträge teilweise in Englisch
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 50
    Monograph available for loan
    Monograph available for loan
    Cambridge, Mass : MIT Press
    Call number: PIK N 071-07-0076
    Type of Medium: Monograph available for loan
    Pages: p. cm
    ISBN: 0262134683 , 0-262-63336-1
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 51
    Call number: PIK P 100-06-0288
    Type of Medium: Monograph available for loan
    Pages: 200 S. , graph. Darst.
    ISBN: 9264109862
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 52
    Monograph available for loan
    Monograph available for loan
    Chantilly, Va. : Mineralogical Society of America
    Associated volumes
    Call number: 11/M 06.0515
    In: Reviews in mineralogy & geochemistry
    Description / Table of Contents: Earth is a water planet. Oceans of liquid water dominate the surface processes of the planet. On the surface, water controls weathering as well as transport and deposition of sediments. Liquid water is necessary for life. In the interior, water fluxes melting and controls the solid-state viscosity of the convecting mantle and so controls volcanism and tectonics. Oceans cover more than 70% of the surface but make up only about 0.025% of the planet's mass. Hydrogen is the most abundant element in the cosmos, but in the bulk Earth, it is one of the most poorly constrained chemical compositional variables. Almost all of the nominally anhydrous minerals that compose the Earth's crust and mantle can incorporate measurable amounts of hydrogen. Because these are minerals that contain oxygen as the principal anion, the major incorporation mechanism is as hydroxyl, OH-, and the chemical component is equivalent to water, H2O. Although the hydrogen proton can be considered a monovalent cation, it does not occupy same structural position as a typical cation in a mineral structure, but rather forms a hydrogen bond with the oxygens on the edge of the coordination polyhedron. The amount incorporated is thus quite sensitive to pressure and the amount of H that can be incorporated in these phases generally increases with pressure and sometimes with temperature. Hydrogen solubility in nominally anhydrous minerals is thus much more sensitive to temperature and pressure than that of other elements. Because the mass of rock in the mantle is so large relative to ocean mass, the amount that is incorporated the nominally anhydrous phases of the interior may constitute the largest reservoir of water in the planet. Understanding the behavior and chemistry of hydrogen in minerals at the atomic scale is thus central to understanding the geology of the planet. There have been significant recent advances in the detection, measurement, and location of H in the nominally anhydrous silicate and oxide minerals that compose the planet. There have also been advances in experimental methods for measurement of H diffusion and the effects of H on the phase boundaries and physical properties whereby the presence of H in the interior may be inferred from seismic or other geophysical studies. It is the objective of this volume to consolidate these advances with reviews of recent research in the geochemistry and mineral physics of hydrogen in the principal mineral phases of the Earth's crust and mantle. The Chapters We begin with a review of analytical methods for measuring and calibrating water contents in nominally anhydrous minerals by George Rossman. While infrared spectroscopy is still the most sensitive and most convenient method for detecting water in minerals, it is not intrinsically quantitative but requires calibration by some other, independent analytical method, such as nuclear reaction analysis, hydrogen manometry, or SIMS. A particular advantage of infrared spectroscopy, however, is the fact that it does not only probe the concentration, but also the structure of hydrous species in a mineral and in many cases the precise location of a proton in a mineral structure can be worked out based on infrared spectra alone. The methods and principles behind this are reviewed by Eugen Libowitzky and Anton Beran, with many illustrative examples. Compared to infrared spectroscopy, NMR is much less used in studying hydrogen in minerals, mostly due to its lower sensitivity, the requirement of samples free of paramagnetic ions such as Fe2+ and because of the more complicated instrumentation required for NMR measurements. However, NMR could be very useful under some circumstances. It could detect any hydrogen species in a sample, including such species as H2 that would be invisible with infrared. Potential applications of NMR to the study of hydrogen in minerals are reviewed by Simon Kohn. While structural models of "water" in minerals have already been deduced from infrared spectra several decades ago, in recent years atomistic modeling has become a powerful tool for predicting potential sites for hydrogen in minerals. The review by Kate Wright gives an overview over both quantum mechanical methods and classical methods based on interatomic potentials. Joseph Smyth then summarizes the crystal chemistry of hydrogen in high-pressure silicate and oxide minerals. As a general rule, the incorporation of hydrogen is not controlled by the size of potential sites in the crystal lattice; rather, the protons will preferentially attach to oxygen atoms that are electrostatically underbonded, such as the non-silicate oxygen atoms in some high-pressure phases. Moreover, heterovalent substitutions, e.g., the substitution of Al3+ for Si4+, can have a major effect on the incorporation of hydrogen. Data on water in natural minerals from crust and mantle are compiled and discussed in three reviews by Elisabeth Johnson, Henrik Skogby and by Anton Beran and Eugen Libowitzky. Among the major mantle minerals, clinopyroxenes usually retain the highest water contents, followed by orthopyroxenes and olivine, while the water contents in garnets are generally low. Most of these water contents need to be considered as minimum values, as many of the mantle xenoliths may have lost water during ascent. However, there are some cases where the correlation between the water contents and other geochemical parameters suggest that the measured water concentrations reflect the true original water content in the mantle. The basic thermodynamics as well as experimental data on water solubility and partitioning are reviewed by Hans Keppler and Nathalie Bolfan Casanova. Water solubility in minerals depends in a complicated way on pressure, temperature, water fugacity and bulk composition. For example, water solubility in the same mineral can increase or decrease with temperature, depending on the pressure of the experiments. Nevertheless, the pressure and temperature dependence of water solubility can be described by a rather simple thermodynamic formalism and for most minerals of the upper mantle, the relevant thermodynamic parameters are known. The highest water solubilities are reached in the minerals wadsleyite and ringwoodite stable in the transition zone, while the minerals of the lower mantle are probably mostly dry. The rather limited experimental data on water partitioning between silicate melts and minerals are reviewed by Simon Kohn and Kevin Grant. One important observation here is that comparing the compatibility of hydrogen with that of some rare earth element is misleading, as such correlations are always limited to a small range of pressure and temperature for a given mineral. The stabilities of hydrous phases in the peridotite mantle and in subducted slabs are reviewed by Daniel Frost and by Tatsuhiko Kawamoto. While most of the water in the mantle is certainly stored in the nominally anhydrous minerals, hydrous phases can be important storage sites of water in certain environments. Amphibole and phlogopite require a significant metasomatic enrichment of Na and K in order to be stabilized in the upper mantle, but serpentine may be an important carrier of water in cold subducted slabs. The diffusion of hydrogen in minerals is reviewed by Jannick Ingrin and Marc Blanchard. An important general observation here is that natural minerals usually do not loose hydrogen as water, but as H2 generated by redox reaction of OH with Fe2+. Moreover, diffusion coefficients of different mantle minerals can vary by orders of magnitude, often with significant anisotropy. While some minerals in a mantle xenolith may therefore have lost virtually all of their water during ascent, other minerals may still preserve the original water content and in general, the apparent partition coefficients of water between the minerals of the same xenolith can be totally out of equilibrium. Accordingly, it would be highly desirable to directly deduce the water content in the mantle from geophysical data. One strategy, based on seismic velocities and therefore ultimately on the effect of water on the equation of state of minerals, is outlined by Steve Jacobsen. The dissolution of water in minerals usually increases the number of cation vacancies, yielding reduced bulk and shear moduli and seismic velocities. Particularly, the effect on shear velocities is strong and probably larger than the effect expected from local temperature variations. Accordingly, the vs/vp ratio could be a sensitive indicator of mantle hydration. A more general approach towards remote sensing of hydrogen in the Earth's mantle, including effects of seismic anisotropy due to lattice preferred orientation and the use of electrical conductivity data is presented by Shun-ichiro Karato. Probably the most important effect of water on geodynamics is related to the fact that even traces of water dramatically reduce the mechanical strength of rocks during deformation. The physics behind this effect is discussed by David Kohlstedt. Interestingly, it appears that the main mechanism behind "hydrolytic weakening" is related to the effect of water on the concentration and mobility of Si vacancies, rather than to the protons themselves. Water may have major effects on the location of mantle discontinuities, as reviewed by Eiji Ohtani and Konstantin Litasov. Most of these effects can be rationalized as being due to the expansion of the stability fields of those phases (e.g., wadsleyite) that preferentially incorporate water. Together with other geophysical data, the changes in the depths of discontinuities are a promising tool for the remote sensing of water contents in the mantle. The global effects of water on the evolution of our planet are reviewed in the last two chapters by Bernard Marty, Reika Yokochi and Klaus Regenauer-Lieb. By combining hydrogen und nitrogen isotope data, Marty and Yokochi demonstrate convincingly that most of the Earth's water very likely originated from a chondritic source. Water may have had a profound effect on the early evolution of our planet, since a water-rich dense atmosphere could have favored melting by a thermal blanketing effect. However, Marty and Yokochi also show very clearly that it is pretty much impossible to derive reliable estimates of the Earth's present-day water content from cosmochemical arguments, since many factors affecting the loss of water during and after accretion are poorly constrained or not constrained at all. In the last chapter, Klaus Regenauer-Lieb investigates the effect of water on the style of global tectonics. He demonstrates that plate tectonics as we know it is only possible if the water content of the mantle is above a threshold value. The different tectonic style observed on Mars and Venus may therefore be directly related to differences in mantle water content. Earth is the water planet — not just because of it's oceans, but also because of its tectonic evolution.
    Type of Medium: Monograph available for loan
    Pages: xix, 478 S.
    ISBN: 0-939950-74-X , 978-0-939950-74-4
    ISSN: 1529-6466
    Series Statement: Reviews in mineralogy & geochemistry 62
    Classification:
    Hydrology
    Note: Chapter 1. Analytical Methods for Measuring Water in Nominally Anhydrous Minerals by George R. Rossman, p. 1 - 28 Chapter 2. The Structure of Hydrous Species in Nominally Anhydrous Minerals: Information from Polarized IR Spectroscopy by Eugen Libowitzky and Anton Beran, p. 29 - 52 Chapter 3. Structural Studies of OH in Nominally Anhydrous Minerals Using NMR by Simon C. Kohn, p. 53 - 66 Chapter 4. Atomistic Models of OH Defects in Nominally Anhydrous Minerals by Kate Wright, p. 67 - 84 Chapter 5. Hydrogen in High Pressure Silicate and Oxide Mineral Structures by Joseph R. Smyth, p. 85 - 116 Chapter 6. Water in Nominally Anhydrous Crustal Minerals: Speciation, Concentration, and Geologic Significance by Elizabeth A. Johnson, p. 117 - 154 Chapter 7. Water in Natural Mantle Minerals I: Pyroxenes by Henrik Skogby, p. 155 - 168 Chapter 8. Water in Natural Mantle Minerals II: Olivine, Garnet and Accessory Minerals by Anton Beran and Eugen Libowitzky, p. 169 - 192 Chapter 9. Thermodynamics of Water Solubility and Partitioning by Hans Keppler and Nathalie Bolfan-Casanova, p. 193 - 230 Chapter 10. The Partitioning of Water Between Nominally Anhydrous Minerals and Silicate Melts by Simon C. Kohn and Kevin J. Grant, p. 231 - 242 Chapter 11. The Stability of Hydrous Mantle Phases by Daniel J. Frost, p. 243 - 272 Chapter 12. Hydrous Phases and Water Transport in the Subducting Slab by Tatsuhiko Kawamoto, p. 273 - 290 Chapter 13. Diffusion of Hydrogen in Minerals by Jannick Ingrin and Marc Blanchard, p. 291 - 320 Chapter 14. Effect of Water on the Equation of State of Nominally Anhydrous Minerals by Steven D. Jacobsen, p. 321 - 342 Chapter 15. Remote Sensing of Hydrogen in Earth's Mantle by Shun-ichiro Karato, p. 343 - 376 Chapter 16. The Role of Water in High-Temperature Rock Deformation by David L. Kohlstedt, p. 377 - 396 Chapter 17. The Effect of Water on Mantle Phase Transitions by Eiji Ohtani and K. D. Litasov, p. 397 - 420 Chapter 18. Water in the Early Earth by Bernard Marty and Reika Yokochi, p. 421 - 450 Chapter 19. Water and Geodynamics by Klaus Regenauer-Lieb, p. 451 - 474
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 53
    Monograph available for loan
    Monograph available for loan
    Cheshire, Conn. : Graphics Press
    Call number: M 06.0567
    Type of Medium: Monograph available for loan
    Pages: 213 S. , Ill., graph. Darst.
    ISBN: 0961392177
    Classification:
    Informatics
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 54
    Call number: M 06.0537
    Type of Medium: Monograph available for loan
    Pages: XIV, 273 S. , Ill., graph. Darst., Kt.
    ISBN: 3938616407
    Classification:
    Tectonics
    Note: Beitr. teilw. dt., teilw. engl.
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 55
    Series available for loan
    Series available for loan
    Hannover : Fachrichtung Geodäsie und Geoinformatik, Univ. Hannover
    Associated volumes
    Call number: S 99.0139(263)
    In: Wissenschaftliche Arbeiten der Fachrichtung Geodäsie und Geoinformatik der Leibniz Universität Hannover
    Type of Medium: Series available for loan
    Pages: 344 S. , Ill., graph. Darst., Kt.
    Series Statement: Wissenschaftliche Arbeiten der Fachrichtung Geodäsie und Geoinformatik der Leibnitz Universität Hannover 263
    Classification:
    Cartography, Geographical Information Systems, GIS
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 56
    Call number: S 99.0121(90)
    In: Mitteilungen
    Type of Medium: Series available for loan
    Pages: xii, 164 S. , graph. Darst.
    ISBN: 3906467600
    Series Statement: IGP Mitteilungen 90
    Classification:
    Cartography, Geographical Information Systems, GIS
    Note: Zugl.: Zürich, Eidgenössische Techn. Hochsch., Diss., 2006, No. 16474
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 57
    Series available for loan
    Series available for loan
    Zürich : Inst. für Geodäsie und Photogrammetrie
    Associated volumes
    Call number: S 99.0121(91)
    In: Mitteilungen
    Type of Medium: Series available for loan
    Pages: xii, 160 S. , III., graph. Darst.
    ISBN: 3906467619
    Series Statement: IGP Mitteilungen 91
    Classification:
    Photogrammetry, Remote Sensing
    Note: Zugl.: Zürich, Eidgenössische Techn. Hochsch., Diss., 2006, No. 16562
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 58
    Call number: S 00.0063(47)
    In: Schriftenreihe der Deutschen Gesellschaft für Geowissenschaften
    Type of Medium: Series available for loan
    Pages: 107 S. : farb. Ill., graph. Darst. + 1 CD-ROM, 1 Kt.-Beil. (Profilschnitt und Legende)
    ISBN: 3932537432
    Series Statement: Schriftenreihe der Deutschen Gesellschaft für Geowissenschaften 47
    Classification:
    Regional Geology
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 59
    Call number: M 15.89085
    Type of Medium: Monograph available for loan
    Pages: 492 S , zahlr. Ill., graph Darst
    Edition: 2. aktualisierte u. erw. Aufl.
    ISBN: 3836219867 , 9783836219860
    Series Statement: SAP PRESS
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 60
    Call number: M 15.89533
    Type of Medium: Monograph available for loan
    Pages: 1008 S.
    Edition: 4., aktualisierte und erw. Aufl.
    ISBN: 3836219174 , 9783836219174
    Series Statement: SAP PRESS
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 61
    Unknown
    Oxford : Oxford University Press
    Call number: 22/M 15.89566 (1. Ex.) ; 22/M 15.89566 (2. Ex.) ; 22/M 15.89566 (3. Ex.) ; 22/M 15.89566 (4. Ex.) ; 22/M 15.89566 (5. Ex.) ; 22/M 15.89566 (6. Ex.) ; 22/M 15.89566 (7. Ex.) ; 22/M 15.89566 (8. Ex.) ; 22/M 15.89566 (9. Ex.) ; 22/M 15.89566 (10. Ex.)
    Description / Table of Contents: Completely revised and updated, this new edition of the Oxford Guide to Plain English is an essential tool for clear communication. It provides authoritative help on how to get your message across effectively. In 25 easy-to-follow chapters, it covers straightforward language, punctuation, grammar, writing emails, and much more.
    Pages: xxxii, 288 S. , Ill. , 20 cm
    Edition: 4. edition
    ISBN: 0199669171 ((pbk.) £7.99) , 9780199669172 ((pbk.) £7.99)
    Language: English
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 62
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 91.0021(34)
    In: Mainzer geowissenschaftliche Mitteilungen
    Type of Medium: Series available for loan
    Pages: 340 S.
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 63
    Monograph available for loan
    Monograph available for loan
    Oxford : Oxford Univ. Press
    Call number: PIK N 071-15-89127
    Type of Medium: Monograph available for loan
    Pages: XXIII, 317 S.
    Edition: 1. ed.
    ISBN: 0199686394 , 9780199686391
    Language: English
    Note: Introduction.EU energy law and the approach taken in this studyThe regulatory history of EU energy : the evolution of EU energy law from 1957 onwardsThe evolution of the sector-specific regulatory frameworkTreaty law and the energy sectorEnvironment and energy : on a bumpy road towards a clean energy futureThe international dimension of EU energy law and policyFrom state to market and back : the changing role(s) of markets and states in the EUConclusion.European energy law under the impact of globalization : from state to market, from plan to contract, from public ownership to economic regulation and beyond..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 64
    Monograph available for loan
    Monograph available for loan
    [Paris] : Stock
    Call number: IASS 15.89527
    Type of Medium: Monograph available for loan
    Pages: 192 S , 22 cm
    ISBN: 9782234075337 (br) , 2234075335 (br)
    Series Statement: Les essais
    Language: French
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 65
    Monograph available for loan
    Monograph available for loan
    Heidelberg : Kehrer
    Call number: IASS 16.89647
    Type of Medium: Monograph available for loan
    Pages: 122 S. , zahlr. Ill., graph. Darst., Kt , 25 cm
    ISBN: 9783868280951 (kart.)
    Series Statement: Reihe Kunst + Wissenschaft
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 66
    Monograph available for loan
    Monograph available for loan
    Cambridge, Mass. [u.a.] : MIT Press
    Call number: PIK B 020-16-89772
    Type of Medium: Monograph available for loan
    Pages: XXVII, 1064 S. , graph. Darst.
    Edition: 2. ed.
    ISBN: 0262232588 (hbk.) , 9780262232586
    Language: English
    Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 67
    Monograph available for loan
    Monograph available for loan
    Stuttgart : Kohlhammer
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 68
    Monograph available for loan
    Monograph available for loan
    College Station, Tex. : Stata Press
    Call number: PIK M 311-15-89488
    Type of Medium: Monograph available for loan
    Pages: XXXI, 379 S. , graph. Darst.
    ISBN: 1597180475 (pbk.) , 9781597180474 (pbk.)
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 69
    Monograph available for loan
    Monograph available for loan
    Heidelberg [u.a.] : Springer
    Call number: PIK M 390-16-89505
    Type of Medium: Monograph available for loan
    Pages: XVIII, 436 S. , graph. Darst. , 235 mm x 155 mm
    Edition: 4. ed., 2. corr. print.
    ISBN: 9783642142789 (PB.) , 9783642142796
    Series Statement: Graduate texts in mathematics 173
    Language: English
    Note: The basics -- Matching, covering and packing -- Connectivity -- Planar graphs -- Colouring -- Flows -- Extremal graph theory -- Infinite graphs -- Ramsey theory for graphs -- Hamilton cycles -- Random graphs -- Minors, trees, and WQO..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 70
    Monograph available for loan
    Monograph available for loan
    Berlin [u.a.] : Springer
    Call number: PIK M 370-16-89506
    Type of Medium: Monograph available for loan
    Pages: XX, 675 S. , graph. Darst. , 25 cm
    Edition: 4th ed.
    ISBN: 3642322778 (Pp.) , 9783642322778 (Pp.) , 9783642322785
    Series Statement: Algorithms and computation in mathematics 5
    Uniform Title: Graphen, Netzwerke und Algorithmen 〈engl.〉
    Language: English
    Note: 1. Basic graph theory2. Algorithms and complexity -- 3. Shortest paths -- 4. Spanning trees -- 5. The greedy algorithm -- 6. Flows -- 7. Combinatorial applications -- 8. Connectivity and depth first search -- 9. Colorings -- 10. Circulations -- 11. The network simplex algorithm -- 12. Synthesis of networks -- 13. Matchings -- 14. Weighted matchings -- 15. A hard problem: the TSP -- Appendix A. Some NP-complete problems -- Appendix B. Solutions -- Appendix C. List of symbols..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 71
    Monograph available for loan
    Monograph available for loan
    New York : Springer
    Call number: PIK M 390-16-89508
    Type of Medium: Monograph available for loan
    Pages: XVI, 417 S. , graph. Darst.
    ISBN: 0387239464 , 9780387239460 , 0387344713
    Series Statement: Springer series in operations research and financial engineering
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 72
    Call number: IASS 16.89630/2
    Type of Medium: Monograph available for loan
    Pages: S. 118 - 235 , Ill. , 28 cm
    Language: German , English
    Note: Text dt. und engl.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 73
  • 74
    Call number: IASS 16.89630/1
    Type of Medium: Monograph available for loan
    Pages: 107 S. , zahlr. Ill., graph. Darst. , 1 Bl. Bauanleitung - 1 Bl. Entwurf , 28 cm
    Language: German , English
    Note: Text dt. und engl. - Text in Faltbl. [1] dt.
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 75
    Type of Medium: Monograph available for loan
    ISBN: 9783775727723
    Language: German , English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 76
    Call number: PIK A 190-16-89749
    Description / Table of Contents: Modern science is a model-building activity. But how are models contructed? How are they related to theories and data? How do they explain complex scientific phenomena, and which role do computer simulations play? To address these questions which are highly relevant to scientists as well as to philosophers of science, 8 leading natural, engineering and social scientists reflect upon their modeling work, and 8 philosophers provide a commentary
    Description / Table of Contents: Modern science is a model-building activity. But how are models contructed? How are they related to theories and data? How do they explain complex scientific phenomena, and which role do computer simulations play? To address these questions which are highly relevant to scientists as well as to philosophers of science, 8 leading natural, engineering and social scientists reflect upon their modeling work, and 8 philosophers provide a commentary. U. Gähde and J. H. Wolf, University of Hamburg; S. Hartmann, Ludwig-Maximilians-Universität Munich.
    Type of Medium: Monograph available for loan
    Pages: VIII, 274 Seiten , graph. Darst.
    ISBN: 9783110313680 , 9783110313604
    Series Statement: Abhandlungen der Akademie der Wissenschaften in Hamburg 4
    Language: English
    Note: Preface; Contributors; Content; Introduction; Cosmology - The Largest Possible Model?; The Standard Model of Cosmology as a Tool for Interpretation and Discovery; Patterns in Physical and Biological Systems; Symmetry and the Explanation of Organismal Form; Pluralistic Modeling of Complex Systems; The Methodological Challenges of Complex Systems; Contested Modeling: The Case of Economics; A Unifying Approach to High- and Low-Level Cognition; High-vs Low-Level Cognition and the Neuro- Emulative Theory of Mental Representation. , Evaluating a Computational Model of Eye-Movement Control in ReadingConsidering Criteria for Model Modification and Theory Change in Psychology; Identification of Kinetic Models by Incremental Refinement; Kinetics, Models, and Mechanism; Modeling Complexity: The Case of Climate Science; Chaos, Plurality, and Model Metrics in Climate Science; Subject Index; Author Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 77
    Call number: M 16.90059
    Description / Table of Contents: This handbook brings together a great deal of new data on the static and dynamic elastic properties of granular and other composite material. The authors are at the very center of today's research and present new and imported theoretical tools that have enabled our current understanding of the complex behavior of rocks.There are three central themes running throughout the presentation: ? Rocks as the prototypical material for defining a class of materials? The PM space model as a useful theoretical construct for developing a phenomenology? A sequence of refined analysis methods. This suite of
    Type of Medium: Monograph available for loan
    Pages: XIII, 395 S. , ill., maps
    ISBN: 9783527407033
    Classification:
    Planetary Interiors
    Language: English
    Note: Nonlinear Mesoscopic Elasticity; Contents; Preface; Acknowledgements; 1 Introduction; 1.1 Systems; 1.2 Examples of Phenomena; 1.3 The Domain of Exploration; 1.4 Outline; References; 2 Microscopic/Macroscopic Formulation of the Traditional Theory of Linear and Nonlinear Elasticity; 2.1 Prefatory Remarks; 2.2 From Microscopic to Continuum; 2.2.1 A Microscopic Description; 2.2.2 Microscopic Description and Thermodynamics; 2.2.3 From Microscopic Model to Continuum Elasticity; 2.3 Continuum Elasticity and Macroscopic Phenomenology; 2.3.1 Displacement, Strain, and Stress. , 2.3.2 Dynamics of the Displacement Field2.3.3 Coupling Continuum Elasticity to Auxiliary Fields; 2.3.4 Inhomogeneous Elastic Systems; 2.4 Thermodynamics; 2.4.1 Thermodynamic Derivatives; 2.4.2 Series Expansion for ES; 2.4.3 Series Expansion for EZ; 2.4.4 Series Expansion for FT; 2.4.5 Assemble the Pieces; 2.5 Energy Scales; References; 3 Traditional Theory of Nonlinear Elasticity, Results; 3.1 Quasistatic Response; Linear and Nonlinear; 3.1.1 Quasistatic Response; Linear; 3.1.2 Quasistatic Response; Nonlinear; 3.2 Dynamic Response; Linear; 3.3 Quasistatic/Dynamic Response; Nonlinear. , 3.4 Dynamic Response Nonlinear; 3.4.1 Basic Equations; 3.4.2 Wave Propagation; 3.4.3 Resonant Bar; 3.5 Exotic Response; Nonlinear; 3.6 Green Functions; 3.6.1 Green Function, Free Space; 3.6.2 Green Function, Resonant Bar; References; 4 Mesoscopic Elastic Elements and Macroscopic Equations of State; 4.1 Background; 4.2 Elastic Elements; 4.2.1 Hertz-Mindlin Contacts; 4.2.2 Hysteretic Hertzian Contacts; 4.2.3 Hertzian Asperities; 4.2.4 Van der Waals Surfaces; 4.2.5 Other; 4.3 Effective Medium Theory; 4.4 Equations of State; Examples; 4.4.1 Hertzian Contacts; 4.4.2 Van der Waals Surfaces. , 4.4.3 Generalization and CaveatsReferences; 5 Auxiliary Fields; 5.1 Temperature; 5.2 Saturation; 5.2.1 Saturation/Strain Coupling; 5.2.2 Saturation/Strain Response; 5.3 The Conditioning Field, X; References; 6 Hysteretic Elastic Elements; 6.1 Finite Displacement Elastic Elements; Quasistatic Response; 6.1.1 Finite Displacement Elastic Elements: The Model; 6.1.2 Finite Displacement Elastic Element: Implementing the Model; 6.2 Finite Displacement Elastic Elements: Inversion; 6.3 Finite Displacement Elastic Elements: Dynamic Response; 6.3.1 Finite Displacement Elastic Element: Resonant Bar. , 6.3.2 Finite Displacement Elastic Element: Wave Mixing6.4 Models with Hysteresis; 6.5 Summary; 6.6 Models with Hysteresis, Detail; 6.6.1 Hertzian Contacts; 6.6.2 The Masing Rules; 6.6.3 The Endochronic Formalism; References; 7 The Dynamics of Elastic Systems; Fast and Slow; 7.1 Fast/Slow Linear Dynamics; 7.1.1 Quasistatic Response; 7.1.2 AC Response; 7.2 Fast Nonlinear Dynamics; 7.3 Auxiliary Fields and Slow Dynamics; 7.3.1 X = The Conditioning Field; 7.3.2 X = Temperature; 7.4 Summary; References; 8 Q and Issues of Data Modeling/Analysis; 8.1 Attenuation in Linear Elastic Systems. , 8.1.1 Wave Vector Dispersion.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 78
    Call number: M 16.89961
    Type of Medium: Monograph available for loan
    Pages: xix, 694, [7] p. : , ill., maps ; , 27 cm.
    Edition: Shohan.
    ISBN: 9784130607599 , 4130607596
    Classification:
    Seismology
    Language: Japanese
    Note: In Japanese.
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 79
    Monograph available for loan
    Monograph available for loan
    München : Open Source Press
    Call number: 18/M 16.90221
    Type of Medium: Monograph available for loan
    Pages: 575 Seiten , Ill., graph. Darst , 24 cm
    Edition: 5. Aufl.
    ISBN: 9783955390402
    Series Statement: Root's reading
    Classification:
    Informatics
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 80
    Monograph available for loan
    Monograph available for loan
    Cham [u.a.] : Springer
    Call number: IASS 16.90414
    Type of Medium: Monograph available for loan
    Pages: VI, 309 Seiten , Illustrationen
    ISBN: 9783319014951 , 9783319014968 (electronic)
    Series Statement: Economic complexity and evolution
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 81
    Monograph available for loan
    Monograph available for loan
    New York : HarperOne
    Call number: IASS 16.90551
    Type of Medium: Monograph available for loan
    Pages: XXII, 147 S
    Edition: 1. Harperone paperback ed
    ISBN: 9780060937133
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 82
    Call number: IASS 16.90547
    Type of Medium: Monograph available for loan
    Pages: XLV, 448 S , Ill., graph. Darst., Kt
    ISBN: 9780660197241 , 0660197243 , 9781845935832 (CABI) , 1845935837 (CABI)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 83
    Monograph available for loan
    Monograph available for loan
    London : Sage
    Call number: IASS 16.90432
    Type of Medium: Monograph available for loan
    Pages: 260 S.
    Edition: Repr
    ISBN: 9780803983465 (pbk) , 9780803983458 (hbk)
    Series Statement: Theory, culture and society
    Uniform Title: Risikogesellschaft 〈engl.〉
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 84
    Monograph available for loan
    Monograph available for loan
    Cambridge : Cambridge Univ. Press
    Call number: IASS 16.90469
    Type of Medium: Monograph available for loan
    Pages: XVII, 314 S. , Ill., graph. Darst.
    ISBN: 0521198038 (hbk) , 9780521198035 (hbk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 85
    Call number: IASS 16.90470
    Type of Medium: Monograph available for loan
    Pages: V, 279 S.
    ISBN: 047052426X (hbk) , 9780470524268 (hbk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 86
    Monograph available for loan
    Monograph available for loan
    Highclere : Berkshire Academic Press
    Call number: IASS 16.90588
    Type of Medium: Monograph available for loan
    Pages: XVII, 269 S.
    ISBN: 9781907784095
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 87
    Monograph available for loan
    Monograph available for loan
    Berlin : Springer
    Call number: IASS 16.90586
    Type of Medium: Monograph available for loan
    Pages: XXIX, 411 S. , graph. Darst.
    Edition: 4. ed.
    ISBN: 3642345972 , 9783642345975 , 9783642345982 (electronic)
    Series Statement: WMU studies in maritime affairs 1
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 88
    Call number: IASS 17.90611
    Description / Table of Contents: The Arctic is undergoing rapid and dramatic environmental and social transformations due to climate change. This has ramifications for the entire planet, as change spreads through interconnected global networks that are environmental, cultural, economic and political. Today, with the major thrust of research shifting away from deciphering causes and monitoring trends, the central preoccupation of a growing circle of actors has become the exploration of strategies for responding and adapting to climate change. But to understand the far-reaching nature of climate change impacts and the complexities of adaptation, a truly interdisciplinary approach is required. Unique in the UN system, UNESCO brings together the domains of natural sciences, social sciences, culture, education and communication. Given this broad mandate, UNESCO favors integrated approaches for monitoring and adapting to climate change in the Arctic, fostering dialogue among scientists, circumpolar communities and decision-makers. This book brings together the knowledge, concerns and visions of leading Arctic scientists in the natural and social sciences, prominent Chukchi, Even, Inuit and Saami leaders from across the circumpolar North, and international experts in education, health and ethics. They highlight the urgent need for a sustained interdisciplinary and multi-actor approach to monitoring, managing and responding to climate change in the Arctic, and explore avenues by which this can be achieved.--Publisher's description
    Type of Medium: Monograph available for loan
    Pages: XVII, 357 S. , Ill., graph. Darst., Kt
    ISBN: 9789231041396
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 89
    Call number: AWI G3-17-90622
    In: Lecture Notes in Earth Sciences, 118
    Type of Medium: Monograph available for loan
    Pages: XXIX, 387 S. , Ill., graph. Darst., Kt. , 24 cm
    ISBN: 9783642002878 (GB.) , 9783642002885 (electronic)
    Series Statement: Lecture notes in earth sciences 118
    Language: English
    Note: Contents: PART I GEOLOGICAL AND PALEOECOLOGICAL EVENTS OF THE LATE PLEISTOCENE AND HOLOCENE IN NORTHERN EURASIA. - 1 Geological and Paleoecological Events of the Late Pleistocene along Eurasian Coastal Areas of the Arctic Ocean. - General Upper Pleistocene Stratigraphie Scheme for Northern Eurasia. - Duration of the Mikulino Interglaciation. - Correlation of the Natural Events Correlative with MIS 5d-5a in Northern West Europe and Northwestern Russia. - 2 Late Pleistocene Geologic-Paleoecological Events in the North of European Russia. - Relationship between Land and Sea Areas during the Mikulino Interglacial in Northern Eurasia. - Genetic Types of Continental Sediments. - Marine Sediments of the Boreal Transgression in the North of European Russia. - 3 Main Geologic-Paieoecoioglcal Events of the Late Pleistocene in the North of Western Siberia. - 4 Geologic-Paleoecological Events of the late Pleistocene in the Northern-Siberian Lowland and Taimyr Peninsula. - 5 The Late Glacial Time and Holocene of Northern Eurasia. - 6 Outlines of the Late Pleistocene and Holocene History of the East Arctic Seas. - 7 The Deglaciation Time and Holocene of Northern Eurasia. - PART II MARINE SEDIMENTATION IN THE ARCTIC OCEAN AND SUBARCTIC SEAS. - 8 The Seas of West Subarctic Region. - Geologic and Oceanographic Setting. - History of Sedimentation. - History of Sedimentation Rates. - History of Sedimentation on the Vøring Plateau During the Last 25 ka. - History of Sedimentation at the Continental Margin of Eastern and South-Eastern Greenland During the Last 130 ka. - 9 The Arctic Ocean. - Recent Environment. - Morphostructure, Oceanographic and Sea-Ice Setting, Recent Sediments and Their Mineral Composition. - Facies Variations of Holocene Sediments on the Yermak Plateau (According to Study Data of 〉 63 mkm Fraction). - History of Sedimentation. - History of Sedimentation Rates During the Last 130 ka. - History of Sedimentation on the Yermak Plateau During the Last 190 ka. - Organic-Geochemical Sediment Studies of the Eastern Part of the Central Arctic. - 10 The Western Arctic Seas. - Recent Sedimentation Environment. - The Barents Sea. - The Kara Sea. - Surface Sediments of the Pechora Sea. - Surface Sediments of St. Anna Trough. - Facies Zonality of Surface Sediments in the Eastern Kara Sea. - History of Sedimentation. - Late- and Post-Glacial History of Sedimentation in the Eastern Part of the Barents Sea. - Holocene Sedimentation History in the Southern Novaya Zemlya Trough. - History of Sedimentation in the Pechora Sea During the Late Pleistocene and Holocene. - Light Fraction Mineralogy of the Upper Quaternary Sediments from the Saint Anna Trough and Its Paleoceanographic Interpretation. - Holocene History of Yenisei River Discharge. - Holocene History of Ob River Discharge. - 11 Eastern Arctic Seas. - Recent Sedimentation Environment. - The Laptev Sea. - The East Siberian Sea. - The Chukchi Sea. - History of Sedimentation. - History of Sedimentation in the Laptev Sea During the Late Weichselian to Holocene by Geophysical and Geochemical Data. - Holocene History of the Lena and Other Rivers Discharge in the Laptev Sea. - Organic Geochemical Data About Sedimentation History Along the Continental Slope of the East Siberian Sea During the Last Climatic Cycle. - Preliminary Data About Accumulation of Diatom-Bearing Clayey Silts at the Chukchi Sea Shelf. - 12 Seas of the Eastern Subarctic. - Recent Sedimentation Environment. - History of Sedimentation. - History of Sedimentation in the Deep-Water Part of the Shirshov Ridge (Bering Sea) During the Last Three Marine-Isotope Stages. - History of Sedimentation in the Northern Sea of Okhotsk During the Last 1.1 Ma. - PART III THE LATE PLEISTOCENE PALEOGEOGRAPHIC EVENTS OF NORTHERN EURASIA AND HISTORY OF SEDIMENTATION IN THE SUBARCTIC SEAS AND THE ARCTIC OCEAN IN RELATION TO THE NORTHERN HEMISPHERE GLACIATION DURING THE LAST CLIMATIC CYCLE. - 13 Characteristic Features of the Mikulino Landscapes. - 14 Results of Paleoclimate Studies. - 15 Particularities of Sedimentation Processes Within the Continental Blocks and Marine Basins. - Deglaciation Peculiarities. - Facies Variability during Glaciations, Deglaciations, Interglacials. - Geological History of the Arctic Ocean Sea Ice during the Last 60 ka. - Intercoupling of Atmo-, Hydro-, Cryo-, Bio-, and Lithospheres. - References. - Index.
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 90
    Monograph available for loan
    Monograph available for loan
    London [u.a.] : Verso
    Call number: IASS 17.90937
    Type of Medium: Monograph available for loan
    Pages: XVIII, 394 S. , graph. Darst. , 23 cm
    ISBN: 184467617X (pbk) , 9781844676170 (pbk) , 1844676188 (hbk) , 9781844676187 (hbk)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 91
    Series available for loan
    Series available for loan
    Associated volumes
    Call number: S 00.0652(2013-2015
    In: Erdbebenbeobachtung im Freistaat Sachsen
    Type of Medium: Series available for loan
    Pages: 54 Seiten , farbige Illustrationen und graphische Darstellungen
    Series Statement: Erdbebenbeobachtung in Mitteldeutschland
    Classification:
    Seismology
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 92
    Monograph available for loan
    Monograph available for loan
    London : Penguin Books
    Associated volumes
    Call number: IASS 17.91049
    In: Incerto
    Type of Medium: Monograph available for loan
    Pages: xix, 519 Seiten , Illustrationen, Diagramme
    ISBN: 9780141038223
    Series Statement: Incerto / Nassim Nicholas Taleb
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 93
    Monograph available for loan
    Monograph available for loan
    [London] : Penguin Books
    Associated volumes
    Call number: IASS 17.91050
    In: Incerto
    Type of Medium: Monograph available for loan
    Pages: xxxiii, 444 Seiten , Illustrationen, Diagramme
    Edition: revised edition
    ISBN: 9780141034591
    Series Statement: Incerto / Nassim Nicholas Taleb
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 94
    Series available for loan
    Series available for loan
    Wien : Verlag Naturhistorisches Museum
    Associated volumes
    Call number: S 93.0602(120A)
    In: Annalen des Naturhistorischen Museums in Wien
    Type of Medium: Series available for loan
    Pages: 511 Seiten , Illustrationen
    ISBN: 9783903096202
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 95
    Call number: S 94.9499(14)
    In: Geowissenschaftliche Mitteilungen von Thüringen
    Type of Medium: Series available for loan
    Pages: 95 Seiten , Illustrationen
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 96
    Call number: IASS 17.91236
    Type of Medium: Monograph available for loan
    Pages: XVI, 237 S , graph. Darst.
    Edition: 1. ed
    ISBN: 9780415779319 (hbk) , 9780415779326 (pbk) , 9780203864302 (ebk) , 0415779316 (hbk) , 0415779324 (pbk) , 0203864301 (ebk)
    Language: English
    Note: Thinking differently for an age of complexity -- How can theory improve practice? -- Stories from the field -- The praxis of collaboration -- Dialogue as a community of inquiry -- Knowledge into action : the role of dialogue -- Using local knowledge for justice and resilience -- Beyond collaboration : democratic governance for a resilient society..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 97
    Call number: IASS 17.91239
    Type of Medium: Monograph available for loan
    Pages: X, 326 S. , zahlr. Ill., graph. Darst. , 24 cm
    ISBN: 9781118083468 (pbk.) , 9781118330241 (electronic) , 9781118330883 (electronic) , 9781118333068 (electronic) , 9781118392188 (electronic) , 9781118392195 (electronic)
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 98
    Monograph available for loan
    Monograph available for loan
    Los Angeles : SAGE
    Call number: IASS 17.91242
    Type of Medium: Monograph available for loan
    Pages: xii, 484 Seiten , 25 cm
    Edition: First paperback edition
    ISBN: 9781446270455 , 9781412934008
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 99
    Call number: 5/M 18.91371
    In: Space science series of ISSI
    Type of Medium: Monograph available for loan
    Pages: 664 Seiten , Ill., graph. Darst., Kt. , 235 mm x 155 mm
    ISBN: 9781441959003
    Series Statement: Space Sciences Series of ISSI 33
    Classification:
    Geomagnetism, Geoelectromagnetism
    Language: English
    Note: Planetary magnetism : foreword / A. Balogh ... [et al.] -- Space exploration of planetary magnetism / N.F. Ness -- Planetary magnetic field measurements : missions and instrumentation / A. Balogh -- Current systems in planetary magnetospheres and ionospheres / W. Baumjohann ... [et al.] -- Separation of the magnetic field into external and internal parts / N. Olsen, K.-H. Glassmeir, X. Jia -- The magnetic field of planet Earth / G. Hulot ... [et al.] -- Crustal magnetic fields of terrestrial planets / B. Langlais ... [et al.] -- Magnetic fields of the outer planets / C.T. Russell, M.K. Dougherty -- Magnetic fields of the satellites of Jupiter and Saturn / X. Jia ... [et al.] -- The magnetic field of mercury / B.J. Anderson ... [et al.] -- Paleomagnetic records of meteorites and early planetesimal differentiation / B.P. Weiss ... [et al.] -- Induced magnetic fields in solar system bodies / J. Saur, f.M. Neubauer, K.-H. Glassmeier -- The interior structure, composition, and evolution of giant planets / J.J. Fortney, N. Nettelmann -- Thermal evolution and magnetic field generation in terrestrial planets and satellites / D. Breuer, S. Labrosse, T. Spohn -- Theory and modeling of planetary dynamos / J. Wicht, A. Tilgner -- Laboratory dynamo experiments / G. Verhille ... [et al.] -- Dynamo scaling laws and applications to the planets / U.R. Christensen -- The solar dynamo / C.A. Jones, M.J. Thompson, S.M. Tobias -- Dynamo models for planets other than Earth / S. Stanley, G.A. Glatzmaier -- Planetary magnetic fields : achievements and prospects / D.J. Stevenson..
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
  • 100
    Monograph available for loan
    Monograph available for loan
    Harpenden, Herts : VOCAT International Ltd.
    Call number: PIK B 190-18-91631
    Type of Medium: Monograph available for loan
    Pages: 216 Seiten , graph. Darst.
    ISBN: 9780956297518
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...