ALBERT

Note: Ersch. unregelmäßig , Beiträge teilweise in Englisch

Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.

Note: Zugl.: Marburg, Univ., Diss.

Note: Introduction.EU energy law and the approach taken in this studyThe regulatory history of EU energy : the evolution of EU energy law from 1957 onwardsThe evolution of the sector-specific regulatory frameworkTreaty law and the energy sectorEnvironment and energy : on a bumpy road towards a clean energy futureThe international dimension of EU energy law and policyFrom state to market and back : the changing role(s) of markets and states in the EUConclusion.European energy law under the impact of globalization : from state to market, from plan to contract, from public ownership to economic regulation and beyond..

Note: A stratigraphic concept for Middle Pleistocene Quaternary sequences in Upper Austria --- Magnetic excursions recorded in the Middle to Upper Pleistocene loess/palaeosol sequence Wels-Aschet (Austria) --- Paleopedological record along the loess-paleosol sequence in Oberlaab, Austria --- Grain size and mineralogical indicators of weathering in the Oberlaab loess-paleosol sequence, Upper Austria --- Last Interglacial paleosols with Argic horizons in Upper Austria and Central Russia --- Paudorf locus typicus (Lower Austria) revisited

Note: Ernie Rutter has made, and continues to make, a significant impact in the field of rock deformation. He has studied brittle and plastic deformation processes that occur within both the oceanic and continental crust, as well as other key properties such as the permeability and seismic velocities of these rocks. His approach has been one that integrates field observations, laboratory experiments and theoretical analyses. This volume celebrates Ernie's key contribution to rock deformation and structural geology by bringing together a collection of papers that represent this broad approach. The papers within the volume address key issues that remain within these fields. These range from fundamental studies of brittle and plastic behaviour along with the resultant structures and microstructures from both the field and laboratory, to applied problems where a better understanding of the deformation and properties of the crust is still needed.

Note: Contents: Linear Control Systems ; The Dynamic Programming Approach ; Ellipsoidal Techniques: Reachability and Control Synthesis ; Solution Examples on Ellipsoidal Methods: Computation in High Dimensions ; The Comparison Principle: Nonlinearity and Nonconvexity ; Impulse Controls and Double Constraints ; Dynamics and Control Under State Constraints ; Trajectory Tubes State-Constrained Feedback Control ; Guaranteed State Estimation ; Uncertain Systems: Output Feedback Control ; Verification: Hybrid Systems

Note: Erschienen: 1 - 2

Note: Beitr. teilw. in engl., teilw. in dt. Sprache

Note: Introduction; Benno WerlenPreface: Speech at TIERS Conference in Jena on 8 June 2012; Matthias Machnig -- PART I: INTEGRATED TRANSDISCIPLINARY RESEARCH -- Chapter 1: Sustainability and Territory: An Approach from the Perspective of the Imaginary in Shaping Development; Enrique Aliste -- Chapter 2: Challenges for Transdisciplinary Research; Joske Bunders -- Chapter 3: Narratives for a Sustainable Future. Vision and Motivation for Collective Action; Ilan Chabay -- PART II: KNOWLEDGE -- Chapter 4: Carving a Niche for the Social Sciences in Trans-disciplinary Research on Climate Change Adaptation and Agriculture in Southern Africa; Chipo Plaxedes Mubaya -- Chapter 5: From Co-Production of Knowledge to Transdisciplinary Research. Lessons from the Quest for Producing Socially Robust Knowledge; Juergen Weichselgartner and Bernhard Truffer -- PART III: INTERFACES SOCIETY NATURE -- Chapter 6: Terrestrial Ecosystems Dynamic in the Senegalese Agro-silvopastoral Center-east in the Second Half of the XXe Century; Aliou Dijouf and Matthew G. Hatvany -- Chapter 7: Integrated Global Change Research in West Africa: Flood Vulnerability Studies; Ibidun Adelekan -- Chapter 8: Integrated Approach in Environment Management: Context Bangladesh; Raquib Ahmed -- Chapter 9: Awareness of and Responses to the 2011 Flood Warnings among Vulnerable Communities in Lagos, Nigeria; Olokesusi, F., Olorunfemi, F.B., Onwuemele A. and Oke, M.O -- PART IV: INTERFACES SCIENCE POLICY -- Chapter 10: Solution-Based Spatial Planning for Disaster Risk Reduction and Adaptation to Climate Change in Taiwan; Yu-Fang Lin -- Chapter 11: Institutions and Planning: A Reflection from the Disaster Management Planning in Indonesia; Hendricus A Simarmata and Raka W Suryandaru -- Chapter 12: Could the Search for Sustainability Reinforce the Socio-ecological Conflict? The Mining Industry in Chile and its Impact at the Local and Regional Level; Fernando Campos-Medina -- Chapter 13: Institutions and Planning: A Reflection from Disaster Management Planning in Indonesia; Hendricus A. Simarmata and Raka W. Suryandaru -- Chapter 14: Could the Search for Sustainability Reinforce the Socio-ecological Conflict? The Mining Industry in Chile and its Impact at the Local and Regional Level; Fernando Campos-Medina -- Chapter 15: Political decision-making and Scientific Insights. A comment form the Political Arena; Matthias Machnig..

Note: Contents: Preface. - Acknowledgements. - 1. The boy: Berlin and Brandenburg, 1880-1899. - 2. The student: Berlin - Heidelberg - Innsbruck - Berlin, 1899-1901. - 3. The astronomer: Berlin, 1901-1904. - 4. The aerologist: Lindenberg, 1905-1906. - 5. The polar meteorologist: Greenland, 1906. - 6. The Arctic explorer (1): Greenland, 1907-1908. - 7. The atmospheric physicist (1): Berlin und Marburg, 1908-1910. - 8. The atmospheric physicist (2): Marburg, 1910. - 9. At a crossroads: Marburg, 1911. - 10. The theorist of continental drift (1): Marburg, December 1911 - February 1912. - 11. The theorist of continental drift (2): Marburg, February - April 1912. - 12. The Arctic explorer (2): Greenland, 1912-1913. - 13. The soldier: Marburg and "The Field", 1913-1915. - 14. The meteorologist: "In the field", 1916-1918. - 15. The geophysicist: Hamburg, 1919-1920. - 16. From geophysicist to climatologist: Hamburg, 1920-1922. - 17. The paleoclimatologist: Hamburg, 1922-1924. - 18. The professor: Graz, 1924-1928. - 19. Theorist and Arctic explorer: Graz and Greenland, 1928-1929. - 20. The expedition leader: Graz and Greenland, 1929-1930. - Epilogue. - Notes. - Bibliographical essay. - Index.

Note: Beiträge teilweise in deutscher, teilweise in englischer Sprache

Note: 1. Abschied und Wiederkehr ; Erster Grad: Die Haut 2. Wachstumsstörungen ; 3. Der beschränkte Planet ; 4. Entdeckungsreise zum Klimawandel , 5. Klimapalaver ; 6. Der Faktor Mensch ; 7. Stühlerücken auf der »Titanic« ; 8. Warum eigentlich Klimaschutz? ; 9. Mohamed ohne Land ; 10. Einstein, Gödel, Drake ; Zweiter Grad: Das Fleisch ; 11. Gottes Element ; 12. Zwei Große Transformationen ; 13. Klima als Geschichtsmacht ; 14. Ultrakurzgeschichte der Um-Welt ; 15. Vom Wetter zum Klima ; 16. Ins Feuer? ; 17. Merkel auf dem Philosophenweg ; 18. Klimafolgen: Leib und Leben ; 19. Klimafolgen: Brot und Spiele ; 20. Zwei Grad Celsius ; 21. Kippelemente im Erdgetriebe ; Dritter Grad: Das Mark ; 22. Blendet die Seher! ; 23. Betäubt die Hörer! ; 24. Die Diktatur des Jetzt ; 25. Falsche Ausfahrt: Anpassung ; 26. Falscher Film: Klimamanipulation ; 27. Die Neuerfindung der Moderne ; 28. Klimaschutz als Weltbürgerbewegung ; 29. Flucht und Gewalt ; 30. Arm und Reich ; 31. Wissenschaft, Gewissenschaft ; 32. Geschenk an Michelangelo

Note: Preface; Contributors; Content; Introduction; Cosmology - The Largest Possible Model?; The Standard Model of Cosmology as a Tool for Interpretation and Discovery; Patterns in Physical and Biological Systems; Symmetry and the Explanation of Organismal Form; Pluralistic Modeling of Complex Systems; The Methodological Challenges of Complex Systems; Contested Modeling: The Case of Economics; A Unifying Approach to High- and Low-Level Cognition; High-vs Low-Level Cognition and the Neuro- Emulative Theory of Mental Representation. , Evaluating a Computational Model of Eye-Movement Control in ReadingConsidering Criteria for Model Modification and Theory Change in Psychology; Identification of Kinetic Models by Incremental Refinement; Kinetics, Models, and Mechanism; Modeling Complexity: The Case of Climate Science; Chaos, Plurality, and Model Metrics in Climate Science; Subject Index; Author Index.

Note: Contents: 1 Introduction. - 1.1 Chapter Summary. - 1.2 The Meaning of the Book’s Title. - 1.3 Historical Background. - 1.4 How to Read This Book. - 1.5 Further Reading. - References. - PART 1 BASIC THEORETICAL CONCEPTS. - 2 Discrete-Time Signals and Systems. - 2.1 Chapter Summary. - 2.2 Basic Definitions and Concepts. - 2.3 Discrete-Time Signals: Sequences. - 2.3.1 Basic Sequence Operations. - 2.3.2 Basic Sequences. - 2.3.3 Deterministic and Random Signals. - 2.4 Linear Time-Invariant (LTI) Systems. - 2.4.1 Impulse Response of an LTI System and Linear Convolution. - 2.4.2 An Example of Linear Convolution. - 2.4.3 Interconnections of LTI Systems. - 2.4.4 Effects of Stability and Causality Constraints on the Impulse Response of an LTI System. - 2.4.5 Finite (FIR) and Infinite (IIR) Impulse Response Systems. - 2.4.6 Linear Constant-Coefficient Difference Equation (LCCDE). - 2.4.7 Examples of LCCDE. - 2.4.8 The Solutions of an LCCDE. - 2.4.9 From the LCCDE to the Impulse Response: Examples. - 2.4.10 Eigenvalues and Eigenfunctions of LTI Systems. - References. - 3 Transforms of Discrete-Time Signals. - 3.1 Chapter Summary. - 3.2 z-Transform. - 3.2.1 Examples of z-Transforms and Special Cases. - 3.2.2 Rational z-Transforms. - 3.2.3 Inverse z-Transform. - 3.2.4 The z-Transform on the Unit Circle. - 3.2.5 Selected z-Transform Properties. - 3.2.6 Transfer Function of an LTI System. - 3.2.7 Output Sequence of an LTI System. - 3.2.8 Zeros and Poles: Forms for Rational Transfer Functions. - 3.2.9 Inverse System. - 3.3 Discrete-Time Fourier Transform (DTFT). - 3.3.1 An Example of DTFT Converging in the Mean-Square Sense. - 3.3.2 Line Spectra. - 3.3.3 Inverse DTFT. - 3.3.4 Selected DTFT Properties. - 3.3.5 The DTFT of a Finite-Length Causal Sequence. - 3.4 Discrete Fourier Series (DFS). - 3.4.1 Selected DFS Properties. - 3.4.2 Sampling in the Frequency Domain and Aliasing in the Time Domain. - 3.5 Discrete Fourier Transform (DFT). - 3.5.1 The Inverse DFT in Terms of the Direct DFT. - 3.5.2 Zero Padding. - 3.5.3 Selected DFT Properties. - 3.5.4 Circular Convolution Versus Linear Convolution. - 3.6 Fast Fourier Transform (FFT). - 3.7 Discrete Trigonometric Expansion. - 3.8 Appendix: Mathematical Foundations of Signal Representation. - 3.8.1 Vector Spaces. - 3.8.2 Inner Product Spaces. - 3.8.3 Bases in Vector Spaces. - 3.8.4 Signal Representation by Orthogonal Bases. - 3.8.5 Signal Representation by Standard Bases. - 3.8.6 Frames and Biorthogonal Bases. - 3.8.7 Summary and Complements. - References. - 4 Sampling of Continuous-Time Signals. - 4.1 Chapter Summary. - 4.2 Sampling Theorem. - 4.3 Reconstruction of a Continuous-Time Signal from Its Samples. - 4.4 Aliasing in the Frequency Domain and Anti-Aliasing Filter. - 4.5 The Uncertainty Principle for the Analog Fourier Transform. - 4.6 Support of a Continuous-Time Signal in the Time and Frequency Domains. - 4.7 Appendix: Analog and Digital Frequency Variables. - References. - 5 Spectral Analysis of Deterministic Discrete-Time Signals. - 5.1 Chapter Summary. - 5.2 Issues in Practical Spectral Analysis. - 5.2.1 The Effect of Windowing. - 5.2.2 The Effect of Spectral Sampling. - 5.3 Classical Windows. - 5.4 The Kaiser Window. - 5.5 Energy and Power Signals and Their Spectral Representations. - 5.6 Correlation of Deterministic Discrete-Time Signals. - 5.6.1 Correlation of Energy Signals. - 5.6.2 Correlation of Power Signals. - 5.6.3 Effect of an LTI System on Correlation Properties of Input and Output Signals. - 5.7 Wiener-Khinchin Theorem. - 5.7.1 Energy Signals and Energy Spectrum. - 5.7.2 Power Signals and Power Spectrum. - References. - PART 2 DIGITAL FILTERS. - 6 Digital Filter Properties and Filtering Implementation. - 6.1 Chapter Summary. - 6.2 Frequency-Selective Filters. - 6.3 Real-Causal-Stable-Rational (RCSR) Filters. - 6.4 Amplitude Response. - 6.5 Phase Response. - 6.5.1 Phase Discontinuities and Zero-Phase Response. - 6.5.2 Linear Phase (LP). - 6.5.3 Generalized Linear Phase (GLP). - 6.5.4 Constraints on GLP Filters. - 6.6 Digital Filtering Implementation. - 6.6.1 Direct Forms. - 6.6.2 Transposed-Direct Forms. - 6.6.3 FIR Direct and Transposed-Direct Forms. - 6.6.4 Direct and Transposed-Direct Forms for LP FIR Filters. - 6.6.5 Cascade and Parallel Forms. - 6.7 Zero-Phase Filtering. - 6.8 An Incorrect Approach to Filtering. - 6.9 Filtering After Downsampling. - 6.9.1 Theory of Downsampling. - 6.9.2 An Example of Filtering After Downsampling. - References. - 7 FIR Filter Design. - 7.1 Chapter Summary. - 7.2 Design Process. - 7.3 Specifications of Digital Filters. - 7.3.1 Constraints on the Magnitude Response. - 7.3.2 Constraints on the Phase Response. - 7.4 Selection of Filter Type: IIR or FIR?. - 7.5 FIR-Filter Design Methods and Approximation Criteria. - 7.6 Properties of GLP FIR Filters. - 7.6.1 Factorization of the Zero-Phase Response. - 7.6.2 Zeros of the Transfer Function. - 7.6.3 Another Form of the Adjustable Term. - 7.7 Equiripple FIR Filter Approximations: Minimax Design. - 7.8 Predicting the Minimum Filter Order. - 7.9 MPR Algorithm. - 7.10 Properties of Equiripple FIR Filters. - 7.11 The Minimax Method for Bandpass Filters. - References. - 8 IIR Filter Design. - 8.1 Chapter Summary. - 8.2 Design Process. - 8.3 Lowpass Analog Filters. - 8.3.1 Laplace Transform. - 8.3.2 Transfer Function and Design Parameters. - 8.4 Butterworth Filters. - 8.5 Chebyshev Filters. - 8.5.1 Chebyshev-I Filters. - 8.5.2 Chebyshev-II Filters. - 8.6 Elliptic Filters. - 8.7 Normalized and Non-normalized Filters. - 8.8 Comparison Among the Four Analog Filter Types. - 8.9 From the Analog Lowpass Filter to the Digital One. - 8.9.1 Bilinear Transformation. - 8.9.2 Design Procedure. - 8.9.3 Examples. - 8.10 Frequency Transformations. - 8.10.1 From a Lowpass to a Highpass Filter. - 8.10.2 From a Lowpass to a Bandpass Filter. - 8.10.3 From a Lowpass to a Bandstop Filter . - 8.11 Direct Design of IIR Filters. - 8.12 Appendix. - 8.12.1 Trigonometric Functions with Complex Argument. - 8.12.2 Elliptic Integrals. - 8.12.3 Jacobi Elliptic Functions. - 8.12.4 Landen-Gauss Transformation. - 8.12.5 Elliptic Rational Function. - References. - PART 3 SPECTRAL ANALYSIS. - 9 Statistical Approach to Signal Analysis. - 9.1 Chapter Summary. - 9.2 Preliminary Considerations. - 9.3 Random Variables. - 9.4 Ensemble Averages. - 9.5 Stationary Random Processes and Signals. - 9.6 Ergodicity. - 9.7 Wiener-Khinchin Theorem for Random Signals and Power Spectrum. - 9.8 Cross-Power Spectrum of Two Random Signals. - 9.9 Effect of an LTI System on a Random Signal. - 9.10 Estimation of the Averages of Ergodic Stationary Signals. - 9.10.1 General Concepts in Estimation Theory. - 9.10.2 Mean and Variance Estimation. - 9.10.3 Autocovariance Estimation. - 9.10.4 Cross-Covariance Estimation. - 9.11 Appendix: A Road Map to the Analysis of a Data Record. - References. - 10 Non-Parametric Spectral Methods. - 10.1 Chapter Summary. - 10.2 Power Spectrum Estimation. - 10.3 Periodogram. - 10.3.1 Bias. - 10.3.2 Variance. - 10.3.3 Examples. - 10.3.4 Variance Reduction by Band- and Ensemble-Averaging. - 10.4 Bartlett’s Method. - 10.5 Modified Periodogram. - 10.6 Welch’s Method. - 10.7 Blackman-Tukey Method. - 10.8 Statistical Significance of Spectral Peaks. - 10.9 MultiTaper Method. - 10.10 Estimation of the Cross-Power Spectrum of Two Random Signals. - 10.11 Use of the FFT in Power Spectrum Estimation. - 10.12 Power Spectrum Normalization. - References. - 11 Parametric Spectral Methods. - 11.1 Chapter Summary. - 11.2 Signals with Rational Spectra . - 11.3 Stochastic Models and Processes. - 11.3.1 Autoregressive-Moving Average (ARMA) Model. - 11.3.2 Autoregressive (AR) Model. - 11.3.3 Moving Average (MA) Model. - 11.3.4 How the AR and MA Modeling Approaches Are Theoretically Related. - 11.3.5 First-Order AR and MA Models: White, Red and Blue Noise. - 11.3.6 Higher-Order AR Models. - 11.4 The AR Approach to Spectral Estimation. - 11.5 AR Modeling and Linear Prediction. - 11.6

Note: 1. The basic idea -- 2. Seafloor spreading and magnetic anomalies -- 3. Fracture zones and transform faults -- 4. Subduction of oceanic lithosphere -- 5. Rigid plates of lithosphere -- 6. Tectonics of continents -- 7. From whence to whither?

Note: section A. Language, ideology and powersection B. Discourse and sociocultural change -- section C. Dialectics of discourse: theoretical developments -- section D. Methodology in CDA research -- section E. Political discourse -- F. Globalisation and 'transition' -- section G. Language and education..

Note: Cover; Title Page; Copyright Page; Table of Contents; List of illustrations; Notes on contributors; Acknowledgements; 1 Socio-ecological transformations and the social sciences; PART I Challenges, contradictions and consequences of global socio-ecological change; 2 Ecological modernization theory: taking stock, moving forward; 3 The emergence of new world-systems perspectives on global environmental change; 4 China's economic growth and environmental protection: approaching a 'win-win' situation? A discussion of ecological modernization theory; 5 Eco-imperialism and environmental justice. , 6 Neoliberalism by design: changing modalities of market-based environmental governance7 Dilemmas for standardizers of sustainable consumption; PART II Climate change, energy and adaptation; 8 Climate, scenario-building and governance: comprehending the temporalities of social-ecological change; 9 From Rio to Copenhagen: multilateral agreements, disagreements and situated actions; 10 Marriage on the rocks: sociology's counsel for our struggling energy-society relationships; 11 Sustainability as social practice: new perspectives on the theory and policies of reducing energy consumption. , 12 Environmental migration: nature, society and population movementPART III Urban environmental change, governance and adaptation; 13 Climate change and urban governance: a new politics?; 14 Recovering the city level in the global environmental struggle: going beyond carbon trading; 15 Hybrid arrangements within the environmental state; 16 The new mobilities paradigm and sustainable transport: finding synergies and creating new methods; PART IV Risk, uncertainty and social learning; 17 Towards a socio-ecological foundation for environmental risk research. , 18 Uncertainty and claims of uncertainty as impediments to risk management19 Transboundary risk governance: co-constructing environmental issues and political solutions; 20 The role of professionals in managing technological hazards: the Montara blowout; 21 Social learning to cope with global environmental change and unsustainability; PART V (Re)assembling social-ecological systems; 22 The social-ecological co-constitution of nature through ecological restoration: experimentally coping with inevitable ignorance and surprise. , 23 Biological invasions as cause and consequence of 'our' changing world: social and environmental paradoxes24 Biological resources, knowledge and property; 25 Disassembling and reassembling socionatural networks: integrated natural resource management in the Great Bear Rainforest; 26 Land use tensions for the development of renewable sources of energy; Index.

Note: Univ., Diss.--Hannover, 2015

Note: Ecotones Between Forest and Grassland; Preface; Contents; Contributors; Chapter 1: Introduction; 1.1 Rationale; 1.2 Case Study: The Cross Timbers; 1.3 About This Book; References; Part I: Temperate Forest-Grassland Ecotones: Prairies, Steppes, and Pampas; Chapter 2: Woodland-Grassland Ecotonal Shifts in Environmental Mosaics: Lessons Learnt from the Environmental History of the Carpathian Basin (Central Europe) During the Holocene and the Last Ice Age Based on Investigation of Paleobotanical and Mollusk Remains; 2.1 Introduction. , 2.2 Modern Woodland-Grassland Ecotone in the Carpathian Basin and Controversies Around Definitions2.3 Profiles Selected and Methods Applied in Modeling Woodland-Grassland Ecotone Shifts in the Carpathian Basin; 2.3.1 The Climate-Zonal Hypothesis Put to the Test; 2.3.2 Testing the Model of Edaphic Ecological Factors; 2.3.3 Testing the Idea of Human-Induced Ecotone Development; 2.4 The Vegetation History of the Great Hungarian Plains as Inferred from the Evaluation of Quaternary Paleoecological and Environmental Historical Data; 2.4.1 Vegetation Development During Last Ice Age. , 2.4.2 Vegetation Development During the Terminal Part of the Last Ice Age2.4.3 Vegetation Development During the Pleistocene/Holocene Transition; 2.4.4 Vegetation History of the Carpathian Basin from the Settlement of the First Farmers; 2.5 Summary; References; Chapter 3: Ecotones as Complex Arenas of Disturbance, Climate, and Human Impacts: The Trans-Andean Forest-Steppe Ecotone of Northern Patagonia; 3.1 Introduction; 3.2 Physical and Biological Setting of Forest-Steppe Ecotone of Northern Patagonia; 3.2.1 Abiotic Transition; 3.2.2 Ecosystem Properties Across the Transition. , 3.2.3 Plant Communities and Plant Diversity Across the Transition3.3 Disturbance Variation and Forest Dynamics Across the Transition; 3.3.1 Fine-Scale Disturbances; 3.3.2 Coarse-Scale Disturbances; 3.4 Direct and Disturbances-Mediated In fl uences of Climate Variability Across the Transition; 3.5 Climate, Fire, Land Use, and Long-Term Vegetation Changes Across the Transition; 3.5.1 Xeric Steppe-Woodland Belt; 3.5.2 The Nothofagus Forest-Shrubland Belt; 3.5.3 The Wet Rainforest Belt; 3.6 Conclusions; References; Chapter 4: Woody-Herbaceous-Livestock Species Interaction; 4.1 Introduction. , 4.2 Woody-Herbaceous Species Interactions and Associated Models4.3 Woodland and Grassland Stable States and Conceptual Models; 4.4 Woody-Herbaceous Ecotones; 4.5 Rates and Patterns of Woody-Herbaceous Ecotone Shift; 4.6 Woody-Herbaceous-Livestock Species Dynamics; 4.7 Other Potential Factors In fl uencing Woody-Herbaceous Species Dynamics; 4.8 Current and Future Research on Woody-Herbaceous-Livestock Species Interaction; References; Chapter 5: Woody Plant Invasions in Pampa Grasslands: A Biogeographical and Community Assembly Perspective; 5.1 Introduction. , 5.2 Woody Invasions as Hierarchical Assembly Processes.

Note: Chapter 1: The innovation challenge: America's innovation challenges -- New trends in global innovation -- The pillars of U.S. innovative strength -- Responding to the innovation challenge -- Chapter 2: Sustaining leadership in innovation: Improving framework conditions, substantially increasing R&D funding, institutional support for applied research -- Strengthening manufacturing -- Providing early stage finance -- Developing twenty-first century universities -- Investing in modern S&T parks -- Growing innovation clusters -- Hunting for global talent, the way forward -- Chapter 3: Findings -- Chapter 4: Recommendations -- Chapter 5: The new global competitive environment: Emerging powers -- Newly industrialized economies -- Industrialized nation case studies -- Chapter 6: National support for emerging industries: Seminconductors -- The photovoltaic industry -- Advanced batteries -- Pharmaceuticals and biopharmaceuticals -- In closing -- Chapter 7: Clusters and regional initiatives: The innovation challenge, policies to foster innovation, regional innovation clusters -- Twenty-first century research and industry -- In closing..

Note: Machine generated contents note:1. Inclusive Developmen t: Debates and Issues -- 2. Inclusive Development and the Burdens of History -- 3. Addressing the Social Deficit in the Wake of Neoliberal Reforms -- 4. Mexico and Indonesia : Politics and Development in Weak States -- 5. Chile : Moving towards Greater Inclusion: From Political Polarization to Consensus -- 6. South Korea : Authoritarianism, Democracy, and the Struggle to Maintain Inclusive Development -- 7. Conclusions: The Politics and Policies of Inclusive Development..

Note: Exploring the politics of inclusive development : towards a new conceptual approach / Sam Hickey, Kunal Sen, and Badru BukenyaThe political determinants of economic growth : an analytical review / Kunal Sen -- The politics of what works for the poor in public expenditure and taxation / Paul Mosley -- Governing natural resources for inclusive development / Anthony Bebbington -- The politics of what works in service delivery / Claire Mcloughlin -- Political factors in the growth of social assistance / Armando Barrientos and Sony Pellissery -- The politics and process of rule of law systems in developmental states / Deval Desai and Michael Woolcock -- The gendered politics of securing inclusive development / Sohela Nazneen and Simeen Mahmud -- Ethnicity, state capacity, and development : reconsidering causal connections / Prerna Singh and Matthias vom Hau -- The politics of aid revisited : a review of evidence on state capacity and elite commitment / Arjan de Haan and Ward Warmerdam -- China in Africa : impacts and prospects for accountable development / Giles Mohan..

Note: Contents: Part I By Stephen M. Gardiner 1. How Will We be Remembered? ; 2. Betraying the Future ; 3. Who Are We and What Do We Want? ; 4. Justice vs. Extortion Part II By David A. Weisbach ; 5. Introduction to Part II ; 6. Climate Policy and Self-Interest ; 7. The Role of Claims of Justice in Climate Change Policy ; 8. Summing Up ; Part III Responses ; 9. 'The Feasible is Political' ; 10. Weisbach Responds to Gardiner

Note: Zugl.: Potsdam, Univ., Diss., 2016

Note: Introduction and overview -- Climate policies in the United States -- Theories of climate policy -- The structural theory applied to the cases -- Causes of climate policies in the fifty states -- Air-pollution and energy policy making in California (the 1940s to the 1980s) -- Climate policy making in California (the 2000s to the present) -- Energy and climate policy making in New York State -- Energy and climate policy making by the federal government -- Conclusions : political opportunities for climate policy in the United States.

Note: SECTION 1 - INTRODUCTION TO THE USE OF REMOTE SENSING FOR WETLAND MAPPING: Wetlands: An Overview / Ralph W. Tiner --- Classification of Wetland Types for Mapping and Large-Scale Inventories / Ralph W. Tiner --- Introduction to Wetland Mapping and Its Challenges / Ralph W. Tiner --- Early Applications of Remote Sensing for Mapping Wetlands / Ralph W. Tiner --- Advances in Remotely Sensed Data and Techniques for Wetland Mapping and Monitoring / Megan W. Lang, Laura L. Bourgeau-Chavez, Ralph W. Tiner, and Victor V. Klemas --- SECTION 2 - SUMMARIES OF REMOTE SENSING TECHNOLOGIES AND THEIR APPLICATION FOR MAPPING WETLANDS: Mapping and Monitoring Surface Water and Wetlands with Synthetic Aperture Radar / Brian Brisco --- Wetland InSAR: A Review of the Technique and Applications / Shimon Wdowinski and Sang-Hoon Hong --- Radar and Optical Image Fusion and Mapping of Wetland Resources / Elijah Ramsey III and Amina Rangoonwala --- Theory and Applications of Object-Based Image Analysis and Emerging Methods in Wetland Mapping / Joseph F. Knight, Jennifer M. Corcoran, Lian P. Rampi, and Keith C. Pelletier --- Unmanned Aerial Systems and Structure from Motion Revolutionize Wetlands Mapping / Marguerite Madden, Thomas Jordan, Sergio Bernardes, David L. Cotten, Nancy O’Hare, and Alessandro Pasqua --- SECTION 3 - APPLICATIONS OF REMOTE SENSING FOR MAPPING SPECIFIC WETLAND HABITATS: Remote Sensing of Submerged Aquatic Vegetation and Coral Reefs / Sam Purkis and Chris Roelfsema --- Remote Sensing of Mangroves / Victor V. Klemas --- Tidal Marsh Classification Approaches and Future Marsh Migration Mapping Methods for Long Island Sound, Connecticut and New York / Mark Hoover and Adam Walton Whelchel --- Using Moderate-Resolution Satellite Sensors for Monitoring the Biophysical Parameters and Phenology of Tidal Marshes / Deepak R. Mishra and Shuvankar Ghosh --- Great Lakes Coastal Wetland Mapping / Laura L. Bourgeau-Chavez, Zachary M. Laubach, Anthony J. Landon, Elizabeth C. Banda, Michael J. Battaglia, Sarah L. Endres, Mary Ellen Miller, Robb D. Macleod, and Colin N. Brooks --- Mapping Wetlands and Surface Water in the Prairie Pothole Region of North America / Jennifer Rover and David M. Mushet --- Mapping the State and Dynamics of Boreal Wetlands Using Synthetic Aperture Radar / Daniel Clewley, Jane Whitcomb, Mahta Moghaddam, and Kyle McDonald --- Fusion of Multispectral Imagery and LiDAR Digital Terrain Derivatives for Ecosystem Mapping and Morphological Characterization of a Northern Peatland Complex / Antonio Difebo, Murray Richardson, and Jonathan Price --- Airborne LiDAR-Based Wetland and Permafrost-Feature Mapping on an Arctic Coastal Plain, North Slope, Alaska / Jeffrey G. Paine, John R. Andrews, Kutalmis Saylam, and Thomas A. Tremblay --- Hybrid Mapping of Pantropical Wetlands from Optical Satellite Images, Hydrology, and Geomorphology / Thomas Gumbricht --- Capturing the Dynamics of Amazonian Wetlands Using Synthetic Aperture Radar: Lessons Learned and Future Directions / Thiago Sanna Freire Silva, John Melack, Annia Susin Streher, Jefferson Ferreira-Ferreira, and Luiz Felipe de Almeida Furtado --- Mapping China’s Wetlands and Recent Changes with Remotely Sensed Data / Zhenguo Niu --- Mapping Invasive Wetland Plants / Carol A. Johnston --- Multisatellite Remote Sensing of Global Wetland Extent and Dynamics / Catherine Prigent and Fabrice Papa --- SECTION 4 - PROMISING DEVELOPMENTS AND FUTURE CHALLENGES: Promising Developments and Future Challenges for Remote Sensing of Wetlands / Megan W. Lang, Sam Purkis, Victor V. Klemas, and Ralph W. Tiner