ALBERT

Note: Ersch. unregelmäßig , Beiträge teilweise in Englisch

Note: Univ., Diss., Hohenheim, 2009

Note: Text dt. und engl.

Note: Techn. Univ., Diss. u.d.T.: Scheel, Katrin: Der Briefwechsel von Richard Dedekind mit Heinrich Weber--Braunschweig, 2015 , Frontmatter -- Grußwort Geleitwort Vorwort des Herausgebers Danksagung Editionskriterien Abkürzungsverzeichnis Inhalt: 1. Einleitung 2. Richard Dedekind 3. Heinrich Weber 4. Briefwechsel Dedekind - Weber 5. Elise Riemann 6. Verlag B. G. Teubner 7. Karl Hattendorff 8. Hermann Amandus Schwarz 9. Friedrich Wöhler A. Verlagsverträge B.G.Teubner-Verlag B. Chronologisches Dokumentenverzeichnis C. Verzeichnis der Fundstellen D. Literaturverzeichnis zum Briefwechsel E. Kurzbiographien Literatur Personenindex..

Note: In kyrill. Schr.

Note: In kyrill. Schr.

Note: Vorwort; Inhaltsverzeichnis; 1 Einführung; 1.1 Grundlegende Begriffe; 1.2 Schutzziele; 1.3 Schwachstellen, Bedrohungen, Angriffe; 1.3.1 Bedrohungen; 1.3.2 Angriffs- undAngreifer-Typen; 1.3.3 Rechtliche Rahmenbedingungen; 1.4 ComputerForensik; 1.5 Sicherheitsrichtlinie; 1.6 Sicherheitsinfrastruktur; 2 Spezielle Bedrohungen; 2.1 Einführung; 2.2 Buffer-Overflow; 2.2.1 Einführung; 2.2.2 Angriffe; 2.2.3 Gegenmaßnahmen; 2.3 Computerviren; 2.3.1 Eigenschaften; 2.3.2 Viren-Typen; 2.3.3 Gegenmaßnahmen; 2.4 Würmer; 2.5 Trojanisches Pferd; 2.5.1 Eigenschaften; 2.5.2 Gegenmaßnahmen; 2.6 Bot-Netze undSpam. , 2.6.1 Bot-Netze2.6.2 Spam; 2.7 MobilerCode; 2.7.1 Eigenschaften; 2.7.2 Sicherheitsbedrohungen; 2.7.3 Gegenmaßnahmen; 2.7.4 MobileApps; 3 Internet-(Un-)Sicherheit; 3.1 Einführung; 3.2 Internet-Protokollfamilie; 3.2.1 ISO/OSI-Referenzmodell; 3.2.2 DasTCP/IP-Referenzmodell; 3.2.3 Das Internet-Protokoll IP; 3.2.4 DasTransmissionControlProtokoll TCP; 3.2.5 DasUserDatagramProtocolUDP; 3.2.6 DHCP und NAT; 3.3 Sicherheitsprobleme; 3.3.1 Sicherheitsprobleme von IP; 3.3.2 Sicherheitsprobleme von ICMP; 3.3.3 Sicherheitsprobleme vonARP; 3.3.4 Sicherheitsprobleme vonUDPundTCP. , 3.4 Sicherheitsprobleme vonNetzdiensten3.4.1 DomainNameService (DNS); 3.4.2 NetworkFileSystem(NFS); 3.4.3 WeitereDienste; 3.5 Web-Anwendungen; 3.5.1 World Wide Web (WWW); 3.5.2 Sicherheitsprobleme; 3.5.3 OWASPTop-TenSicherheitsprobleme; 3.6 Analysetools undSystemhärtung; 4 Security Engineering; 4.1 Entwicklungsprozess; 4.1.1 AllgemeineKonstruktionsprinzipien; 4.1.2 Phasen; 4.1.3 BSI-Sicherheitsprozess; 4.2 Strukturanalyse; 4.3 Schutzbedarfsermittlung; 4.3.1 Schadensszenarien; 4.3.2 Schutzbedarf; 4.4 Bedrohungsanalyse; 4.4.1 Bedrohungsmatrix; 4.4.2 Bedrohungsbaum; 4.5 Risikoanalyse. , 4.5.1 Attributierung4.5.2 Penetrationstests; 4.6 Sicherheitsarchitektur und Betrieb; 4.6.1 Sicherheitsstrategie undSicherheitsmodell; 4.6.2 Systemarchitektur undValidierung; 4.6.3 Aufrechterhaltung im laufenden Betrieb; 4.7 Sicherheitsgrundfunktionen; 4.8 Realisierung der Grundfunktionen; 4.9 Security Development Lifecycle (SDL); 4.9.1 Die Entwicklungsphasen; 4.9.2 Bedrohungs- und Risikoanalyse; 5 Bewertungskriterien; 5.1 TCSEC-Kriterien; 5.1.1 Sicherheitsstufen; 5.1.2 Kritik am Orange Book; 5.2 IT-Kriterien; 5.2.1 Mechanismen; 5.2.2 Funktionsklassen; 5.2.3 Qualität; 5.3 ITSEC-Kriterien. , 5.3.1 Evaluationsstufen5.3.2 Qualität und Bewertung; 5.4 Common Criteria; 5.4.1 Überblick über dieCC; 5.4.2 CC-Funktionsklassen; 5.4.3 Schutzprofile; 5.4.4 Vertrauenswürdigkeitsklassen; 5.5 Zertifizierung; 6 Sicherheitsmodelle; 6.1 Modell-Klassifikation; 6.1.1 Objekte undSubjekte; 6.1.2 Zugriffsrechte; 6.1.3 Zugriffsbeschränkungen; 6.1.4 Sicherheitsstrategien; 6.2 Zugriffskontrollmodelle; 6.2.1 Zugriffsmatrix-Modell; 6.2.2 RollenbasierteModelle; 6.2.3 Chinese-Wall Modell; 6.2.4 Bell-LaPadula Modell; 6.3 Informationsflussmodelle; 6.3.1 Verbands-Modell; 6.4 Fazit undAusblick. , 7 Kryptografische Verfahren.

Note: Vorwort zur zweiten Auflage; Vorwort; Inhalt; Abkürzungen; Einführung; Teil I; Eine kurze Geschichte der Energiewende; Fukushima und Ausstieg (2011); Fundamente der Energiewende (1980 - 1998); EnWG und EEG (1998 - 2003); Emissionshandel und Energiepreise (2003 - 2008); Netzregulierung und EEG (2004 - 2008); Krise in Europa (2009 - 2012); Teil II; Die Zukunft der Energiewende; Standortbestimmung (2013); 2050: Energiewende; Fossile Primärenergien; Die Regenerativen; Energiesystem der Zukunft; Politik für die Energiewende; 1 Braunkohle und Erdgas; 2 Auslaufbetrieb der Kernenergie ; 3 Energieeffizienz ; 4 Emissionshandel ; 5 EEG Reform ; 6 Regulierung der Stromnetze ; 7 Strommarktgestaltung ; 8 Koordinierung der Energiewende ; Zusammenfassung.

Note: Berlin, Humboldt-Univ., Diss., 2011

Note: Table of Contents - Čast' 5: Geocryological monitoring network in the area of Russian Antarctic stations / A. A. Abramov, D. A. Gilichinsky. - Cryogenic sections of gas-bearing structures of West Siberia Sub-Arctic / Yu. B. Badu. - Reconstruction (3 mln years) and forecast (0,3 mln years) of global ecological parameters and methods of saving the last interglacial climate / B. L. Berry. - Geocryological conditions of the plain part of the Lama-Pyasino region / A. B. Bortsov, O. M. Lisitsyna. - Regularities of modern relief organization Yakutia coastal lowlands-remote sensing and GIS-studies / A. A. Veremeeva. - Last interglacial environments in NE Siberia / S. Wetterich, A. Andreev, F. Kienast, L. Schirrmeister, V. Kunitsky. - Prognoz of change of geocryological conditions of the basis of detailed landscape geocryological maping of the Seida key site within the limits of the project "Carbo-north" / J. Vlasova, P. Kuhry, G. G. Mazhitova, S. Marchenko, I. S. Parmuzin, F. M. Rivrin. - Geocryological classification of Arctic shelfs according to the frozen strate formation / A. V. Gavrilov. - The recent climatic changes on the evidence of ice wedges isotopic analysis / A. Yu. Dereviagin, A. B. Chizhov, H. Meyer. - Preliminary results of geocryological investigation on Hayes Island (Franz Josef Land) / D. S. Drozdov, E. A. Slagoda,A. A. Abramov, A. A. Ermak, P. T. Orekhov. - Permafrost and geothermal conditions in the Vilyui Synelcise / M. N. Zheleznyak, V. P. Semenov, V. T. Balobaev, V. G. Rusakov. - Development of a permafrost monitoring network in north eastern Asia / M. N. Zheleznyak, S. I. Serikov. - The state of permafrost in the Yakutsk Combined Heat and Power Plant area / S. I. Zabolotnik, P. S. Zabolotnik. - Geocryological conditions Swedish Lapland / N. V. lvanova, I. L. Kuznetsova, I. S. Parmuzin, F. M. Rivkin, V. A. Sorokovikov. - Closed submarine taliks in the eastern part of the Laptev Sea shelf / M. V. Kasymskaya. - Permafrost conditions of the north eastern part of the Yamal Peninsula / V. V. Kondakov, O. F. Kusova, M. V. Kondakov. - Comparison of the frontier geological, climatic and frozen Pleistocene events on the coastal lowlands of the north Yakutia / L. N. Maksimova. - Some specialties of freezing process of rocks on first stage of permafrost layer formation / L. N. Maksimova, S. Yu. Parmuzin. - Monitoring of the Mean-annual ground temperature and thawing depth on the steady-state-station Bolvansky in the Pechora delta / G. V. Malkova. - Saline the Quaternary sediment of shore of Enisey Bay / A. G. Matukhin, I. D. Streletskaya, L. E. Polaykova, M. S. Pavlov, G. E. Oblogov. - Characteristics and evolution of thermokarst lakes and alasses in Ice complex deposits of the Lena River delta / A. Morgenstern, G. Grosse, F. Günther, L. Schirrmeister. - Recent formation of Permafrost in coastal zone of Kara Sea / G. E. Oblogov, R. S. Shirokov, A. G. Matukhin, M. S. Pavlov. - Deformations of Quaternary deposits and their relationship with cryogenic processes in the Kara Sea region / O. L. Opokina, E. A. Slagoda, A. A. Vasil'ev, I. D. Streletskaya, A. A. Bagenov. - The long term dynamics of Lyakhovsky Island coastlines (on evidence of remote sensing data) / E. I. Pizhankova. - Cenozoic sequence correlation for north Yamal / E. E. Podbornyy, Yu. O. Badu. - Cryogenic sediments' structure and formation at the south border cryolithozone, the Kola Peninsula / F. A. Romanenko, E. V. Garankina. - Geothermal monitoring of cryolithozone of the north Tien Shan / E. V. Severskiy. - The ground ice of Yenisey north, International Polar Year rezults / I. D. Streletskaya, A. A. Vasiliev, E. A. Slagoda, E. A. Gusev, O. L. Opokina. - Permafrost-landscape's interactions in cryolithozone of Russia / N. V. Tumel', N. A. Koroleva. - Conditions of perennial frost mounds formation in Yakutia / A. A. Urban. - Conditions of formation of cryolithozone of western Russian Antarctic shelf and the adjacent /N. A. Shpolyanskaya. , Table of Contents - Čast' 6: Numerical modelling of non-stationary teperature fields in three-dimensional domain by programm complex Merzlota / I. B. Bakholdin. - Cryopegs formation features at Bayaratskaya Bay coast / S. N. Buldovich. - Monitoring of the ground thermal state along the railroad corridor underlain by ice-rich permafrost (Olen to Kerdem) / S. P. Varlamov, N. I. Shender, P. N. Skryabin. - Dinamics of frazil processes in Zabaykalie region / A. G. Verhoturov, E. S. Vasilovsraya. - Criogenic processes and events in high-mountain area of central Caucasus (based on winter research during 2000- 2010) / N. A. Volodicheva, M. N. lvanov, V. A. Isakov. - Development of suffosional processes in permafrost areas, Central Yakutia / L. A. Gagarin, A. A. Semernya. - Analysis of role of landscape factors in variability of the seasonal thawing (examples from the CALM program) / V. Grebenets, D. Streletskiy, D. Shmelev, N. Shiklomanov. - Cryogenic processes in valleys of the smoll rivers of the central Yamal / A. A. Gubarkov, M. V. Andreeva. - Assessment of permafrost temperature regime dynamics in the area of Marre-Sale according to the monitoring observation data / V. A. Dubrovin, L. N. Kritsuk. - Anthropogenic modification of the active-layer hydrothermal regime type in permafrost landscapes, northern Verkhoyansk / R. N. lvanova. - Regularities of the dynamics of negative air temperatures in the formation of the thermal state of ground in layer of annual heat turnover in the european north-east Russia / N. B. Kakunov, E. I. Sulimova. - The analysis of displays of climate change on processes of degradation of the long-term frozen ground / S. E. Korkin. - Investigation of termokarst lakes dynamics in central Yakutia by mutitemporal satellite images / V. I. Kravtsova, T. V. Tarasenko. - Simulation of processes heat-moisture trasfer using the method of thermal and hydraulic resistance in soils / N. B. Kutvitskaya, L. A. Duginov, M. Kh. Rozovsky, A. V. Ryazanov, M. A. Magomedgadzhieva. - Climate changes and permafrost in the Bureya River basin / P. V. Novorotsky. - The geocryological consequences of the contemporary global climate changes / A. V. Pavlov, G. V. Malkova, Yu. V. Korostelev, Yu. B. Skachkov. - Quantitative prognosis methods of permafrost responce to contemporary climate changes / A. V. Pavlov, G. Z. Perlshtein, G. S. Tipenko. - Large scale satellite image interpretation of tundra permafrost and landscape conditions and assessment of its authenticity (by the example of central part of the Yamal Peninsula) / E. Panchenko. - Assessment of landscape resistance in areas along the auto road "cp Vorkutinskaya - cp Yarynskaya" (rep. Komi, YNAO) with calculation of permafrost stability index / E. Panchenko. - New tendencies of frost heave in relation to climate change (on the example of the Nadym station) / O. E. Ponomareva, A. G. Gravis, N. M. Berdnikov. - Effect of alternating temperature on the process of frost weathering / V. Popov. - Climatic variability in Yakutia at the turn of the 20th and 21st centuries / Yu. B. Skachkov. - Post-fire dynamics of the thermal state of soils in Central Yakutia / P. N. Skryabin. - Thermal regime of seasonally frozen soils and permafrost in the Baikal-type depressions / I. E. Trofimova, A. I. Shekhovtsov. - Dynamics of cryogenic relief / A. I. Tyurin. - Monitoring of permafrost, active layer and geosystem state in the forest-tundra and southern tundra of Western Siberia / N. G. Ukraintseva, D. S. Drozdov, K. A. Popov, G. V. Matyshak, A. M. Tsarev. - The method of the forecast of variation of temperature conditions of ground, the bases of buildings and constructions in permafrost / A. A. Fedotov, P. V. Hrapov, N. I. Sidnyaev, A. V. Glasko. - Landsliding hazard assesment in typical tundra (central Yamal) / A. V. Khomutov, M. O. Leibman. - Glaciation of siberian mountains as the specific component of cryolithozone - a view from the position of Earth cryiology / V. S. Sheinkman. - Dynamics of temperature states of permafrost on north of West Siberia and Alaska under different climate forecasts / D. G. Shmelev. - Climatic change in western North America during the last 15,000 years: the role of changes in the relative strengths of air masses in producing the changing climates / S. A. Harris. , In kyrill. Schr.

Note: TABLE OF CONTENTS: Contemporary hydrographic network of the North-East of the Russian Plain: chronology of development / A. S. Lavrov, L. M. Potapenko. - Some distinctions of big and smoll interglacials (by way of example of Western Siberia during Late Pleistocene) / S. A. Laukhin, A. M. Firsov. - Pollen spectra in the lithological facies of lake bottom sediment on the White Sea Coast / N. B. Lavrova, V. V. Kolka, O. P. Korsakova. - Barsova Gora is the unical object of glacial geology and Taiga vegetation in the middle Priobie / N. B. Levina, V. A. Tkachenko, V. N. Turin, N. N. Lavrovich, E. V. Shepetova. - Geological role of ice in formation of the Arctic Ocean recent and quaternary sediments composition / M. A. Levitan, K. V. Syromyatnikov. - Granite protrusions as a relief-forming factor of the activated sections of platforms and mobile belts / M. G. Leonov, E. S. Przhiyalgovsky. - Glacial tectonics and the granulated substance mechanics / M. G. Leonov, O. G. Epshtein. - Late Pliocene-Early Pleistocene lake sediments in hollow D'Issyk-kul / O. N. Leflat, T. N. Voskresenskaya. - Complexity and diversity of genetic indication of loose formations and new things in the methods of their identification (according to the results of research of small rivers' valleys of the North of Amur-Zeya Plain, Lower Amur Region and Western Priokhotye / E. Yu. Likutov. - Landscape-geological characteristic of travertine cascade of the ancient thermal source of tract pymvashor / A. A. Ljubas, J. N. Bolotov, M. Y. Gofarov, S. A. lglovskiy. - Lake's lithogenesis: new formations are on the bottom of the drying up Udinsky Streach / L. A. Magaeva, M. T. Ustinov. - Genetic classification of peat deposits based on trophicity degree / G. L. Makarenko. - On the issue of classification of mires based on trophicity degree / G. L. Makarenko. - Some burning issues of a structural interpretation of the plain areas relief / V. I. Makarov, N. V. Makarova, T. V. Sukhanova. - The first experience of the 230Th/U dating of buried wood remains / R. E. Maksimov, V. Yu. Kuznetsov, S. A. Laukhin, I. E. Zherebtsov, S. B. Levchenko, N. G. Baranova. - Variations of the relative intensity of geomagnetic field in bottom sediments of the Bering Sea and North-Western Pacific during the last 380 kyr / M. I. Malakhov, S. A. Gorbarenko, D. Nurnberg, R. Tiedemann, G. Yu. Malakhova, J. Riethdorf. - Using high-resolution records petromagnetic and lithophysic characteristics of the sediments Bering Sea and high-latitude Western Pacific for reconstruction of climate and environment in the Late Pleistocene-Holocene / M. I. Malakhov, S. A. Gorbarenko, D. Nurnberg, R. Tiedemann, G. Yu. Malakhova, J. Riethdorf. - Some information about genetic classification of lakes of the Vepsovsky Hill East of the Leningrad Region / O. V. Malozemova, L. A. Nesterova, D. A. Subetto. - Middle Pleistocene small mammal faunas of Eastern and Central Europe: Chronology, correlation / A. K. Markova, T. van Kolfschoten. - Astronomical and meteorological criteria of defining human activity traces in ancient megalith rock complexes in the North-West Russia / L. S. Marsadolov, G. N. Paranina. - Palynological characteristics of the middle Pleistocene deposits in the Vychegda River Basin, the Komi Republic (preliminary data) / T. I. Marchenko-Vagapova. - Isotope specialization (δ18O, δ13C) of quaternary carbonates from Belarus and potential of palaeoenvironments indication / N. A. Makhnach. - The complex survey of quaternary deposits / A. V. Mashukov, A. E. Mashukova. - Quaternary deposits and construction materials' deposits in the Kaluga Region / S. G. Medvedeva. - Vegetation and climate of Sakhalin in the early Holocene / Yu. A. Mikishin, L. G. Gvozdeva. - Inorganic geochemistry record of stages 6-11 from Elgygytgyn lake sediments (deep drilling data) / P. S. Minyuk, V. Ya. Borkhodoev and Elgygytgyn Scientific Party. - Palaeoshorelines on the Murmansk coast / M. V. Mityaev. - Vertical matter flow in Gulfs on Murmansk and Karelian coasts / M. V. Mityaev, M. V. Gerasimova. - Channel and basin components of sediment yield in the formation of quaternary alluvial suites of rivers of the middle Volga Region / V. V. Mozzherin. - Late Pleistocene interglacial-glacial climatic transition (MIS 5/MIS 4) as derived from palynological analysis and IR-OSL dating of deposits from the Voka Reference Section, Southeastern coast of the Gulf of Finland / A. N. Molodkov, N. S. Bolikhovskaya. - Quaternary sediments in the Central Part of Northern West Siberia / D. V. Nazarov. - Palynological evidences of the postglacial warm event of the Laptev Sea Region / O. D. Naidina. - Some problems of using luminescent methods for absolute dating of glacial deposits (by the example of Chagan Section, SE Altai) / R. K. Nepop, A. R. Agatova, H. Rodnight. - Freshwater travertine-like carbonates of the Izhora Plateau as the natural markers of the structural dislocations / M. U. Nikitin, A. A. Medvedeva. - Fold deformations in late Pleistocene deposits of the Central Part Kola Region and their genesis / S. B. Nikolaeva. - Mammoths and man of stone age in Northern Europe - insight of a question on migrations to European Subarctic by Western paths / A. A. Nikonov. - Formation of present-day deposits in the conditions of technogenic litogenesis / E. N. Ogorodnikova, S. K. Nikolaeva. - Traces cryogenesis of Neopleistocene sediments the lower Irtysh / O. L. Opokina, E. A. Slagoda. - Stratigraphical subdivision of the Eopleistocene deposits of the Simbugino Site and new mollusc finds (Southern Foreurals) / E. M. Osipova, G. A. Danukalova. - Late Pleistocene to Holocene environment and climate in the Upper Ponoy Depression (Kola Peninsula) reconstracted from pollen record of Churozero lake bottom deposits / E. Yu. Pavlova, M. V. Dorozhkina, E. I. Devyatova. - Absolute chronology and climatic conditions of Valdai (Vistulian) terraces formation in the middle Seim River Valley / A. Panin, J.-P. Buylaert, E. Matlakhova, A. Murray, O. Pakholova. - Possibility of reconstruction of climate change in the Mongolian Altai based on analysis of annual records in glaciers and lacustrine sediment / T. S. Papma, E. Yu. Mitrofanova, N. S. Malygina. - Northern labyrinth - thee Gnomon: compass, clock, calendar / G. N. Paranina. - Late Pleistocene and Holocene paleogeography of the coastal lowlands of Is. Paramushir (Kuril Islands) / A. Ju. Pakhomov. - Upper-Kama (Verhnekama) Upland - the newest lifting of the middle Last Pleistocene / M. M. Pakhomov, I. L. Borodatyi. - Dating mass accumulations of Mammoth across Arctic Eurasia / V. V. Pitulko, P. A. Nikolskiy, A. E. Basilyan, E. Y. Pavlova. - Features of vertical distribution of the materials within the marginal zones of permafrost polygonal structures and its importance for dating of quaternary deposits in cryolitozone / V. V. Pitulko, E. Y. Pavlova, A. E. Basilyan, S. G. Kritsuk. - Morfogenesis of the tectonics active area of the Mongolian Altay / S. G. Platonova. - Reference section of the Lichvin interglacial in the North-Western Part of European Russia's Region / E. S. Pleshivtseva, V. L. Garkusha, M. A. Travina. - New radiocarbon dates of Late Quaternary Mammals in the Arkhangelsk Region in connection with reconstructions of the last glaciation in the Eastern Europe / D. V. Ponomarev, T. van Kolfschoten, A. K. Markova, J. van der Plicht. - Geological illustrations of Aral-Caspian Region's latest seismodynamic high activity / V. I. Popkov. - About Karagiinsk closed depression (Mangishlak)'s genesis / V. I. Popkov. - On the issue of formation of the Caucasian mineral waters' modern structural geomorphologic aspect / V. I. Popkov, I. G. Sazonov, D. A. Kolleganova. - Natural climate changes on the border of Late Pleistocene and Holocene / A. N. Popova, D. A. Subetto. - Some problems paleogeomorfologi Volga Region / I. V. Proletkin. - New perspectives on modern geomorphological studies / I. V. Proletkin. - Dynamics of small mammals local assem , In kyrill. Schr. , In engl. und rus. Sprache

Note: In kyrill. Schr., russ.

Note: Zugleich: Dissertation, Christian-Albrechts-Universität zu Kiel, 1999 , INHALTSVERZEICHNIS 1. Einleitung 1.1 Kenntnisstand und offene Fragen 1.2 Fragestellung und Ziele dieser Arbeit 2. Umweltbedingungen in den Arbeitsgebieten 2.1 Hydrographie, Eisverhältnisse und NAO 2.2 Zur Variation von Wassertiefe und Breite der Dänemarkstraße und zur Vereisung Islands während des letzten Glazials 3. Methoden 3.1 Auswahl der Kernstationen 3.2 Probennahme und Analysen (Übersicht) 3.3 Zur Rekonstruktion von Paläobedingungen im Oberflächenwasser Zur Aussage stabiler Isotopenverhältnisse in planktischen Foraminiferen Zur Messung stabiler Isotopenverhältnisse Zur Massenspektrometrie Zur Rekonstruktion von Oberflächentemperaturen Alkane und Alkohole als Maß für Staubeintrag Eistranspmtiertes Material und vulkanische Aschen 3.4 Zur Rekonstruktion von Paläobedingungen im Zwischen-/ Tiefenwasser Häufigkeit von Cibicides- und anderen benthischen Arten (inkl. Taxonomie) Stabile Isotopenverhältnisse in benthischen Foraminiferen 3.5 AMS 14C-Datierungen Probenreinigung 3. 6 Hauptelementanalysen von vulkanischen Asche-Leithorizonten 3. 7 Geomagnetische Meßgrößen und magnetische Suszeptibiltät 3.8 Techniken zur Spektralanalyse 4. Methodische Ergebnisse 4.1 Zum Einfluß der Probenreinigung auf δ18O-/ δ13C-Werte 4.2 Probleme bei der langfristigen Reproduzierbarkeit von δ18O-Zeitreihen 4.3 Einfluß der Korngröße und Artendefinition planktischer Foraminiferen auf SST-Rekonstruktionen in hohen Breiten 4.4 Vergleich der stabilen Isotopenwerte von Cibicides lobatulus und Cibicidoides wuellerstorfi 5. Stratigraphische Grundlagen und Tiefenprofile der Klimasignale 5.1 Stratigraphische Korrelation zwischen parallel-gekernten GKG- und SL-/KL-Profilen 5.2 Flanktische δ18O-/ δ13C-Kurven, 14C-Alter und biostratigraphische Fixpunkte Westliches Islandbecken Kern PS2644 Kern PS2646 Kern PS2647 Kern 23351 Vøring-Plateau Kern 23071 Kern 23074 5.3 Benthische δ18O-/ δ13C-Werte in Kern PS2644 5.4 Siliziklastische Sedimentkomponenten: Eistransportiertes Material Westliches Islandbecken Kern PS2644 Kern PS2646 Kern PS2647 Vøring-Plateau Kern 23071 Kern 23074 5.5 Vulkanische Glasscherben in Kern PS2644: Wind- und Eiseintrag 5.6 Geochemie und Alter einzelner Tephralagen als Leithorizonte Westliches Islandbecken Kern PS2644 Kern PS2646 Kern PS2647 Vøring-Plateau Kern 23071 Kern 23074 5.7 Magnetische Suszeptibilität in den Kernen PS2644, PS2646 und PS2647 Kern PS2644 Kern PS2646 und PS2647 5.8 Geomagnetische Feldintensität und Richtungsänderungen in Kern PS2644 5.9 Variation von Planktonfauna und -flora Westliches Islandbecken: Kern PS2644 Kern PS2646 und PS2647 Vøring-Plateau: Kern 23071 und 23074 5.10 Benthische Foraminiferen in Kern PS2644 6. Entwicklung von Temperatur und Salzgehalt nördlich der Dänemark-Straße 6.1 Variation der Oberflächentemperatur nach Planktonforaminiferen 6.2 Variation der Oberflächentemperatur nach Uk37 6.3 Variation der Oberflächensalinität 7. Die Feinstratigraphie von Kern PS2644 als Basis für eine Eichung der 14C-Altersskala 22 - 55 ka 7.1 Korrelation zwischen den Klimasignalen in Kern PS2644 und der GISP2-Klimakurve zum Kalibrieren der 14C-Alter und Erstellen eines Altersmodells Tephrachronologische Marker Korrelationsparameter und -regeln Sonderfälle/ Probleme bei der Korrelation 7.2 Alters-stratigraphische Korrelation der Klimakurven von Kern 23071 und 23074 7.3 Variation der Altersanomalien zwischen 20 und 55 14C-ka 7.4 Variabilität des planktischen 14C-Reservoiralters in Schmelzwasserbeeinflußten Seegebieten Variation der planktischen 14C-Alter unmittelbar an der Basis von Heinrich-Ereignis 4 Unterschiede zwischen planktischen und benthischen 14C-Altern in der westlichen Islandsee. Zur Erklärung der inversen Altersdifferenzen 7.5 Differenz zwischen 14C- und Kalenderalter: Zeitliche Variation unter Einfluß des Erdmagnetfeldes - Modell und Befund 7.6 Sedimentationsraten der Kerne 23071, 23074 und PS2644 nach dem GISP2-Altersmodell Vøring-Plateau: Kerne 23071 und 23074 Südwest-Islandsee: Kern PS2644 8. Klimaoszillationen im Europäischen Nordmeer in der Zeit und Frequenzdomäne 8.1 "Der Einzelzyklus" in den Klimakurven von Kern PS2644 8.2 Zur Veränderlichkeit der Warm- und Kaltextreme sowie Zyklenlänge Besonderheiten in der Zyklenlänge Variation der Kalt-(Stadiale) Variation der Interstadiale 8.3 Periodizitäten der Klimasignale im Frequenzband der D.-Oe.-Zyklen. Der D.-Oe.-Zyklus von 1470 J., seine Multiplen und harmonischen Schwingungen Weitere Frequenzen: 1000-1150 Jahre- und 490- 510 Jahre-Zyklizitäten Höhere Frequenzen im Bereich von Jahrhunderten und Dekaden 8.4 Phasenbeziehungen und (örtliche) Steuemngsmechanismen der Dansgaard-Oeschger-Zyklen 9. Schlußfolgerungen Danksagung Literaturverzeichnis Anhang

Note: Inhaltsverzeichnis: Vorwort. - 1. Gletscherrückgang – eine dramatische Folgereaktion des Klimawandels in den Alpen. - 2. Methoden der Gletscherforschung. - 3. Einflussfaktoren auf die Entwicklung von Gletschern in den Alpen. - 4. Bedeutung der Alpengletscher im Wasserkreislauf. - 5. Gletscher in Bayern heute – eine Bestandsaufnahme. - Nördlicher Schneeferner. - Südlicher Schneeferner. - Höllentalferner. - Watzmanngletscher. - Blaueis. - 6. Entwicklung der Gletscher in Bayern. - Historische Aufzeichnungen seit dem 18. Jahrhundert. - Systematische Erfassung der bayerischen Gletscher ab 1950. - Ausblick in die Zukunft der bayerischen Gletscher. - 7. Ein Blick nach Europa: Haben die Gletscher der Alpen eine Zukunft?. - Alpengletscher im Überblick. - Schweizer Alpengletscher. - Österreichische Alpengletscher. - Zusammenfassung. - Glossar. - Fachliteratur und Quellen. - Allgemeine Literatur zum Thema Gletscher. - Internetquellen. - Impressum.

Note: Contents: 1 Einführung ; 2 Einige spieltheoretische Grundlagen der Analyse ; 3 Theorie externer Effekte ; 4 Auflagen ; 5 Steuern und Abgaben (Preislösungen) ; 6 Zertifikate ; 7 Verhandlungslösungen ; 8 Umwelthaftung ; 9 Umwelttechnischer Fortschritt (dynamische Anreizwirkungen) ; 10 Internationale Aspekte des Umweltproblems ; 11 Umweltpolitik bei asymmetrischer Informationsverteilung ; 12 Kosten-Nutzen-Analyse ; 13 Ressourcenökonomie

Note: 1. Experiment, Scheitern und Resilienz 2. Georg Simmel und die Beobachtung der Natur 3. Objektive Kultur und die Entwicklung des Nichtwissens 4. Kollektive Experimente in Natur und Gesellschaft 5. Unberechenbare Umwelt 6. Landschaftsdesign als experimenteller Lehrpfad: die Entwicklung postindustrieller Regionen 7. Vor der Hacke bleibt es duster: experimentelles Nichtwissen und die Sanierung kontaminierter Landschaften 8. Reise zur Hitze der Erde: Geothermie und nachhaltige Energiegewinnung Zu viel Resilienz Hindernisse auf dem Weg in die experimentelle Gesellschaft Literatur NachweiseBackmatter..

Note: Zugleich: Dissertation, Freie Unversität Berlin, [ca. 1963] , INHALTSVERZEICHNIS PROBLEMSTELLUNG UND ZIELSETZUNG 1. BEMERKUNGEN ZUM BEOBACHTUNGSGELÄNDE UND ZUM BEOBACHTUNGSMATERIAL 1.1 Das Beobachtungsgelände 1.2 Das Beobachtungsmaterial 2. HOMOGENITÄTSBETRACHTUNGEN 2.1 Temperatur 2.2 Niederschlag 2.3 Wind 2.4 Sonnenschein und Bewölkung 3. TEMPERATURVERHÄLTNISSE 3.1 Monats- und Jahreswerte 3.2 Tageswerte 3.3 Pentadenwerte 3.4 Häufigkeitsbetrachtungen 3.5 Interdiurne Veränderlichkeit 3.6 Der tägliche Gang 3.7 Vorkommen bestimmter Schwellenwerte 3.71 Frost- und Eistage 3.72 Sommer- und Tropentage 4. DER WASSERGEHALT DER LUFT 4.1 Monats- und Jahreswerte 4.2 Tageswerte 4.3 Häufigkeitsbetrachtungen 4.4 Interdiurne Veränderlichkeit 4.5 Der tägliche Gang 5. BEWÖLKUNGSVERHÄLTNISSE 5.1 Monats- und Jahreswerte 5.2 Tageswerte 5.3 Häufigkeitsbetrachtungen 5.4 Der tägliche Gang 5.5 Heitere und trübe Tage 5.6 Nebel 6. SONNENSCHEIN 6.1 Monats- und Jahreswerte 6.2 Tageswerte 6.3 Der tägliche Gang 7. NIEDERSCHLAGSVERHÄLTNISSE 7.1 Monats- und Jahreswerte 7.2 Niederschlagsbereitschaft 7.3 Tageswerte 7.4 Der tägliche Gang 7.5 Häufigkeitsbetrachtungen 7.6 Niederschlags- und Trockenperioden 7.7 Niederschlag und Wind· 7.8 Schneeverhältnisse 7.81 Schneefall und Schneedecke 7.82 Schneehöhe 7.9 Gewitter 8. WINDVERHÄLTNISSE 8.1 Windrichtung 8.2 Windgeschwindigkeit 8.21 Der jährliche Gang 8.22 Häufigkeitsbetrachtungen 8.23 Sturmtage und Windstillen 8.24 Der tägliche Gang 9.ZUSAMMENFASSUNG VERZEICHNIS DER TEXTTABELLEN VERZEICHNIS DER ABBILDUNGEN LITERATURVERZEICHNIS TABELLENANHANG

Note: Text dt. und engl. - Text in Faltbl. [1] dt.

Note: Contents: I. Grundlagen des Modell-Platonismus ; 1. Einleitung ; 2. Hans Alberts Modell-Platonismus-Vorwurf ; 3. Zur logischen Struktur neoklassischer Theorie ; 4. Das Marktmodell vollkommener Konkurrenz ; 5. Varianten der Charakterisierung neoklassischer Ökonomie ; II. Erweiterungen des Modell-Platonismus ; 6. Realitätsbezug und Informationsgehalt: Zur Grenzenlosigkeit neoklassischer Ökonomie ; 7. Axiomatische Variationen: Zur Flexibilität neoklassischer Theorie ; 8. Institutionelle Aspekte: Die Ökonomie als soziales Feld ; 9. Empirie und Evidenz: Zur Rolle von Ökonometrie und Experiment ; 10. Abschließende Bemerkungen

Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.

Note: Table of Contents - Čast' 1.: Research by the pulsing method of a NRM of the metastable water formed at dissociation freonhydrate-12 in the field of negative temperatures / V. A. Vlasov, A. G. Zavodovsky, M. S. Madygulov, A. N. Nesterov, A. M. Reshetnikov. - Kinetics crystallization subcooling of the water contacting to surface gas hydrate / V. A. Vlasov, A. G. Zavodovsky, M. S. Madygulov, A. N. Nesterov, A. M. Reshetnikov. - Transformation of cryogenic structure of frozen clay soils at plain stamp test / S. S. Volokhov. - About influence of contact zone structure of frozen soils with materials on adfreezing strength / S. S. Volokhov, N. V. Solovyeva. - Possibilities of calculating the effective diffusion coefficient of water vapour in snow due to field observations data / R. I. Gavriliev. - Features of water's crystallization in dispersed rocks / V. N. Golubev, G. A. Rzhanitsyn. - Mass exchange in the system of atmosphere-snow cover-ground / V. N. Golubev, D. M. Frolov. - Physical and mechanical aspects of phase transition processes in frozen and freezing ground / J. B. Gorelik. - The experimental stadies of cryogenic preassure into water-saturated saline soils / S. E. Grechishchev, A. V. Brousehkov, Ark. V. Pavlov, O. V. Grechisheheva. - Phase composition of frozen saline ground with petroleum pollution / E. S. Grechishcheva, R. G. Motenko. - About plastic deformation of frozen rocks / M. M. Iudin. - Studies of Soil Moisture Transfer and ice extraction in clay loam Patterns Under External Pressure / O. A. Kazansky. - Isotopic content of interfacial water and ice frozen ground / V. N. Konischev, V. V. Rogov, V. N. Golubev, S. A. Sokratov. - On longevity and structured physical system organizations (on example of frozen soils and ice) / A. A. Konovalov. - On toughness and deforming the frozen ground / A. A. Konovalov. - The study of deformation characteristics of thawing soils / P. I. Kotov. - Thermal properties of volcanic ashes (Kamchatka) / E. P. Kuznetsova, R. G. Motenko. - About temperature extension coeffision of frozen soils / V. P. Merzlyakov. - Classification indicators of frost-susceptible soils / A. L. Nevzorov. - Separation of the pore solution compounds during mass transfer in disperse ice / V. Ye. Ostroumov, N. V. Ostroumova. - Achievements and problems of frozen soils mechanics / L. T. Roman. - Classification of frozen soils / L. T. Roman, V. I. Aksenov, A. V. Iospa. - Modification of frozen soils and ice by adding polyvinyl alcohol in order to facilitate construction / E. V. Safronov, V. V. Vialdin, V. G. Cheverev, V. E. Gagarin, D. V. Hvostikov. - Method of mass crystallization calculation for multiphased rheological mediums / N. I. Sidnyaev, D. A. Krylov. - The deflected mode of the freezing soils layer taking into account the creep and compliance of the boundary conditions / Z. G. Ter-Martirosyan, P. A. Gorbachev. - Study of deformation characteristics of thawing soils of Vankor oilfield / M. N. Tsarapov. - Influence of outer loading on frost heaving of freezing soils, according to theoretical and experimental researches / V. G. Cheverev, M. A. Minkin, E. V. Safronov, V. E. Gagarin, R. S. Bumaev. , Table of Contents - Čast' 2.: Investigation of glaciers and fumarolic activity of Mt Elbrus / V. A. Alekseev, N. G. Alekseeva, M. G. Daniyalov, P. A. Morozov, C. M. Pershin, P. V. Hlebopashev. - The study of impact craters near the Tunguska meteorite epicenter / V. A. Alekseev, V. V. Kopeykin, N. G. Alekseeva, V. V. Krivulin, L. G. Pelehan', V. A. Rukavishnikov, V. A. Chechin. - Engineering geophysical investigations to substantiate the investments for Nizhne-Timptonsk HPP construction / O. K. Voronkov, N. N. Sigatcheva, O. A. Semenov, Yu. Yu. Punin. - Essentials of technique for seismic hazard zoning of extended linear structures in cryolithic zone / V. I. Dzhurik, S. P. Serebrennikov, L. A. Usynin, E. V. Bryzhak. - Temperature dependence of seasonal changes of electrical resistance of frozen ground / V. N. Efremov. - Role and place geophysical methods at studying criolitozone / Y. D. Zykov, A. V. Koshurnikov, N. V. Paramonov, A. A. Pogorelov, R. D. Ostrovsky, A. Y. Gunar. - EM sounding technology's capability in long-term engineering-geological studies in transition zones (case study: transition of a pipeline Bovanenkovo-Ukhta through Baidaratskaya Bay) / Y. D. Zykov, Y. V. Kuleshov, S. V. Kulakov, A. V. Koshurnikov, E. I. Gorshkov, A. A. Pogorelov, E. M. Sizykh. - Experience using of aerospace infrared thermal data for characteristics of the permafrost / S. G. Kornienko. - Wave characteristics of permafrost in Western Yakutia / L. G. Neradovsky. - Geological-geophysical analysis of seismic events in the cryolithic zone of Mongolia / S. P. Serebrennikov, Ts. Batsaikhan, V. I. Dzhurik, A. Yu. Eskin, A. F. Drennov. - Seismic geocryological study of shallow waters in permafrost / A. G. Skvortsov, M. R. Sadurtdinov, A. M. Tsarev. - Features of seismic methods in engineering geocryological studies / A. G. Skvortsov, A. M. Tsarev, M. R. Sadurtdinov. - Descriptiveness of geophysical methods in the assessment of oil pollution / A. D. Skobelev, Y. D. Zykov, A. V. Koshurnikov, A. A. Pogorelov, P. D. Ostrovsky, A. Y. Gunnar. - Radiolocation of the upper frozen ground in Anadyr city: structure, interpretation, forecast / O. D. Tregubov. - Estimating of rock state and properties in long-tem physical weathering by an ultrasonic method / L. F. Ushakova, O. K. Voronkov. - The efficiency of geophysical methods in studies of cryolithic zone in the process of placer accumulation by dredge acquisition / I. M. Khasanov, N. L. Alevskaya, A. V. Koshumikov. - Impact assessment of cryolithic zone in geophysical explorations of gold minefields on a prospecting step, that arc disposed in background medium, consisted of finest sedimentary rock / I. M. Khasanov, V. M. Sharaphytdinov, A. V. Koshurnikov. - Engineering-geocryological research in offshore area of Kruzenshternsky field in Kara sea / V. A. Kholodilov, M. L. Tsemkalo, M. F. Savitskiy, N. V. Paramonov, A. V. Koshumikov, A. A. Pogorelov. - Using electrical resistivity tomography to investigate near-shore permafrost dynamics / P. Overduin, M. Grigoriev, T. Haberlau, S. Wetterich, S. Westermann, K. Yoshikawa. , Table of Contents - Čast' 3.: Cryogenic and seismogenic deormations in the Late Cenozoic deposits of Tunkinskaya depression in Baikal rift zone / S. V. Alexeev, L. P. Alexeeva, A. C. Gladkov, O. V. Lunina, A. M. Kononov, A. V. Andreev. - Coastal Permafrost evolution of Western Yamal in context of climate change / A. A. Vasiliev, I. D. Streletskaya, R. S. Shirokov, G. E. Oblogov. - Classification of massive ice /Yu. K. Vasil'chuk. - δ18O variation of Late Holocene ice-wedge of Aventdalen, Svalbard / Yu. K. Vasil'chuk, N. A. Budantseva, A. M. Zemskova. - Pollen spectra of massive ice of Yerkutayakha River valley, Southern Yamal Peninsula / A. C. Vasil'chuk, Yu. K. Vasi l'chuk, N. A. Budantscva. - Complex assessment of crioecolological and bioresource state of northern geosystems / L. I. Zotova, S. J. Dedjusova. - Study of Quaternary sediments and ground ice with detailed grane-size composition analysis at Yenisey North / M. S. Pavlov, I. D. Streletskaya, A. G. Matyukhin, G. E. Oblogov, A. V. Surkov. - On rock weathering in Cryolithozone / D. M. Shesternev. - Fossil organic matter in permafrost deposits of northern East Siberia - contents and characteristics / L. Schirrmeister, S. Wetterich, G. Grosse, J. Strauss, C. Siegert, P. P. Overduin, H.-W. Hubberten. , Table of Contents - Čast' 4.: The influence of reservoir parameters on hydrate formation in gas wells in permafrost / E. A. Bondarev, K. K. Argunova, I. I. Rozhin. - Research features of deposits wells with abnormal low field temperature / Z. A. Vasil'eva, D. S. Djafarov. - Technogenic indicators of natural gas hydrates presence in deposits of the western part of the Siberian Platform and Yenisei-Khatanga Depression / Z. A. Vasil'eva, D. S. Dzhafarov. - The commercially viable unconventional gas sources (gas hydrates, coalbed methane and shale gas) - experience of development and prospects in Russia / E. V. Perlova. - Gas hydrate of Yamal region (Yamal Peninsular, Kara Sea's shelf) - occurance, types, resources, technogenic challenges / E. V. Perlova, S. A. Leonov, E. S. Miklyaeva, S. D. Perlov. - Variation of thermal conductivity in gas-saturated sediments during hydrate accumulation and freezing / E. M. Chuvilin, B. A. Buhanov. - Sources of natural gas in cryolithozone of Yamal Pemnsula / V. S. Yakushev. , In kyrill. Schr.

Note: Text dt. und engl.

Note: Text dt. und engl.

Note: Zugl.: Hamburg, Univ., FB Rechtswiss., Diss., 2011

Note: Beitr. teilw. dt., teilw. engl.

Note: Zugl.: München, Univ., Diss., 2011

Note: Ungezählte Beil. ab 2010: Special , Ersch. jährl. 4x

Note: Inhalt Vorwort Einleitung: Unser Klima aus der Polarperspektive Verbessertes Verständnis arktischer Klimaänderungen durch Messungen und Modellierung Physikalische Prozesse in der polaren Atmosphäre Langzeit-Messreihen zeigen: Ozonschicht über der Antarktis konnte sich noch nicht erholen Arktischer Meereisrückgang verursacht Anomalien in Ozean und Atmosphäre HAFOS erfasst längerfristige Veränderungen im Ozean Meereisspiegel im Nordatlantik in nur 15 Jahren um 6 cm gestiegen Eis im Klimawandel Erderwärmung gefährdet die Permafrost-regionen und damit das globale Klimasystem Marine Klimaarchive – Aus der Vergangenheit lernen, um den Blick in die Zukunft zu schärfen Paläoklimamodelle: Zurück in die Zukunft Marines Plankton beeinflusst das globale Klima Die regionalen Auswirkungen des Klimawandels rücken in den Blickpunkt Das World Radiation Monitoring Center am AWI: weltweite Datenzentrale der Erdsystemforschung Klimaberatung: regionalspezifisch, verständlich, solide – das Helmholtz-Klimabüro am AWI Die stationären und mobilen Infrastrukturen des Alfred-Wegener-Instituts in Arktis und Antarktis Ansprechpartner im AWI, Impressum

Note: Beitr. teilw. in dt., teilw. in engl. Sprache