ALBERT

All Library Books, journals and Electronic Records Telegrafenberg

X
feed icon rss

Your email was sent successfully. Check your inbox.

An error occurred while sending the email. Please try again.

Proceed reservation?

Export
Filter
  • 2015-2019  (4,200,882)
  • 2010-2014  (3,083,989)
Collection
Keywords
Publisher
Language
Years
Year
  • 1
    Monograph available for loan
    Monograph available for loan
    Bolivia (2010)
    Footscray, Vic. : Lonely Planet
    Details Availability
    Call number: 1.8/M 10.0326
    Type of Medium: Monograph available for loan
    Pages: 392 S.
    Edition: 7th ed.
    ISBN: 9781741049985
    Series Statement: Lonely planet
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 2
    Monograph available for loan
    Monograph available for loan
    Malaysia, Singapore & Brunei (2010)
    Footscray, VIc. : Lonely Planet
    Details Availability
    Call number: 1.8/M 10.0343
    Type of Medium: Monograph available for loan
    Pages: 636 S.
    Edition: 11th ed.
    ISBN: 9781741048872
    Series Statement: Lonely planet
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 3
    Unknown
    Proceedings of the Tenth World Conference on Earthquake Engineering : 19-24 July 1992, Madrid, Spain (1992-)
    Rotterdam [u.a.] : Balkema
    Details Availability
    Call number: M 92.0634
    ISBN: 9054100605
    Language: English
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 4
    Monograph available for loan
    Monograph available for loan
    USA (2010)
    Footscray, VIc. : Lonely Planet
    Details Availability
    Call number: 1.8/M 10.0347
    Type of Medium: Monograph available for loan
    Pages: 1216 S.
    Edition: 6th ed.
    ISBN: 9781741792355
    Series Statement: Lonely planet
    Language: English
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 5
    Monograph available for loan
    Monograph available for loan
    The Comparative Method : Moving Beyond Qualitative and Quantitative Strategies (2014)
    Berkeley : University of California Press
    Details
    Call number: IASS 16.89932
    Description / Table of Contents: Charles C. Ragin's "The Comparative Method" proposes a synthetic strategy, based on an application of Boolean algebra, that combines the strengths of both qualitative and quantitative sociology. Elegantly accessible and germane to the work of all the social sciences, and now updated with a new introduction, this book will continue to garner interest, debate, and praise
    Type of Medium: Monograph available for loan
    Pages: xxx, 185 S.
    ISBN: 9780520280038
    Language: English
    Note: Cover; Contents; Preface and Overview; Acknowledgments; Introduction to the 2014 Edition; 1. The Distinctiveness of Comparative Social Science; 2. Heterogeneity and Causal Complexity; 3. Case-Oriented Comparative Methods; 4. The Variable-Oriented Approach; 5. Combined Versus Synthetic Comparative Strategies; 6. A Boolean Approach to Qualitative Comparison: Basic Concepts; 7. Extensions of Boolean Methods of Qualitative Comparison; 8. Applications of Boolean Methods of Qualitative Comparison; 9. The Dialogue of Ideas and Evidence in Social Research; Bibliography; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 6
    Monograph available for loan
    Monograph available for loan
    Deutschland - Erneuerbare Energien erleben : [Baedeker Wissen: Windkraft - auf ein Windrad steigen ; Solarenergie - auf Solarfähren lautlos dahingleiten ; Wasserkraft - große Wasserturbinen erleben ; Bioenergie - Bioenergiedörfer entdecken ; Geothermie - im Thermalbad entspannen ; mit Reiseatlas] (2014)
    Ostfildern : Baedeker
    Details Availability
    Call number: IASS 16.89938
    Description / Table of Contents: Unverändert gilt die Einschätzung von O. Kaptein zur 1. Auflage (ID-B 29/11), dass dieses Buch weniger einen touristischen Sinn erfüllt, sondern vielmehr als Hilfsmittel zur Projektplanung oder zu schulischen Zwecken dienen kann, für alle, die auf der Suche nach Vorzeigeprojekten der verschiedenen Formen von erneuerbaren Energien in einer bestimmten Gegend sind. Viele Kaufinteressenten hatten dies unter dem Label "Baedeker" missverstanden, was entsprechend säuerliche Bewertungen im Internet zur Folge hatte. Daher ist dieser Führer definitiv besser im Bestand zu den erneuerbaren Energien als bei der Reiseliteratur aufgehoben und rechtfertigt dort durchaus die breite Empfehlung für die genannte Zielgruppe. Gegenüber der 1. Auflage wurden die Touren herausgenommen und durch "Specials" zu Metropolregionen ersetzt, rund 30 neue Ziele wurden aufgenommen und die Angaben aktualisiert. Wo die Vorauflage gut genutzt wird, sollte sie um die vorliegende ergänzt werden. (2 A) (LK/LEV: Junker)
    Description / Table of Contents: Vorstellung von rund 190 in Deutschland umgesetzten Projekten zu erneuerbaren Energien, mit Basisinformationen, Wegbeschreibungen und Weblinks. Nützlich für thematisch Interessierte, die Praxisbeispiele in einer bestimmten Region besichtigen möchten. (LK/LEV: Junker)
    Type of Medium: Monograph available for loan
    Pages: 195 S. , zahlr. Ill. (farb.), graph. Darst., Kt. , 19 cm
    Edition: 2. Aufl., Red.-Schluss: 12/2013
    ISBN: 9783829714952
    Series Statement: Baedeker
    URL: Inhaltsverzeichnis
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 7
    Monograph available for loan
    Monograph available for loan
    SAP-Änderungs- und Transportmanagement : [das umfassende Handbuch zu Architektur, Installation, Werkzeugen, Betrieb und Wartung ; detaillierte Anleitungen zur Änderungs- und Transportverwaltung ; Transport Organizer, SAP Solution Manager, erweitertes Transportwesen (CTS+), Enhancement Packages u.v.m.] (2013)
    Bonn : Galileo Press
    Details Availability
    Call number: M 15.89533
    Type of Medium: Monograph available for loan
    Pages: 1008 S.
    Edition: 4., aktualisierte und erw. Aufl.
    ISBN: 3836219174 , 9783836219174
    Series Statement: SAP PRESS
    URL: Inhaltstext
    URL: Inhaltsverzeichnis
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 8
    Monograph available for loan
    Monograph available for loan
    SAP-Berechtigungswesen (2013)
    Bonn [u.a.] : Galileo Press
    Details Availability
    Call number: M 16.89534
    Type of Medium: Monograph available for loan
    Edition: 3. Aufl.
    ISBN: 978-3-8362-3768-0
    Series Statement: SAP Press
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 9
    Monograph available for loan
    Monograph available for loan
    SAP-Schnittstellenprogrammierung : [alle wichtigen Schnittstellentechnologien im Überblick; RFC, BAPI, ALE, IDoc, OData und SOAP in praktischer Anwendung; komplett ausprogrammierte Beispiele in ABAP, Java, C/C++ und C# (2014)
    Bonn : Galileo Press
    Details Availability
    Call number: M 15.89535
    Type of Medium: Monograph available for loan
    Pages: 548 S. , Ill. , 24 cm
    Edition: 3., aktualisierte und erw. Aufl.
    ISBN: 3836226758 , 9783836226752
    Series Statement: SAP Press
    URL: Inhaltsverzeichnis
    URL: Inhaltstext
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 10
    Monograph available for loan
    Monograph available for loan
    Schwarzwald : : Lagerstätten und Mineralien aus vier Jahrhunderten; 1: Nordschwarzwald & Grube Clara (2015)
    Lauenstein : Bode
    Associated volumes
    Details Availability
    Call number: M 15.89564/1
    Type of Medium: Monograph available for loan
    Pages: 672 Seiten , Illustrationen, Diagramme, Karten
    ISBN: 9783942588171
    Series Statement: Edition Krüger-Stiftung
    URL: Inhaltsverzeichnis
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 11
    Series available for loan
    Series available for loan
    Miocene Bryozoa from East Kalimantan, Indonesia. Part II: 'Ascophoran' Cheilostomata (2015)
    Leiden : Nationaal Natuurhistorisch Nuseum
    Details Availability
    Call number: S 93.0422(148)
    Type of Medium: Series available for loan
    Pages: 142 S. , Ill.
    ISBN: 9789065190000
    Series Statement: Scripta geologica 148
    Language: English
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 12
    Series available for loan
    Series available for loan
    Proceedings of the 5th Symposium on Mesozoic Cenozoic Decapod Crustaceans, Krakow, Poland, 2013 : a tribute to Pál Mihály Müller (2014)
    Leiden : Naturalis Biodiversity Center
    Details Availability
    Call number: S 93.0422(147)
    Type of Medium: Series available for loan
    Pages: 329 S. , Ill., Kt.
    Series Statement: Scripta geologica 147
    Language: English
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 13
    Monograph available for loan
    Monograph available for loan
    Sichere Vergabe unterhalb der Schwellenwerte (2015)
    Köln : Bundesanzeiger
    Details Availability
    Call number: PIK C 329-16-89587
    Type of Medium: Monograph available for loan
    Pages: 472 S , graph. Darst. , 244 mm x 165 mm
    Edition: 3. akt. und überarb. Aufl.
    ISBN: 3846204730 , 9783846204733
    URL: Inhaltstext
    Language: German
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 14
    Series available for loan
    Series available for loan
    Geologica Saxonica; 60, 3 (2015)
    Dresden : Senckenberg-Ges. für Naturforschung
    Associated volumes
    Details Availability
    Call number: S 92.0551(60, 3)
    In: Geologica Saxonica
    Type of Medium: Series available for loan
    Pages: S. 377 - 488 , Ill., graph. Darst., Kt.
    ISBN: 9783910006560 (korrigiert)
    URL: http://www.senckenberg.de/root/index.php?page_id=8076#GS603
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 15
    Series available for loan
    Series available for loan
    Der gepixelte Wald - reloaded : Fachtagung am Zentrum Wald-Forst-Holz in Freising-Weihenstephan vom 17. bis 18. März 2015 (2015)
    Freising : Zentrum Wald-Forst-Holz
    Associated volumes
    Details Availability
    Call number: ZS-064(214)
    In: Forstliche Forschungsberichte München
    Type of Medium: Series available for loan
    Pages: 147 S. , Ill., graph. Darst., Kt.
    ISBN: 393350645X
    Series Statement: Forstliche Forschungsberichte München 214
    Classification:
    Photogrammetry, Remote Sensing
    Language: German
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 16
    Monograph available for loan
    Monograph available for loan
    Systems thinking for geoengineering policy : how to reduce the threat of dangerous climate change by embracing uncertainty and failure (2016)
    New York, NY :Routledge,
    Details Availability
    Call number: IASS 16.90069
    Type of Medium: Monograph available for loan
    Pages: XV, 211 S.
    ISBN: 9781138841178 (hb)
    Series Statement: Earthscan science in society
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 17
    Unknown
    Oxford guide to plain English (2013)
    Oxford : Oxford University Press
    Details Availability
    Call number: 22/M 15.89566 (1. Ex.) ; 22/M 15.89566 (2. Ex.) ; 22/M 15.89566 (3. Ex.) ; 22/M 15.89566 (4. Ex.) ; 22/M 15.89566 (5. Ex.) ; 22/M 15.89566 (6. Ex.) ; 22/M 15.89566 (7. Ex.) ; 22/M 15.89566 (8. Ex.) ; 22/M 15.89566 (9. Ex.) ; 22/M 15.89566 (10. Ex.)
    Description / Table of Contents: Completely revised and updated, this new edition of the Oxford Guide to Plain English is an essential tool for clear communication. It provides authoritative help on how to get your message across effectively. In 25 easy-to-follow chapters, it covers straightforward language, punctuation, grammar, writing emails, and much more.
    Pages: xxxii, 288 S. , Ill. , 20 cm
    Edition: 4. edition
    ISBN: 0199669171 ((pbk.) £7.99) , 9780199669172 ((pbk.) £7.99)
    Language: English
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 18
    Unknown
    A manual for writers of research papers, theses, and dissertations : Chicago Style for students and researchers (2013)
    Chicago, Ill. [u.a.] : Univ. of Chicago Press
    Details Availability
    Call number: 22/M 15.89565 (1. Ex.) ; 22/M 15.89565 (2. Ex.) ; 22/M 15.89565 (3. Ex.) ; 22/M 15.89565 (4. Ex.) ; 22/M 15.89565 (5. Ex.) ; 22/M 15.89565 (6. Ex.) ; 22/M 15.89565 (7. Ex.) ; 22/M 15.89565 (8. Ex.) ; 22/M 15.89565 (9. Ex.) ; 22/M 15.89565 (10. Ex.
    Pages: XV, 448 S. , Ill., graph. Darst.
    Edition: 8. ed. [rev. ed.]
    ISBN: 0226816370 (hbk) , 9780226816371 (hbk) , 9780226816388 (pbk) , 9780226816395 (electr.; ebk)
    Series Statement: Chicago guides to writing, editing, and publishing
    URL: Inhaltsverzeichnis
    Language: English
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Location: Reading room/gallery
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 19
    Unknown
    Be the Captain of Your Career : A New Approach to Career Planning and Advancement (2014)
    Chicago : Precision Wordage Press
    Details
    Call number: 22/M 15.89567 (1. Ex.) ; 22/M 15.89567 (2. Ex.) ; 22/M 15.89567 (3. Ex.) ; 22/M 15.89567 (4. Ex.) ; 22/M 15.89567 (5. Ex.) ; 22/M 15.89567 (6. Ex.) ; 22/M 15.89567 (7. Ex.) ; 22/M 15.89567 (8. Ex.) ; 22/M 15.89567 (9. Ex.) ; 22/M 15.89567 (10. Ex.)
    Description / Table of Contents: Drawing from his own experience with corporations both large and small and as a business owner, Jack Molisani has seen every mistake the professional (or not-so-professional) can make in today's highly competitive job market. This book provides the tools for navigating these choppy waters. Starting with how to escape a dead-end job or an overbearing boss, to advancing one's career, and finally to achieving a higher standard of living, the book is divided into sections on finding new directions, making things happen, and optimizing the results. While most business guides focus on either job hun
    Pages: Online-Ressource (111 p)
    Edition: Online-Ausg.
    ISBN: 9780962709029
    URL: Volltext
    URL: Volltext
    URL: Inhaltsverzeichnis
    Parallel Title: Print version: Be the Captain of Your Career : A New Approach to Career Planning and Advancement
    Language: English
    Note: Cover; Copyright; Praise; Introduction; Contents; Section 1: THINK IT; The First Thing to Do When You Find Yourself in a Hole: Stop Digging; Stay Positive; Never Lose Faith; Seven Career Lessons I Learned from Selling Ginsu Knives; A Turning Point; Stop. Breathe. Think. Then Act.; Overcoming Inertia; Overcoming Fear; Keep Swimming; Section 2: DO IT; What Is a Resume?; What Are Managers Looking For?; Dirty Little Resume Secrets; The T-Bomb; Current Experience; What You Do Is More Important than What You're Called; The Top Ten Mistakes Professionals Make When Looking for Work. , Resumes: A SummaryCover Your Letter; Following Up; Getting Interviews; Be Proactive; Be Visible; Social Networking; Four Critical Steps to Getting a Job Offer; Send Out Ships; Gold Calling; Section 3: HAVE IT; Creating the Path; Recession-Proof Your Career; Creating a PR Campaign; Taking the Initiative; Increase Your Ability to Find Work; Advancing Your Career through Personal Branding; Advancing Your Career through Progressive Information Disclosure; Honing Your Workplace Negotiation Skills; The Sky's the Limit; What Are You Waiting For?; About Making Money; Creating the Life You Want. , Recommended ReadingAbout the Author.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 20
    Series available for loan
    Series available for loan
    2015 - Helmholtz Association 20 years (2014)
    Associated volumes
    Details Availability
    Call number: 3/S 07.0034(2015)
    In: Annual report ...
    Type of Medium: Series available for loan
    Pages: 51 S.
    URL: https://www.helmholtz.de/no_cache/en/about_us/press_und_media/media_centre/publications/pr/geschaeftsbericht-2015/
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 21
    Monograph available for loan
    Monograph available for loan
    Kooperationsmanagement in der Praxis : Gesellschaftliche Veränderungen gestalten mit Capacity WORKS (2014)
    Wiesbaden : Springer
    Details Availability
    Call number: PIK D 025-16-89602
    Type of Medium: Monograph available for loan
    Pages: IX, 283 S. , graph. Darst. , 240 mm x 168 mm
    ISBN: 3658062754 , 9783658062750 , 9783658062767
    URL: Inhaltstext
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 22
    Monograph available for loan
    Monograph available for loan
    Agricultural policy monitoring and evaluation 2015 (2015)
    Paris : OECD
    Details
    Call number: PIK W 101-16-89599
    Description / Table of Contents: This annual publication provides information on policy developments and related support to agriculture in OECD countries and selected partner economies, measured with the OECD Producer Support Estimate methodology. Countries covered represent about 80% of the global value added in agriculture. The report includes a general discussion on developments in agricultural policies and specific chapters for each country covered
    Description / Table of Contents: This annual publication provides information on policy developments and related support to agriculture in OECD countries and selected partner economies, measured with the OECD Producer Support Estimate methodology. Countries covered represent about 80% of the global value added in agriculture. The report includes a general discussion on developments in agricultural policies and specific chapters for each country covered.
    Type of Medium: Monograph available for loan
    Pages: 293 S. , graph. Darst.
    Edition: 1. Aufl.
    ISBN: 9789264234529
    Language: English
    Note: Foreword; Acknowledgements; Table of contents; Reader's guide; Definition of OECD indicators of agricultural support; Nominal indicators used in this report; Ratio indicators and percentage indicators; Box 1. Definitions of categories in the PSE classification; Decomposition indicators; Definition of GSSE categories; Sources and definitions of contextual indicators; Table X.1. Contextual indicators; Box 2. Definitions of categories in the GSSE classification; Figure X.2. Main macroeconomic indicators; Figure X.3. Agro-food trade; OECD indicators of support; Currencies. , List of acronyms and abbreviationsExecutive summary; Recommendations; Chapter 1. Developments in agricultural policy and support; Key economic and market developments; Table 1.1. Key economic indicators; Figure 1.1. Commodity world price indices, 2007 to 2014; Main features of agricultural policies; Box 1.1. Agriculture and COP21; Box 1.2. Developments post the 2013 Bali WTO Ministerial; Developments in agricultural support; Countries' importance in global agriculture has changed since the mid-1990s - and so has their role in supporting agriculture. , Figure 1.2. Country shares in total agricultural GDP and in total TSE, 1995-97 and 2012-14Total monetary transfers to the agricultural sector were stable in some countries, but increased significantly in others; Figure 1.3. Evolution of Total Support Estimate, 1995-97 to 2012-14; However the relative cost of agricultural support for the economies has decreased significantly over time in most of the countries; Figure 1.4. Total Support Estimate by country, 1995-97 and 2012-14. , The total agricultural support is dominated by support to agricultural producers, while expenditures on key general services to the sector are relatively smallFigure 1.5. Composition of Total Support Estimate by country, 2012-14; Average support to agricultural producers in OECD countries and emerging economies is converging; Figure 1.6. Evolution of Producer Support Estimate, 1995 to 2014; However short- and long-term changes across individual countries remain very uneven; Figure 1.7. Producer Support Estimate by country, 2013 and 2014. , Box 1.3. What drove changes in the monetary value of producer support in 2014?Figure 1.8. Contribution of various factors to the change in the Producer Support Estimate in 2014; Box 1.3. What drove changes in the monetary value of producer support in 2014? (cont.); Figure 1.9. Evolution of producer support at different stages of economic development, 1986 to 2013; Figure 1.10. Producer Support Estimate by country, 1995-97 and 2012-14; Differences in policy approaches are also reflected in policy instruments; Figure 1.11. Composition of Producer Support Estimate by country, 2012-14. , Figure 1.12. Composition of payments based on area, animal numbers, receipts and income by country, 1995-97 and 2012-14.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 23
    Monograph available for loan
    Monograph available for loan
    Thermodynamic foundations of the Earth system (2016)
    New York : Cambridge University Press
    Details Availability
    Call number: PIK N 141-15-89606
    Type of Medium: Monograph available for loan
    Pages: XV, 379 Seiten , Ill., graph. Darst.
    ISBN: 9781107029941 , 1107029945
    URL: http://www.gbv.de/dms/bowker/toc/9781107029941.pdf
    Language: English
    Note: Thermodynamics and the Earth systemEnergy and entropy -- The first and second law of thermodynamics -- Thermodynamic limits -- Dynamics, structures, and maximization -- Radiation -- Motion -- Hydrologic cycling -- Geochemical cycling -- Land -- Human activity -- The thermodynamic Earth system..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 24
    Monograph available for loan
    Monograph available for loan
    Extreme events : observations, modeling and economics (2014)
    Somerset : Wiley
    Associated volumes
    Details Availability
    Call number: 5/M 16.89607
    In: Geophysical monograph
    Description / Table of Contents: Home / Earth, Space & Environmental Sciences / Geology & Geophysics / Geology & Geophysics Extreme Events: Observations, Modeling, and Economics Mario Chavez (Editor), Michael Ghil (Editor), Jaime Urrutia-Fucugauchi (Editor) ISBN: 978-1-119-15701-4 438 pages March 2016, Wiley-Blackwell Extreme Events: Observations, Modeling, and Economics (1119157013) cover image Read an Excerpt Description The monograph covers the fundamentals and the consequences of extreme geophysical phenomena like asteroid impacts, climatic change, earthquakes, tsunamis, hurricanes, landslides, volcanic eruptions, flooding, and space weather. This monograph also addresses their associated, local and worldwide socio-economic impacts. The understanding and modeling of these phenomena is critical to the development of timely worldwide strategies for the prediction of natural and anthropogenic extreme events, in order to mitigate their adverse consequences. This monograph is unique in as much as it is dedicated to recent theoretical, numerical and empirical developments that aim to improve: (i) the understanding, modeling and prediction of extreme events in the geosciences, and, (ii) the quantitative evaluation of their economic consequences. The emphasis is on coupled, integrative assessment of the physical phenomena and their socio-economic impacts. With its overarching theme, Extreme Events: Observations, Modeling and Economics will be relevant to and become an important tool for researchers and practitioners in the fields of hazard and risk analysis in general, as well as to those with a special interest in climate change, atmospheric and oceanic sciences, seismo-tectonics, hydrology, and space weather.
    Type of Medium: Monograph available for loan
    ISBN: 9781119157014
    Series Statement: Geophysical monograph series 214
    Classification:
    Natural Disasters, Disaster Management
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 25
    Monograph available for loan
    Monograph available for loan
    Forschungsmethoden und Evaluation in den Sozial- und Humanwissenschaften (2016)
    Berlin, Heidelberg : Springer
    Details Availability
    Call number: IASS 16.90105
    Description / Table of Contents: Der Methoden-Koffer für Studium, Forschung und Praxis. Der Klassiker zu den Forschungsmethoden - in der 5. Auflage rundum erneuert, didaktisch verbessert und aktueller denn je! Dieses Buch ist ein fundierter und verlässlicher Begleiter für Studierende, Forschende und Berufstätige. Alles drin… Grundlagen: Quantitative und qualitative Sozialforschung, Wissenschaftstheorie, wissenschaftliche Qualitätskriterien und Forschungsethik. Anwendung: Alle Phasen des Forschungsprozesses von der Festlegung des Forschungsthemas, des Untersuchungsdesigns und der Operationalisierung über Stichprobenziehung, Datenerhebungs- und Datenanalysemethoden bis zur Ergebnispräsentation. Vertiefung: Effektgröße, Teststärke und optimaler Stichprobenumfang, Metaanalysen, Strukturgleichungsmodelle, Evaluationsforschung. … und grundlegend überarbeitet - das ist neu! Klarheit: Verbesserte Gliederung der Kapitel sowie des gesamten Buches. Aktualität: Beiträge zu Online-Methoden, Mixed-Methods-Designs und anderen neueren Entwicklungen. Lernfreundlichkeit: Viele Abbildungen, Tabellen, Definitionsboxen, Cartoons, Übungsaufgaben und Lernquiz mit Lösungen. Praxisbezug: Reale Studienbeispiele aus verschiedenen sozial- und humanwissenschaftlichen Fächern (z. B. Psychologie, Kommunikationswissenschaft, Erziehungswissenschaft, Medizin, Soziologie). Mit Begleit-Website: Lern-Tools für Studierende und Materialien für Lehrende
    Type of Medium: Monograph available for loan
    Pages: XXVII, 1051 S. 194 Abb
    Edition: 5., vollst. überarb., akt. u. erw. Aufl. 2016
    Edition: Online edition Springer eBook Collection. Psychology
    ISBN: 9783642410895 , 9783642410888
    Series Statement: Springer-Lehrbuch
    Parallel Title: Erscheint auch als
    Language: German
    Note: I. GrundlagenEmpirische Sozialforschung im Überblick -- Wissenschaftstheoretische Grundlagen der empirischen Sozialforschung -- Qualitätskriterien in der empirischen Sozialforschung -- Forschungs- und Wissenschaftsethik -- II. Anwendung -- Forschungsthema -- Forschungsstand und theoretischer Hintergrund -- Untersuchungsdesign -- Operationalisierung -- Stichprobenziehung -- Datenerhebung -- Datenaufbereitung -- Datenanalyse -- Ergebnispräsentation.- III. Vertiefung -- Bestimmung von Teststärke, Effektgröße und optimalem Stichprobenumfang -- Minimum-Effektgrößen-Tests -- Metaanalyse -- Strukturgleichungsmodelle -- Evaluationsforschung..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 26
    Monograph available for loan
    Monograph available for loan
    The honest broker : making sense of science in policy and politics (2011)
    Cambridge [u.a.] : Cambridge Univ. Press
    Details Availability
    Call number: IASS 16.90120
    Type of Medium: Monograph available for loan
    Pages: X, 188 S. , graph. Darst.
    Edition: 1. publ. 2007, 11. print. 2014
    ISBN: 9780521873208 ((hardback)) , 9780521694810 ((paperback))
    URL: http://www.gbv.de/dms/bowker/toc/9780521873208.pdf
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 27
    Monograph available for loan
    Monograph available for loan
    Wissenschaftliche Arbeiten schreiben mit Microsoft Office Word 2016, 2013, 2010, 2007 (2016)
    [Frechen] : mitp
    Details Availability
    Call number: M 16.89638
    Type of Medium: Monograph available for loan
    Pages: 495 Seiten , Illustrationen , 24 cm
    Edition: 1. Auflage
    ISBN: 9783958450479
    URL: Inhaltsverzeichnis
    URL: Inhaltstext
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 28
    Monograph available for loan
    Monograph available for loan
    Makroseismischer Atlas Baden-Württemberg : 19. und 20. Jahrhundert (2015)
    Freiburg : Regierungspräsidium Freiburg
    Details Availability
    Call number: 8/A4 48
    Type of Medium: Monograph available for loan
    Pages: 320 S. , Ill., überw. Kt.
    Edition: 1. Auflage: Februar 2015
    ISBN: 9783000475252
    URL: Inhaltsverzeichnis
    Classification:
    Seismology
    Language: German , English
    Note: Einl. in dt. und engl. Sprache
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 29
    Monograph available for loan
    Monograph available for loan
    Praxishandbuch Report Painter/Report Writer : [schnell und einfach Bericht für das SAP-Finanzwesen erstellen, Report Painter/Report Writer bestmöglich nutzen ; mit ausführlichen Praxisbeispielen] (2012)
    Bonn : Galileo Press
    Details Availability
    Call number: M 16.89641
    Type of Medium: Monograph available for loan
    Pages: 320 S. , graph Darst., Tab. , 168 mm x 240 mm
    Edition: 1. Aufl.
    ISBN: 9783836217187
    Series Statement: SAP PRESS
    URL: Inhaltstext
    URL: Inhaltsverzeichnis
    URL: Inhaltsverzeichnis
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 30
    Monograph available for loan
    Monograph available for loan
    Smart power generation : [the future of electricity production] (2011)
    Helsinki : Avain Publ.
    Details Availability
    Call number: IASS 16.89649
    Type of Medium: Monograph available for loan
    Pages: 200 S. , Ill., graph. Darst.
    Edition: 2nd edition
    ISBN: 9789516928466
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 31
    Monograph available for loan
    Monograph available for loan
    Total alles über Südtirol =Alto Adige - tutto di tutto =The complete South Tyrol (2012)
    Wien : Folio
    Details Availability
    Call number: IASS 16.89650
    Type of Medium: Monograph available for loan
    Pages: 128 S , überw. Ill , 245 mm x 190 mm
    Edition: 1. Aufl.
    ISBN: 9783852566078
    URL: Inhaltsverzeichnis
    URL: Rezension
    URL: Inhaltsverzeichnis
    Language: German , Italian , English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 32
    Monograph available for loan
    Monograph available for loan
    Nachhaltige Ökonomie : ökonomische Theorie und Praxis einer Nachhaltigen Entwicklung ; [Grenzen der natürlichen Tragfähigkeit: Ökonomie, Ökologie, Soziales] (2012)
    Marburg : Metropolis-Verl.
    Details Availability
    Call number: IASS 16.89646
    Type of Medium: Monograph available for loan
    Pages: 812 S , graph. Darst. , 23 cm
    Edition: 2., überarb. und erw. Aufl
    ISBN: 3895188654 (Geb.) , 9783895188657 (Geb.)
    Series Statement: Grundlagen der Wirtschaftswissenschaft 15
    URL: http://www.gbv.de/dms/zbw/683382446.pdf
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 33
    Monograph available for loan
    Monograph available for loan
    Buying time : the delayed crisis of democratic capitalism (2014)
    London [u.a.] : Verso
    Details Availability
    Call number: IASS 16.90268
    Description / Table of Contents: "The financial crisis keeps us on edge and creates a diffuse sense of helplessness. Well-nigh unfathomable problems lead to measures that seem like emergency operations on the open heart of the Western world, performed with no knowledge of the patient's clinical history. The gravity of the situation is matched by the paucity of our understanding of it, and of how it came about in the first place. In this book, compiled from his Adorno Lectures given in Frankfurt, Wolfgang Streeck lays bare the roots of the present financial, fiscal and economic crisis, seeing it as part of the long neoliberal transformation of postwar capitalism that began in the 1970s. Linking up with the crisis theories of that decade, he analyses the subsequent tensions and conflicts involving states, governments, voters and capitalist interests--a process in which the defining focus of the European state system has shifted from taxation through debt to budgetary "consolidation." The book then ends by exploring the prospects for a restoration of social and economic stability. Buying Time is a model of enlightenment. It shows that something deeply disturbing underlies the current situation: a metamorphosis of the whole relationship between democracy and capitalism"--
    Description / Table of Contents: "The financial and economic crisis that began in 2008 still has the world on tenterhooks. The gravity of the situation is matched by a general paucity of understanding about what is happening and how it started. In this book, based on his 2012 Adorno Lectures given in Frankfurt, Wolfgang Streeck places the crisis in the context of the long neoliberal transformation of postwar capitalism that began in the 1970s. He analyses the subsequent tensions and conflicts involving states, governments, voters and capitalist interests, as expressed in inflation, public debt, and rising private indebtedness. Streeck traces the transformation of the tax state into a debt state, and from there into the consolidation state of today. At the centre of the analysis is the changing relationship between capitalism and democracy, in Europe and elsewhere, and the advancing immunization of the former against the latter"--
    Type of Medium: Monograph available for loan
    Pages: XVIII, 220 S. , graph. Darst. , 21 cm
    ISBN: 1781685495 (hbk) , 9781781685495 (hbk) , 1781685487 (pbk) , 9781781685488 (pbk) , 9781781685501 (electr.; US) , 9781781685518 (electr.; UK)
    Uniform Title: Gekaufte Zeit. 〈engl.〉
    URL: Inhaltsverzeichnis
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 34
    Monograph available for loan
    Monograph available for loan
    Counterfactuals and causal inference : methods and principles for social research (2015)
    New York, NY : Cambridge Univ. Press
    Details Availability
    Call number: PIK M 311-16-89773
    Description / Table of Contents: In this second edition of Counterfactuals and Causal Inference, completely revised and expanded, the essential features of the counterfactual approach to observational data analysis are presented with examples from the social, demographic, and health sciences. Alternative estimation techniques are first introduced using both the potential outcome model and causal graphs; after which, conditioning techniques, such as matching and regression, are presented from a potential outcomes perspective. For reseach scenarios in which important determinants of causal exposure are unobserved, alternative techniques, such as instrumental variable estimators, longitudinal methods, and estimation via causal mechanisms, are then presented. The importance of causal effect heterogeneity is stressed throughout the book, and the need for deep causal explanation via mechanisms is discussed.
    Type of Medium: Monograph available for loan
    Pages: XXIII, 499 S. , graph. Darst
    Edition: 2. ed., reprinted with corr., 3. print.
    ISBN: 9781107065079 (hardback) , 9781107694163 (paperback)
    Series Statement: Analytical methods for social research
    Language: English
    Note: Part I. Causality and Empirical Research in the Social Sciences: 1. Introduction ; Part II. Counterfactuals, Potential Outcomes, and Causal Graphs: 2. Counterfactuals and the potential-outcome model ; 3. Causal graphs ; Part III. Estimating Causal Effects by Conditioning on Observed Variables to Block Backdoor Paths: 4. Models of causal exposure and identification criteria for conditioning estimators ; 5. Matching estimators of causal effects ; 6. Regression estimators of causal effects ; 7. Weighted regression estimators of causal effects ; Part IV. Estimating Causal Effects When Backdoor Conditioning Is Ineffective: 8. Self-selection, heterogeneity, and causal graphs ; 9. Instrumental-variable estimators of causal effects ; 10. Mechanisms and causal explanation ; 11. Repeated observations and the estimation of causal effects ; Part V. Estimation When Causal Effects Are Not Point Identified by Observables: 12. Distributional assumptions, set identification, and sensitivity analysis ; Part VI. Conclusions: 13. Counterfactuals and the future of empirical research in observational social science.
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 35
    Monograph available for loan
    Monograph available for loan
    Peacebuilding in a globalized world : an illustrated introduction to peace studies = Quan qiu hua shi jie he ping jian she : tu jie he ping xue (2015)
    Bei jing : Ren min chu ban she
    Details Availability
    Call number: IASS 16.89776
    Type of Medium: Monograph available for loan
    Pages: 530 Seiten , Illustrationen
    ISBN: 9787010149363
    Language: English , Chinese
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 36
    Monograph available for loan
    Monograph available for loan
    Potenziale und Risiken eingeführter Baumarten : Baumartenportraits mit naturschutzfachlicher Bewertung (2015)
    Göttingen : Univiversitäts-Verlag
    Details Availability
    Call number: PIK W 511-16-89775
    Description / Table of Contents: Eine nachhaltige, multifunktionale Forstwirtschaft hat den Anspruch, Wälder so zu pflegen und zu nutzen, dass deren Produktivität, Verjüngungsfähigkeit, Vitalität und biologische Vielfalt erhalten bleiben. In der Vergangenheit hat sich gezeigt, dass weder im Kielwasser der Rohholzerzeugung noch in jenem des Naturschutzes alle Waldfunktionen angemessen erfüllt werden. Die Integration eingeführter Baumarten in einen Waldbau auf ökologischen Grundlagen erfordert daher Kompromisse, die sich auf der Basis wissenschaftlicher Erkenntnisse in der Regel auch finden lassen. Konkret bedeutet dies, dass der Anbau nicht invasiver eingeführter Baumarten in gewissem Umfang vom Naturschutz ebenso akzeptiert wird, wie seitens der Forstwirtschaft naturschutzfachliche Interessen berücksichtigt werden, indem bei ihrem Anbau auf eine räumliche Ordnung geachtet wird und bestehende Vorkommen invasiver Baumarten zurückgedrängt werden. Ziel dieser Ausarbeitung ist es vor diesem Hintergrund, die Potenziale und Risiken von 15 eingeführten Baumarten auf der Grundlage wissenschaftlicher Literatur und langjähriger Forschungsarbeiten auf Versuchsflächen der verschiedenen Forschungseinrichtungen und Anbauflächen der Forstbetriebe aufzuzeigen, um die zwischen Naturschutz und Forstwirtschaft aufgekommene Diskussion zu versachlichen.
    Type of Medium: Monograph available for loan
    Pages: 296 Seiten , Illustrationen
    ISBN: 9783863952402
    Series Statement: Göttinger Forstwissenschaften 7
    URL: http://www.gbv.de/dms/tib-ub-hannover/840203462.pdf
    URL: https://www.univerlag.uni-goettingen.de/bitstream/handle/3/isbn-978-3-86395-240-2/GoeForst7_baumarten.pdf?sequence=4&isAllowed=y
    Parallel Title: Online-Ausg.: Potenziale und Risiken eingeführter Baumarten
    Language: German
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 37
    Monograph available for loan
    Monograph available for loan
    EU energy law and policy : a critical account (2013)
    Oxford : Oxford Univ. Press
    Details Availability
    Call number: PIK N 071-15-89127
    Type of Medium: Monograph available for loan
    Pages: XXIII, 317 S.
    Edition: 1. ed.
    ISBN: 0199686394 , 9780199686391
    URL: http://www.gbv.de/dms/spk/sbb/toc/769783910.pdf
    URL: Autorenbiografie
    URL: Verlagsangaben
    Language: English
    Note: Introduction.EU energy law and the approach taken in this studyThe regulatory history of EU energy : the evolution of EU energy law from 1957 onwardsThe evolution of the sector-specific regulatory frameworkTreaty law and the energy sectorEnvironment and energy : on a bumpy road towards a clean energy futureThe international dimension of EU energy law and policyFrom state to market and back : the changing role(s) of markets and states in the EUConclusion.European energy law under the impact of globalization : from state to market, from plan to contract, from public ownership to economic regulation and beyond..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 38
    Monograph available for loan
    Monograph available for loan
    La fin du rêve européen (2013)
    [Paris] : Stock
    Details Availability
    Call number: IASS 15.89527
    Type of Medium: Monograph available for loan
    Pages: 192 S , 22 cm
    ISBN: 9782234075337 (br) , 2234075335 (br)
    Series Statement: Les essais
    URL: Notice et cote du catalogue de la Bibliothèque nationale de France
    Language: French
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 39
    Monograph available for loan
    Monograph available for loan
    Plate tectonics : a very short introduction (2015)
    Oxford : Oxford University Press
    Details Availability
    Call number: M 16.89793
    Description / Table of Contents: Plate tectonics caused a revolution in our understanding of the Earth. It has aided our understanding of why earthquakes and volcanoes are found in distinct locations, how oceans form and disappear, and how mountain ranges were built. In this volume, Peter Molnar explores the history and significance of plate tectonics
    Description / Table of Contents: Plate tectonics caused a revolution in our understanding of the Earth. It has aided our understanding of why earthquakes and volcanoes are found in distinct locations, how oceans form and disappear, and how mountain ranges were built. In this volume, Peter Molnar explores the history and significance of plate tectonics. --
    Type of Medium: Monograph available for loan
    Pages: xvii, 136 p , Ill., maps , 18 cm
    Edition: 1st ed
    ISBN: 9780198728269 , 0198728263
    Series Statement: Very short introductions 425
    URL: Inhaltsverzeichnis
    URL: Autorenbiografie
    URL: Verlagsangaben
    URL: Inhaltsverzeichnis
    Language: English
    Note: 1. The basic idea -- 2. Seafloor spreading and magnetic anomalies -- 3. Fracture zones and transform faults -- 4. Subduction of oceanic lithosphere -- 5. Rigid plates of lithosphere -- 6. Tectonics of continents -- 7. From whence to whither?
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 40
    Monograph available for loan
    Monograph available for loan
    Arbeitsbuch Grundzüge der Volkswirtschaftslehre (2016)
    Stuttgart : Schäffer-Poeschel Verlag
    Details Availability
    Call number: PIK B 100-16-89869
    Type of Medium: Monograph available for loan
    Pages: VIII, 446 Seiten , Diagramme
    Edition: 5. überarbeitete und erweiterte Auflage
    ISBN: 3791035991 (kart.) , 9783791035994 (kart.) , 9783791035994
    URL: http://www.gbv.de/dms/weimar/toc/840853106_toc.pdf
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 41
    Monograph available for loan
    Monograph available for loan
    Globale Sammlungen für globalisierte Städte (2016)
    Berlin : Matthes & Seitz
    Details Availability
    Call number: IASS 16.89875
    Type of Medium: Monograph available for loan
    Pages: 58 Seiten , Illustrationen
    Edition: Erste Auflage
    ISBN: 9783957571380
    Series Statement: Fröhliche Wissenschaft 70
    URL: Inhaltstext
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 42
    Monograph available for loan
    Monograph available for loan
    Kann Demokratie Nachhaltigkeit? (2014)
    Wiesbaden : Springer VS
    Details
    Call number: IASS 16.90372 ; PIK D 022-19-89867
    Description / Table of Contents: Wir leben auf Kosten der Zukunft. Warum? Kurzfristige Interessen der Bürger (sichere Arbeit) ergänzen sich mit kurzfristigen Interessen der Politiker (Wiederwahl). Das politische System trägt Mitschuld. Wie kann man es ändern, um  diese Schwächen zu vermeiden? Lässt es sich demokratisch rechtfertigen, wenn Anwälte zukünftiger Generationen heute schon mitentscheiden? Diese Fragen werden  von Wissenschaftlern, Schriftstellern, Politikern und Unternehmern behandelt, um methodische Analyse, politischen und ökonomischen Sachverstand und kreative Ideen zu kombinieren. Das Buch enthält Beiträge von H. Geißler, H. J. Schellnhuber, I. Trojanow u.a. „Die Demokratie hat viele große Vorzüge und Stärken. Langfristigkeit und Nachhaltigkeit gehören bislang nicht dazu. Dem kann man institutionell abhelfen. Das Buch zeigt, wie.“ (Ernst Ulrich von Weizsäcker, MdB a.D.)   Der Inhalt ·         Problemanalyse und Überblick ·         Neue Institutionen: Zukunftsräte ·         Neue Institutionen: Ombudspersonen ·         Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten ·         Ombudspersonen in Unternehmen?   Die Zielgruppen   ·         PolitikwissenschaftlerInnen ·         PhilosophInnen ·         politisch interessierte Bürger     Der Herausgeber Prof. Dr. Bernward Gesang lehrt Philosophie an der Universität Mannheim
    Type of Medium: Monograph available for loan
    Pages: XII, 150 S.
    ISBN: 9783658048952 , 9783658048945
    DOI: 10.1007/978-3-658-04895-2
    Parallel Title: Print version: Kann Demokratie Nachhaltigkeit
    Language: German
    Note: Problemanalyse und ÜberblickNeue Institutionen: Zukunftsräte -- Neue Institutionen: Ombudspersonen -- Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten -- Ombudspersonen in Unternehmen?..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 43
    Monograph available for loan
    Monograph available for loan
    Sharing cities : a case for truly smart and sustainable cities (2015)
    Cambridge, Massachusetts ; London, England : The MIT Press
    Details Availability
    Call number: PIK N 531-16-89876
    Type of Medium: Monograph available for loan
    Pages: X, 445 Seiten
    ISBN: 9780262029728
    Series Statement: Urban and industrial environments
    Language: English
    Note: Contents: Introduction 1 1 Case Study: San Francisco ; Sharing Consumption: The City as Platform ; 2 Case Study: Seoul ; Sharing Production: The City as Collective Commons ; 3 Case Study: Copenhagen ; Sharing Politics: The City as Public Realm ; 4 Case Study: Medellín ; Sharing Society: Reclaiming the City ; 5 Case Study: Amsterdam ; The Sharing City: Understanding and Acting on the Sharing Paradigm ; 6 Case Study: Bengaluru ; Synthesis
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 44
    Monograph available for loan
    Monograph available for loan
    Deutschland - erneuerbare Energien entdecken : [mit Reiseatlas] (2011)
    Ostfildern : Baedeker
    Details Availability
    Call number: IASS 16.89880/1 ; IASS 16.89880/2
    Type of Medium: Monograph available for loan
    Pages: 192 S. , Ill., graph. Darst., Kt. , 19 cm
    Edition: 1. Aufl.
    ISBN: 9783829712903 , 3829712901
    Series Statement: Baedeker-Reiseführer
    URL: Inhaltsverzeichnis
    Language: German
    Branch Library: RIFS Library
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 45
    Monograph available for loan
    Monograph available for loan
    Rethinking private authority : agents and entrepreneurs in global environmental governance (2014)
    Princeton, NJ [u.a.] : Princeton Univ. Press
    Details Availability
    Call number: PIK D 020-15-0141
    Description / Table of Contents: "Rethinking Private Authority examines the role of non-state actors in global environmental politics, arguing that a fuller understanding of their role requires a new way of conceptualizing private authority. Jessica Green identifies two distinct forms of private authority--one in which states delegate authority to private actors, and another in which entrepreneurial actors generate their own rules, persuading others to adopt them.Drawing on a wealth of empirical evidence spanning a century of environmental rule making, Green shows how the delegation of authority to private actors has played a small but consistent role in multilateral environmental agreements over the past fifty years, largely in the area of treaty implementation. This contrasts with entrepreneurial authority, where most private environmental rules have been created in the past two decades. Green traces how this dynamic and fast-growing form of private authority is becoming increasingly common in areas ranging from organic food to green building practices to sustainable tourism. She persuasively argues that the configuration of state preferences and the existing institutional landscape are paramount to explaining why private authority emerges and assumes the form that it does. In-depth cases on climate change provide evidence for her arguments.Groundbreaking in scope, Rethinking Private Authority demonstrates that authority in world politics is diffused across multiple levels and diverse actors, and it offers a more complete picture of how private actors are helping to shape our response to today's most pressing environmental problems"--
    Description / Table of Contents: Rethinking Private Authority examines the role of non-state actors in global environmental politics, arguing that a fuller understanding of their role requires a new way of conceptualizing private authority. Jessica Green identifies two distinct forms of private authority--one in which states delegate authority to private actors, and another in which entrepreneurial actors generate their own rules, persuading others to adopt them.Drawing on a wealth of empirical evidence spanning a century of environmental rule making, Green shows how the delegation of authority to private actors has played a small but consistent role in multilateral environmental agreements over the past fifty years, largely in the area of treaty implementation. This contrasts with entrepreneurial authority, where most private environmental rules have been created in the past two decades. Green traces how this dynamic and fast-growing form of private authority is becoming increasingly common in areas ranging from organic food to green building practices to sustainable tourism. She persuasively argues that the configuration of state preferences and the existing institutional landscape are paramount to explaining why private authority emerges and assumes the form that it does. In-depth cases on climate change provide evidence for her arguments.Groundbreaking in scope, Rethinking Private Authority demonstrates that authority in world politics is diffused across multiple levels and diverse actors, and it offers a more complete picture of how private actors are helping to shape our response to today's most pressing environmental problems.
    Type of Medium: Monograph available for loan
    Pages: XII, 215 S. , graph. Darst.
    ISBN: 9780691157580 (hardback) , 9780691157597 (paperback)
    URL: http://www.gbv.de/dms/zbw/757505562.pdf
    Language: English
    Note: A theory of private authorityAgents of the state : a century of delegation in international environmental lawGovernors of the market : the evolution of entrepreneurial authorityAtmospheric police : delegated authority in the clean development mechanismAtmospheric accountants : entrepreneurial authority and the greenhouse gas protocol..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 46
    Monograph available for loan
    Monograph available for loan
    Schlusskonferenz : Geschichte und Zukunft der Klimadiplomatie (2015)
    München : oekom Verl.
    Details Availability
    Call number: PIK N 071-15-89065
    Type of Medium: Monograph available for loan
    Pages: 203 S.
    ISBN: 3865817467 , 9783865817464
    URL: Inhaltstext
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 47
    Monograph available for loan
    Monograph available for loan
    Pakt für Forschung und Innovation : Monitoring-Berich 2015 (2015)
    Bonn : GWK
    Associated volumes
    Details Availability
    Call number: M 15.89066
    In: Materialien der GWK
    Type of Medium: Monograph available for loan
    Pages: Getr. Zählung , Ill., graph. Darst., Kt.
    ISBN: 9783942342308
    Series Statement: Materialien der GWK 42
    URL: http://www.gwk-bonn.de/fileadmin/Papers/GWK-Heft-42-PFI-Monitoring-Bericht-2015.pdf
    Language: German
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 48
    Monograph available for loan
    Monograph available for loan
    Grundriss der Wirtschaftsethik : von der Stammesmoral zur Ethik der Globalisierung (2010)
    Stuttgart : Kohlhammer
    Details
    Call number: PIK B 050-15-0138
    Description / Table of Contents: Wirtschaftsethik ist im Zeitalter der Globalisierung zu einem zentralen Diskussionsthema geworden. Für dieses Lehrbuch wurde nun erstmals kein systematisch-analytischer Ansatz, sondern ein historisch-genetischer Zugang zur Wirtschaftsethik gewählt. Durch die Herausarbeitung der vielfältigen und komplexen historischen Wandlungsprozesse werden pointierend Leitbilder bzw. Paradigmen der Wirtschaftsethik vorgestellt, die über den Lauf der Geschichte das Denken und Handeln geprägt haben. Ausgehend von der Entwicklung der Horden- und Stammesmoral bis hin zur Globalisierung der letzten Jahrzehnte wird ein historischer Streifzug unternommen, bei dem der Verfasser sieben wohlunterscheidbare Paradigmen herausarbeiten kann. Die Darstellung ist ein wissenschaftlich fundierter Grundriss zu einem komplexen Themenfeld an der Schnittstelle von Ökonomik, Geschichte, Theologie und Philosophie, der bewusst interdisziplinär angelegt ist, aber aufgrund seiner verständlichen Sprache sowohl für Fachleute der verschiedenen Disziplinen als auch für akademisch Vorgebildete einen Zugang zur Geschichte der Wirtschaftsethik bietet. Prof. Dr. Bernd Noll lehrt Volkswirtschaftslehre und Wirtschaftsethik an der Hochschule Pforzheim.
    Type of Medium: Monograph available for loan
    Pages: 459 S.
    ISBN: 3170200259 , 9783170200258
    URL: Inhaltsverzeichnis
    Language: German
    Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 49
    Monograph available for loan
    Monograph available for loan
    Lee Kuan Yew : the grand master's insights on China, the United States, and the world (2012)
    Cambridge [u.a.] : MIT Press
    Details Availability
    Call number: PIK D 025-16-89988
    Type of Medium: Monograph available for loan
    Pages: XXVIII, 186 Seiten , 21 cm
    ISBN: 9780262019125 (hardcover)
    Series Statement: Belfer center studies in international security
    Uniform Title: Interviews. Selections
    URL: Inhaltsbeschreibung & Leseprobe
    URL: http://www.gbv.de/dms/sub-hamburg/727346040.pdf
    Language: English
    Note: The future of China -- The future of the United States -- The future of U.S.-China relations -- The future of India -- The future of Islamic extremism -- The future of national economic growth -- The future of geopolitics and globalization -- The future of democracy -- How Lee Kuan Yew thinks -- Conclusion..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 50
    Monograph available for loan
    Monograph available for loan
    Encyclopedia of global environmental governance and politics (2015)
    Cheltenham, UK : Edward Elgar
    Details
    Call number: PIK N 071-16-89990
    Description / Table of Contents: Cover -- Copyright -- Contents -- Alphabetical list of entries -- Figures and tables -- Editors and contributors -- Preface -- Part I Concepts and Definitions -- 1 Anthropocene and planetary boundaries -- 2 Consumerism -- 3 Earth system governance -- 4 Environment and nature -- 5 Global environmental governance -- 6 Inclusive development -- 7 Liberal environmentalism and governance norms -- 8 Risk -- 9 Sustainable development -- Part II Theories and Methods -- 10 Constructivism and sociological institutionalism -- 11 Cost-benefit analysis -- 12 Deep ecology -- 13 Deliberative policy analysis
    Description / Table of Contents: 14 Feminism -- 15 Governmentality -- 16 Integrated assessment modeling -- 17 Neo-Gramscianism -- 18 Neoliberal institutionalism -- 19 Qualitative comparative analysis -- 20 Quantitative comparative analysis -- 21 Simulations -- 22 Teaching global environmental governance -- 23 World society -- Part III Actors -- 24 Civil society -- 25 European Union -- 26 Individuals -- 27 International bureaucracies -- 28 Media -- 29 Private sector -- 30 Religious movements -- 31 Scientists and experts -- 32 States -- 33 United Nations -- Part IV Institutions -- 34 Clubs -- 35 International organizations
    Description / Table of Contents: 36 Mega-conferences -- 37 Private environmental governance -- 38 Public-private partnerships -- 39 Regimes -- Part V Issue Areas -- 40 Air pollution -- 41 Arctic -- 42 Biological diversity -- 43 Biosafety and genetically modified organisms -- 44 Chemicals -- 45 Climate change -- 46 Desertification -- 47 Fisheries and whaling -- 48 Forestry -- 49 Hazardous waste -- 50 Ocean space -- 51 Ozone depletion -- 52 Phosphorus -- 53 Renewable energy -- 54 Water -- 55 Wetlands -- Part VI Cross-Cutting Questions and Emerging Topics -- 56 Effectiveness -- 57 Environmental policy diffusion
    Description / Table of Contents: 58 Environmental policy integration -- 59 Green economy -- 60 Institutional fragmentation -- 61 Millennium Development Goals and Sustainable Development Goals -- 62 Orchestration -- Part VII Borders and Interlinkages -- 63 Agriculture -- 64 Food -- 65 Health -- 66 Poverty -- 67 Security -- 68 Trade -- Index
    Description / Table of Contents: Providing its readers with a unique point of reference, as well as stimulus for further research, the Encyclopedia of Global Environmental Governance and Politics is an indispensable tool for anyone interested in the governance and politics of the environment, particularly students, researchers and practitioners. This comprehensive reference work, written by some of the most eminent academics in the field, contains entries on numerous aspects of global environmental governance and politics, including concepts and definitions; theories and methods; actors; institutions; issue-areas; cross-cutt
    Type of Medium: Monograph available for loan
    Pages: XXXI, 563 S. , Diagramme
    ISBN: 9781782545781 , 9781782545798 (print) , 1782545786 (print)
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 51
    Monograph available for loan
    Monograph available for loan
    Intergovernmental fiscal transfers, forest conservation and climate change (2016)
    Cheltenham : Edward Elgar Publishing
    Details Availability
    Call number: PIK B 160-16-89992
    Type of Medium: Monograph available for loan
    Pages: IX, 195 Seiten , Illustrationen
    ISBN: 1784716596 , 9781784716592 , 9781784716608 (electronic)
    URL: http://www.gbv.de/dms/zbw/846590018.pdf
    Language: English
    Note: Contents: 1. Introduction 2. Theories of Decentralised Forest Management and Fiscal Decentralisation 3. The Cases of Riau and Papua Provinces 4. Factors Affecting Local Forest Governance 5. Intergovernmental Fiscal Transfers and Indonesia's Experience 6. The Design of REDD+ and Decentralised Forest Management 7. Incentive Structures Influencing Subnational Governments’ Decisions on Land-use Change 8. The Distribution Formulae of IFTs for REDD+ 9. Conclusion Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 52
    Monograph available for loan
    Monograph available for loan
    Linking eu climate and energy policies : decision-making, implementation and reform (2016)
    Northampton, MA : Elgar
    Details Availability
    Call number: PIK N 071-16-89993
    Type of Medium: Monograph available for loan
    Pages: XI, 265 Seiten
    ISBN: 9781785361272 (hardback)
    Series Statement: New horizons in environmental politics
    Language: English
    Note: Contents: 1. Introduction 2. Analytical Framework 3. Evolution of EU Climate and Energy Policies 4. Initiating the Package for 2020 5. Deciding the Package for 2020 6. Implementation in Germany 7. Implementation in Poland 8. Implementation in the Netherlands 9. Implementation in Norway 10. Comparative Analysis and Consequences for EU 2030 11. Conclusions and the Road Ahead. Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 53
    Monograph available for loan
    Monograph available for loan
    Symbolschlüssel Geologie; 2: Glossar (2015)
    Hannover : Landesamt für Bergbau, Energie und Geologie (LBEG)
    Associated volumes
    Details Availability
    Call number: 9/M 16.89924
    Type of Medium: Monograph available for loan
    Pages: Seite 355-535
    Edition: 4., völlig neu bearbeitete und erweiterte Auflage
    URL: Inhaltsverzeichnis
    Language: German
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 54
    Monograph available for loan
    Monograph available for loan
    Handbook of water economics (2015)
    Cheltenham [u.a.] : Elgar
    Details Availability
    Call number: PIK T 240-16-89996
    Type of Medium: Monograph available for loan
    Pages: XVII, 522 S. , Diagramme
    ISBN: 9781782549642 , 9781782549666 (electronic)
    URL: http://www.gbv.de/dms/zbw/822195127.pdf
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 55
    Monograph available for loan
    Monograph available for loan
    Justice for future generations : climate change and international law (2014)
    Cheltenham, UK : Edward Elgar
    Details Availability
    Call number: PIK N 073-16-89994
    Type of Medium: Monograph available for loan
    Pages: XXIII, 227 Seiten , 25 cm
    ISBN: 9780857934154 (hbk.) , 0857934155 (hbk.)
    Language: English
    Note: Contents: 1. Introduction: The Climate Change Problem and Solutions Part 1: Theory 2. The Basis of an Obligation Towards Future Generations in Justice and Ethics in the Context of Climate Change 3. Content of Justice-based Obligations Towards Future Generations in the Context of Climate Change Part II: International Law and Politics 4. Current International Law, Intergenerational Justice and Climate Change 5. International Human Rights Law, Intergenerational Justice and Climate Change 6. Climate Change Discources and Intergenerational Justice Part III: The Way Forward and Conclusion 7. The Way Forward – Incorporating Intergenerational Justice Principles into International Climate Law 8. Conclusion Bibliography Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 56
    Monograph available for loan
    Monograph available for loan
    Energy, governance and sustainability (2016)
    Northampton, MA : Edward Elgar Publishing
    Details Availability
    Call number: PIK P 113-16-89997
    Type of Medium: Monograph available for loan
    Pages: XVII, 327 Seiten
    ISBN: 9781785368110 (hardback)
    Series Statement: The IUCN Academy of Environmental Law series
    Language: English
    Note: Contents: 1. Energy Governance — A Key Challenge in the Era of Globalization ; PART I FOUNDATIONS ; 2. Germany’s ‘Energiewende’: What Can Environmental Law Scholarship Learn From it? ; 3. Ten Good Practices in Environmental Constitutionalism that can Contribute to Sustainable Shale Gas Development ; 4. Human Rights versus Human Needs: Debating the Language for Universal Access to Modern Energy Services ; 5. Using Social Science Perspectives on Risk to Implement an Environmental Justice Analysis ; 6. Scaling Up Local Solutions: Creating an Enabling Legal Environment for the Deployment of Community-Based Renewable Microgrids ; 7. Innovative Financing for Renewable Energy ; PART II EXPERIENCES ; 8. Energy and Smart Cities — Perspectives from a City-State, Singapore ; 9. Judicial Perspectives on Renewable Energy and Climate Change Governance ; 10. A Reflection on Some Legal Aspects of Decision Control in the Energy Transition Process: A Comparison of France and Germany ; 11. Learning from Europe: Some Ideas for the Energy Improvement of the US Existing Building Stock ; 12. Sustainable Sewage PART III GOVERNANCE GAPS ; 13. Environmentally Displaced Persons in the Niger Delta: Challenges and Prospects ; 14. Agriculture, Energy and Development: An Uneasy Relationship ; Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 57
    Series available for loan
    Series available for loan
    Preprints of the DGMK-Conference "Synthesis Gas Chemistry" : October 7 - 9, 2015, Dresden, Germany ; (authors' manuscripts) (2015)
    Hamburg : DGMK
    Details Availability
    Call number: S 98.0095(2015-2)
    Type of Medium: Series available for loan
    Pages: IV, 300 S. , zahlr. Ill. u. graph. Darst.
    Edition: Als Ms. gedr.
    ISBN: 9783941721562
    Series Statement: DGMK Tagungsbericht 2015,2
    URL: http://www.dgmk.de/petrochemistry/abstracts_content23/abstracts_proceedings23.html
    Language: English
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 58
    Monograph available for loan
    Monograph available for loan
    Advances in lithium isotope geochemistry (2016)
    Cham : Springer International Publishing
    Details
    Call number: 10/M 16.89929
    Description / Table of Contents: This work summarizes the historical progression of the field of lithium (Li) isotope studies and provides a comprehensive yet succinct overview of the research applications toward which they have been directed. In synthesizing the historical and current research, the volume also suggests prospective future directions of study. Not even a full decade has passed since the publication of a broadly inclusive summary of Li isotope research around the globe (Tomascak, 2004). In this short time, the use of this isotope system in the investigation of geo- and cosmochemical questions has increased dramatically, due, in part, to the advent of new analytical technology at the end of the last millennium. Lithium, as a light element that forms low-charge, moderate-sized ions, manifests a number of chemical properties that make its stable isotope system useful in a wide array of geo- and cosmochemical research fields.  
    Type of Medium: Monograph available for loan
    Edition: Online edition Springer eBook Collection. Earth and Environmental Science
    ISBN: 9783319014302 , 9783319014296
    Series Statement: Advances in isotope geochemistry
    DOI: 10.1007/978-3-319-01430-2
    Classification:
    Geochemistry
    Language: English
    Note: Methodology of Lithium Analytical Chemistry and Isotopic MeasurementsCosmochemistry of Lithium -- Li Partitioning, Diffusion and Associated Isotopic Fractionation: Theoretical and Experimental Insights -- Lithium in the Deep Earth: Mantle and Crustal Systems -- The Surficial Realm: Low Temperature Geochemistry of Lithium..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 59
    Monograph available for loan
    Sea-level science : understanding tides, surges, tsunamis and mean sea-level changes (2014)
    Cambridge : Cambridge Univ. Press
    Details Availability
    Call number: 13/M 16.89930
    Description / Table of Contents: Understanding sea-level processes, such as ocean tides, storm surges, tsunamis, El Niño and rises caused by climate change, is key to planning effective coastal defence. Building on David Pugh's classic book Tides, Surges and Mean Sea-Level, this substantially expanded, full-colour book now incorporates major recent technological advances in the areas of satellite altimetry and other geodetic techniques (particularly GPS), tsunami science, measurement of mean sea level and analyses of extreme sea levels. The authors discuss how each surveying and measuring technique complements others in providing an understanding of present-day sea-level change and more reliable forecasts of future changes. Giving the how and the why of sea-level change on timescales from hours to centuries, this authoritative and exciting book is ideal for graduate students and researchers in oceanography, marine engineering, geodesy, marine geology, marine biology and climatology. It will also be of key interest to coastal engineers and governmental policy-makers.
    Type of Medium: Monograph available for loan
    Pages: XII, 395 S. , Ill., graph. Darst., Kt.
    Edition: 2nd ed.
    ISBN: 1107028191 , 9781107028197
    URL: http://www.gbv.de/dms/bowker/toc/9781107028197.pdf
    URL: Cover
    Language: English
    Note: 1. Introduction; 2. Observations and data reduction; 3. Tidal forces; 4. Tidal analysis and prediction; 5. Tidal dynamics; 6. Shallow water and coastal tides; 7. Storm surges, meteotsunamis and other meteorological effects on sea level; 8. Tsunamis; 9. Sea-level changes in space; 10. Mean sea-level changes in time; 11. Sea-level changes in time to do with the solid Earth; 12. Sea-level applications; 13. Sea level and life; Appendix A. The basic hydrostatic and hydrodynamic equations; Appendix B. Currents; Appendix C. High and low water times and heights; Appendix D. Theoretical tidal dynamics; Appendix E. Legal definitions in the coastal zone; Glossary; References; Index..
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 60
    Monograph available for loan
    Monograph available for loan
    Earth governance : trusteeship of the global commons (2015)
    Cheltenham [u.a.] : Edward Elgar
    Details Availability
    Call number: PIK N 071-16-90004
    Type of Medium: Monograph available for loan
    Pages: XI, 300 S.
    ISBN: 9781783477814 (hbk.) , 9781783477821 (electronic; ebook)
    Series Statement: New horizons in environmental and energy law
    URL: http://www.gbv.de/dms/spk/sbb/toc/823233871.pdf
    Language: English
    Note: Contents: 1. World at a Tipping Point 2. Framing Earth Governance 3. Commons 4. The Global Commons 5. Trusteeship 6. State as Environmental Trustee 7. Trusteeship and the United Nations 8. Institutionalizing Trusteeship for the Global Commons Conclusion: There is Another Way Bibliography Index
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 61
    Monograph available for loan
    Monograph available for loan
    Erdbeben als Vehikel religiöser Ermahnung : zu drei schwäbischen Predigten im Jahr 1601 (2015)
    Details Availability
    Call number: M 15.89581
    In: Geschichte(n) des Wissens : Festschrift für Wolfgang E. J. Weber zum 65. Geburtstag, (2015), p. 413 - 430
    Type of Medium: Monograph available for loan
    Pages: Ill.
    Classification:
    Seismology
    Language: German
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 62
    Monograph available for loan
    Monograph available for loan
    Tsunamis in the European-Mediterranean Region (2015)
    London : Elsevier Science
    Details Availability
    Call number: 8/M 16.89584
    Description / Table of Contents: Tsunamis in the European-Mediterranean Region: From Historical Record to Risk Mitigation provides readers with a much needed, reliable, and up-to-date history of the region, including descriptions and parameters of the main events from pre-history to the present that are supported by parametric catalogues, pictorial material, and examples of instrumental records, such as tide-gauge records. The book presents a broader perspective of needed action for local and national governments, and international organizations, and is written by an internationally recognized expert in this field, providing an authoritative account of historical tsunamis in the eastern Mediterranean. It addresses key points of tsunami mitigation, including the systems currently available for tsunami recording, monitoring, and early warning, along with a presentation of the preventative measures that can be applied in all tsunami-vulnerable regions. Details the systems currently available for tsunami recording, monitoring, and early warning, and the technologies that support them. Contains numerical modeling techniques used for the generation, propagation, and inundation of tsunamis. Presents clear examples of tsunamis in the region and their documentation, as well as comparisons with other regions globally
    Type of Medium: Monograph available for loan
    Pages: 290 S.
    ISBN: 9780124202245
    Classification:
    Natural Disasters, Disaster Management
    Language: English
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 63
    Monograph available for loan
    Monograph available for loan
    Industry 4.0, urban development and german international development cooperation (2015)
    Utz : München
    Details Availability
    Call number: M 16.89596
    Type of Medium: Monograph available for loan
    Pages: 47 S. , Ill., graph. Darst., Kt.
    ISBN: 9783831644957
    Series Statement: acatech Position paper
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 64
    Monograph available for loan
    Monograph available for loan
    2016 (2014)
    Bonn : Festland Verl.
    Associated volumes
    Details Availability
    Call number: PIK A 010-06-0379 (2016)
    In: Taschenbuch des öffentlichen Lebens
    Type of Medium: Monograph available for loan
    Pages: XVIII, 1822 S.
    Edition: 65. Jg., Stand: 13. November 2015
    ISBN: 9783872241405
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 65
    Monograph available for loan
    Monograph available for loan
    Vergaberecht : Vergabe- und Vertragsordnung für Bauleistungen Teil A und B - VOB, Vergabe- und Vertragsordnung für Leistungen Teil A und B - VOL, Vergabeordnung für freiberufliche Dienstleistungen - VOF ; Textausgabe (2015)
    München : Dt. Taschenbuch-Verl. [u.a.]
    Details Availability
    Call number: IASS 16.90078
    Description / Table of Contents: Vergabe- und Vertragsordnung für Bauleistungen VOB Teil A und B, Vergabe- und Vertragsordnung Leistungen VOL Teil A und B, Vergabeordnung für freiberufliche Dienstleistungen - VOFTextausgabe mit Sachverzeichnis und einer Einführung von Dr. Ute Jasper und Dr. Fridhelm Marx. Inhalt:VOB Vergabe- und Vertragsordnung für Bauleistungen Teil A und B, Ausgabe 2012, VOL Vergabe und Vertragsordnung für Leistungen Teil A und B (Ausgabe 2009), VOF Vergabeordnung für freiberufliche Dienstleistungen, Ausgabe 2009, GWB Gesetz gegen Wettbewerbsbeschränkungen Ausz5250849
    Type of Medium: Monograph available for loan
    Pages: L, 535 S.
    Edition: Sonderausg., 17. Aufl., Stand: 1. November 2014
    ISBN: 9783423055956 (dtv) , 9783406674969
    Series Statement: dtv 5595
    URL: -Q-GBV
    URL: Inhaltsverzeichnis
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 66
    Monograph available for loan
    Monograph available for loan
    Climate, fire and human evolution : the deep time dimensions of the Anthropocene (2015)
    Cham [u.a.] : Springer
    Details
    Call number: PIK N 076-16-89604
    Description / Table of Contents: The book outlines principal milestones in the evolution of the atmosphere, oceans and biosphere during the last 4 million years in relation with the evolution from primates to the genus Homo - which uniquely mastered the ignition and transfer of fire. The advent of land plants since about 420 million years ago ensued in flammable carbon-rich biosphere interfaced with an oxygen-rich atmosphere. Born on a flammable Earth surface, under increasingly unstable climates descending from the warmer Pliocene into the deepest ice ages of the Pleistocene, human survival depended on both-biological adaptations and cultural evolution, mastering fire as a necessity. This allowed the genus to increase entropy in nature by orders of magnitude. Gathered around camp fires during long nights for hundreds of thousandth of years, captivated by the flickering life-like dance of the flames, humans developed imagination, insights, cravings, fears, premonitions of death and thereby aspiration for immortality, omniscience, omnipotence and the concept of god. Inherent in pantheism was the reverence of the Earth, its rocks and its living creatures, contrasted by the subsequent rise of monotheistic sky-god creeds which regard Earth as but a corridor to heaven. Once the climate stabilized in the early Holocene, since about -7000 years-ago production of excess food by Neolithic civilization along the Great River Valleys has allowed human imagination and dreams to express themselves through the construction of monuments to immortality. Further to burning large part of the forests, the discovery of combustion and exhumation of carbon from the Earth's hundreds of millions of years-old fossil biospheres set the stage for an anthropogenic oxidation event, affecting an abrupt shift in state of the atmosphere-ocean-cryosphere system. The consequent ongoing extinction equals the past five great mass extinctions of species-constituting a geological event horizon in the history of planet Earth. Dr Andrew Glikson is an Earth and Paleo-climate Scientist, Visiting Fellow at the Australian National University, Research School of Earth Science, the School of Archaeology and Anthropology, and the Planetary Science Institute, and a member of the ANU Climate Change Institute.
    Type of Medium: Monograph available for loan
    Pages: XVII, 227 S. , Ill., graph. Darst.
    ISBN: 9783319225111
    Series Statement: Modern approaches in solid earth sciences 10
    URL: http://www.ciando.com/pictures/bib/331922512Xbib_t_1_58864.jpg
    Language: English
    Note: Foreword; Prologue; Acknowledgements; Contents; Chapter 1: Early Earth Systems; 1.1 Archaean and Proterozoic Atmospheres; 1.2 Early Biospheres; 1.3 Greenhouse States and Glaciations; Chapter 2: Phanerozoic Life and Mass Extinctions of Species; 2.1 Acraman Impact and Acritarchs Radiation; 2.2 Cambrian and Late Ordovician Mass Extinction; 2.3 Late and End-Devonian Mass Extinctions; 2.4 Late Permian and Permian-Triassic Mass Extinctions; 2.5 End-Triassic Mass Extinction; 2.6 Jurassic-Cretaceous Extinction; 2.7 K-T (Cretaceous-Tertiary Boundary) Mass Extinction; 2.8 Paleocene-Eocene Extinction. , 2.9 The End-Eocene FreezeChapter 3: Cenozoic Biological Evolution (by Colin Groves); 3.1 The Evolution of Mammals; 3.2 From Primates to Humans; 3.3 From Genetic Evolution to Cultural Evolution; Chapter 4: Fire and the Biosphere; 4.1 An Incendiary Biosphere; 4.2 The Deep-Time History of Fire; 4.3 Fire and Pre-historic Human Evolution; 4.4 Neolithic Burning and Early Civilizations; Chapter 5: The Anthropocene; 5.1 The Modern Atmosphere; 5.2 Neolithic Burning and Early Global Warming; 5.3 The Great Carbon Oxidation Event; 5.4 The Sixth Mass Extinction of Species; 5.5 The Faustian Bargain. , 5.6 The Post-anthropocene WorldChapter 6: Rare Earth; Chapter 7: Prometheus: An Epilogue; References; About the Book and the Authors; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 67
    Monograph available for loan
    Monograph available for loan
    Wörterbuch Hochschule : Deutsch-Englisch : Englisch-Deutsch (2015)
    Bonn : Deutscher Hochschulverband
    Details Availability
    Call number: M 16.89614 ; M 16.89614 (2. Ex.)
    Type of Medium: Monograph available for loan
    Pages: 475 Seiten , 19 cm
    Edition: 1. Auflage
    Edition: Zweite unveränderte Auflage 2016
    ISBN: 9783944941028
    URL: Inhaltstext
    Language: German , English
    Location: Upper compact magazine
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 68
    Series available for loan
    Series available for loan
    Mainzer naturwissenschaftliches Archiv; Bd. 52 (2014)
    Associated volumes
    Details Availability
    Call number: S 94.0081(52)
    In: Mainzer naturwissenschaftliches Archiv
    Type of Medium: Series available for loan
    Pages: 212 S. : farb. Ill., graph. Darst.
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 69
    Monograph available for loan
    Monograph available for loan
    Frühe Öffentlichkeitsbeteiligung bei Industrie- und Infrastrukturprojekten (2015)
    Berlin [u.a.] : Beuth
    Associated volumes
    Details Availability
    Call number: PIK N 071-16-89621
    In: VDI-Richtlinien
    Type of Medium: Monograph available for loan
    Pages: 103 S. , graph Darst.
    Edition: Januar 2015
    Series Statement: VDI-Richtlinien 7000
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 70
    Monograph available for loan
    Monograph available for loan
    Wörterbuch Klimadebatte (2016)
    Bielefeld : transcript
    Details Availability
    Call number: PIK N 071-16-89624 ; IASS 16.89624
    Type of Medium: Monograph available for loan
    Pages: 326 S. , 23 cm
    ISBN: 3837632385 (Pb.) , 9783837632385 (Pb.) , 9783839432389
    Series Statement: Edition Kulturwissenschaft 82
    URL: Inhaltstext
    Parallel Title: -Ausgabe
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 71
    Monograph available for loan
    Monograph available for loan
    Warnsignal Klima: Das Eis der Erde : wissenschaftliche Fakten (2015)
    Hamburg : Wissenschaftliche Auswertungen
    Details Availability
    Call number: PIK N 454-16-89625
    Type of Medium: Monograph available for loan
    Pages: 299 Seiten , Ill., graph. Darst., Kt.
    Series Statement: Warnsignale
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 72
    Monograph available for loan
    Monograph available for loan
    Architektur der Stadt (2016)
    Stuttgart : Krämer Verlag
    Details Availability
    Call number: PIK K 130-16-89631
    Type of Medium: Monograph available for loan
    Pages: 136 Seiten , 17 Illustrationen , 20 cm x 16 cm
    ISBN: 378281147X , 9783782811477
    URL: Inhaltsverzeichnis
    Language: German
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 73
    Monograph available for loan
    Monograph available for loan
    Energiewende - Quo vadis? : Beiträge zur Energieversorgung (2016)
    Wiesbaden : Springer Vieweg
    Details
    Call number: PIK P 113-16-89634
    Description / Table of Contents: Die Autoren dieses Buches diskutieren die ursprünglichen Ziele der Energiewende unter den derzeitigen Prämissen interdisziplinär. Sowohl technische Aspekte der elektrischen Energieversorgung und der Stromerzeugung aus fluktuierenden Quellen als auch gesellschaftliche Herausforderungen und ethische Fragen sind in den Beiträgen behandelt. Die Texte wollen helfen, im Spannungsfeld einer nachhaltigen Energieversorgung Perspektiven aufzuzeigen und in ein eigenes Ordnungssystem zu bringen. Die Konzeption geht auf den Workshop „Energiewende: Quo vadis?“ der Akademie der Wissenschaften in Hamburg zurück. Aus dem Inhalt Technische Optionen der Energieversorgung Elektrische Energieversorgung Wird konventionelle Energieerzeugung im nachhaltigen Energiekonzept noch benötigt? Stromerzeugung aus Wind und Sonne - Erzeugungscharakteristik und Aspekte einer Integration ins Versorgungssystem Gesellschaftliche Herausforderungen der Energieversorgung Ethische Fragen der Energieerzeugung Die deutsche Energiepolitik aus ökonomischer Perspektive Rechtliche Rahmenbestimmungen Die Zielgruppe Wissenschaftler und Dozenten in den Gebieten Technik und Gesellschaft Berater und Entscheider in Unternehmen, Genossenschaften und Politik Der Herausgeber Herr Univ.-Prof. Dr.-Ing. Franz Joos leitet das Fachgebiet Energietechnik an der H elmut-Schmidt-Universität in Hamburg und ist als Ordentliches Mitglied Sprecher der Arbeitsgruppe „Energie und Ressourcen“ der Akademie der Wissenschaften in Hamburg
    Type of Medium: Monograph available for loan
    Pages: IX, 140 S. , Ill., graph. Darst.
    ISBN: 9783658117986
    DOI: 10.1007/978-3-658-11799-3
    Language: German
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 74
    Unknown
    Aushangpflichtige Arbeitsgesetze im öffentlichen Dienst : Textausgabe (2015)
    Heidelberg [u.a.] : Rehm
    Details Availability
    Call number: 2016/4
    Pages: 290 S. , 21 cm
    Edition: 15. Aufl.
    ISBN: 9783807324241
    Location: Special location V1
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 75
    Monograph available for loan
    Monograph available for loan
    Legal regimes for environmental protection : governance for climate change and ocean resources (2015)
    Boston [u.a.] : Brill [u.a.]
    Details Availability
    Call number: IASS 16.89653
    Type of Medium: Monograph available for loan
    Pages: 351 S.
    ISBN: 9789004302822 (hardback) , 9789004302839 (ebook)
    URL: http://www.gbv.de/dms/bowker/toc/9789004302822.pdf
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 76
    Monograph available for loan
    Monograph available for loan
    Die Zukunft von Einfamilienhausgebieten aus den 1950er bis 1970er Jahren : Handlungsempfehlungen für eine nachhaltige Nutzung ; [ein Forschungsprojekt der Wüstenrot Stiftung] (2012)
    Ludwigsburg : Wüstenrot Stiftung
    Details Availability
    Call number: IASS 16.89651
    Description / Table of Contents: Ein- und Zweifamilienhäuser bilden vor allem in Westdeutschland einen großen und wichtigen Teil des Wohnungsbestandes. Insbesondere die Einfamilienhausgebiete der 1950er bis 1970er Jahre haben damals einen wesentlichen Beitrag zur quantitativen und qualitativen Verbesserung der Wohnsituation geleistet. In den kommenden Jahren stehen diese Bestände vor erheblichen Veränderungsprozessen.
    Type of Medium: Monograph available for loan
    Pages: 303 S. , zahlr. Ill., graph. Darst., Kt.
    ISBN: 9783933249791
    URL: Inhaltsverzeichnis
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 77
    Monograph available for loan
    Monograph available for loan
    2016 : and its companion the astronomical almanac online (2014)
    Washington, DC : US Government Printing Office
    Associated volumes
    Details Availability
    Call number: 20/S 91.0908(2016)
    In: The astronomical almanac
    Type of Medium: Monograph available for loan
    Pages: getr. Zähl.
    Location: Reading room
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 78
    Monograph available for loan
    Monograph available for loan
    Rising to the challenge : US innovation policy for the global economy (2012)
    Washington, DC : The National Academies Press
    Details Availability
    Call number: IASS 16.89655
    Type of Medium: Monograph available for loan
    Pages: XXIII, 573 S. , graph. Darst. , 23 cm
    ISBN: 9780309255516 (softcover)
    Series Statement: Comparative innovation policy
    URL: Inhaltsverzeichnis
    Language: English
    Note: Chapter 1: The innovation challenge: America's innovation challenges -- New trends in global innovation -- The pillars of U.S. innovative strength -- Responding to the innovation challenge -- Chapter 2: Sustaining leadership in innovation: Improving framework conditions, substantially increasing R&D funding, institutional support for applied research -- Strengthening manufacturing -- Providing early stage finance -- Developing twenty-first century universities -- Investing in modern S&T parks -- Growing innovation clusters -- Hunting for global talent, the way forward -- Chapter 3: Findings -- Chapter 4: Recommendations -- Chapter 5: The new global competitive environment: Emerging powers -- Newly industrialized economies -- Industrialized nation case studies -- Chapter 6: National support for emerging industries: Seminconductors -- The photovoltaic industry -- Advanced batteries -- Pharmaceuticals and biopharmaceuticals -- In closing -- Chapter 7: Clusters and regional initiatives: The innovation challenge, policies to foster innovation, regional innovation clusters -- Twenty-first century research and industry -- In closing..
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 79
    Monograph available for loan
    Monograph available for loan
    Geodesy : introduction to geodetic datum and geodetic systems (2014)
    Berlin : Springer
    Details
    Call number: 6/M 16.89656
    Description / Table of Contents: Geodetic datum (including coordinate datum, height datum, depth datum, gravimetry datum) and geodetic systems (including geodetic coordinate system, plane coordinate system, height system, gravimetry system) are the common foundations for every aspect of geomatics. This course book focuses on geodetic datum and geodetic systems, and describes the basic theories, techniques, methods of geodesy. The main themes include: the various techniques of geodetic data acquisition, geodetic datum and geodetic control networks, geoid and height systems, reference ellipsoid and geodetic coordinate systems, Gaussian projection and Gaussian plan coordinates and the establishment of geodetic coordinate systems. The framework of this book is based on several decades of lecture noted and the contents are developed systematically for a complete introduction to the geodetic foundations of geomatics.
    Description / Table of Contents: REVIEW: "The present work integrates both classical materials and modern developments in geodesy, it describes pure theoretical approaches and recent practical applications. The book can be used as a general textbook for undergraduates studying geomatics and survejing and mapping in higher education institutions. For technicians who are engaged in geomatic and surveying engineering, the book is strongly recommended as a basic and useful reference guide."
    Type of Medium: Monograph available for loan
    Pages: XXI, 401 S.
    ISBN: 9783642412455 , 9783642412448
    DOI: 10.1007/978-3-642-41245-5
    Classification:
    Geodesy
    Language: English
    Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 80
    Monograph available for loan
    Monograph available for loan
    IAG 150 Years : Proceedings of the 2013 IAG Scientific Assembly, Potsdam,Germany, 1-6 September, 2013 (2016)
    Cham : Springer International Publishing
    Associated volumes
    Details
    Call number: 6/M 16.90069 ; 6/M 16.90069/ 2. Ex. ; 6/M 16.90069/ 3. Ex.
    In: International Association of Geodesy Symposia, 143
    Description / Table of Contents: This proceedings contains a selection of peer-reviewed papers presented at the IAG Scientific Assembly, Postdam, Germany, 1-6 September, 2013. The scientific sessions were focussed on the definition, implementation and scientific applications of reference frames; gravity field determination and applications; the observation and assessment of earth hazards. It presents a collection of the contributions on the applications of earth rotations dynamics, on observation systems and services as well as on imaging and positioning techniques and its applications.
    Type of Medium: Monograph available for loan
    Pages: xiv, 798 S.
    ISBN: 9783319246031
    Series Statement: International Association of Geodesy Symposia 143
    Classification:
    Geodesy
    Language: English
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 81
    Series available for loan
    Series available for loan
    Aktivitäten des Fachbereichs Aufsuchung und Gewinnung 2016 (2016)
    Hamburg : DGMK, Deutsche Wissenschaftliche Gesellschaft für Edöl, Erdgas und Kohle e.V.
    Details Availability
    Call number: S 98.0095(2016, 1)
    Type of Medium: Series available for loan
    Pages: VII, 82 Seiten , Illustrationen, Diagramme
    ISBN: 9783941721647
    Series Statement: Tagungsbericht / DGMK, Deutsche Wissenschaftliche Gesellschaft für Erdöl, Erdgas und Kohle 2016-1
    URL: http://www.gbv.de/dms/tib-ub-hannover/860572587.pdf
    Language: German
    Note: Erscheint zusammen mit "Beiträge der DGMK/ÖGEW-Frühjahrstagung des Fachbereiches "Aufsuchung und Gewinnung" am 21. und 22. April 2016 in Celle" auf USB-Stick, enthält nur "Verzeichnis der Vorträge und Poster" der Tagung
    Location: Lower compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 82
    Monograph available for loan
    Monograph available for loan
    Modelling human behaviour in landscapes (2016)
    Cham : Springer
    Details Availability
    Call number: M 16.89836
    Type of Medium: Monograph available for loan
    ISBN: 9783319295367
    Series Statement: Quantitative archaeology and archaeological modelling
    URL: Contributor biographical information
    URL: Publisher description
    URL: Table of contents only
    Classification:
    Historical Geology
    Language: English
    Location: Upper compact magazine
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 83
    Monograph available for loan
    Monograph available for loan
    Auf dem Weg zur Professur : die Postdoc-Fibel 2016 (2016)
    Hamburg : academics.de, das Karriereportal für Wissenschaft & Forschung
    Details Availability
    Call number: PIK A 130-16-89844
    Type of Medium: Monograph available for loan
    Pages: 162 Seiten , Illustrationen
    Edition: 1. Auflage
    ISBN: 9783981701524
    URL: https://www.academics.de/postdocfibel
    URL: Inhaltsverzeichnis
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 84
    Monograph available for loan
    Monograph available for loan
    Governance, natural resources, and post-conflict peacebuilding (2010)
    London : Earthscan
    Details Availability
    Call number: IASS 16.90356
    Type of Medium: Monograph available for loan
    Pages: xviii, 1140 Seiten , Illustrationen
    ISBN: 9781849712354
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 85
    Monograph available for loan
    Monograph available for loan
    The perception of the environment : essays on livelihood, dwelling and skill (2011)
    London [u.a.] : Routledge
    Details Availability
    Call number: IASS 16.90357
    Keywords: Sozialanthropologie ; Ethnologie ; Humanökologie ; Ökologische Psychologie ; Umweltwahrnehmung ; Entwicklungsbiologie ; Soziale Evolution ; Humanökologie ; Umweltwahrnehmung ; Umweltveränderung ; Technologie
    Type of Medium: Monograph available for loan
    Pages: XIX, 465 S. , Ill., graph. Darst. , 25 cm
    Edition: reissued with a new preface
    ISBN: 9780415617475 , 9780415228312
    URL: Inhaltsverzeichnis
    URL: Klappentext
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 86
    Monograph available for loan
    Monograph available for loan
    Earthquake time bombs (2015)
    Cambridge : Cambridge University Press
    Details Availability
    Call number: M 16.89854
    Description / Table of Contents: In a media interview in January 2010, scientist Robert Yeats sounded the alarm on Port-au-Prince, Haiti, as an 'earthquake time bomb', a region at critical risk of major seismic activity. One week later, a catastrophic earthquake struck the city, leaving over 100,000 dead and triggering a humanitarian crisis. In this timely study, Yeats sheds new light on other earthquake hotspots around the world and the communities at risk. He examines these seismic threats in the context of recent cultural history, including economic development, national politics and international conflicts. Descriptions of emerging seismic resilience plans from some cities provide a more hopeful picture. Essential reading for policy-makers, infrastructure and emergency planners, scientists, students and anyone living in the shadow of an earthquake, this book raises the alarm so that we can protect our vulnerable cities before it's too late. Draws comparisons between the capacity of first-world and developing-world countries to prepare for a major earthquake. Combines science with history to present a detailed, informative, and timely study of the world's earthquake time bombs. Explores how the combination of mass migration to megacities coupled with poor building standards is putting ever more people at risk
    Type of Medium: Monograph available for loan
    Pages: XV, 346 pages
    ISBN: 9781107085244 (hardback)
    Language: English
    Branch Library: GFZ Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 87
    Monograph available for loan
    Monograph available for loan
    Analysis and public policy : successes, failures and directions for reform (2016)
    Cheltenham, UK : Edward Elgar Publishing
    Details Availability
    Call number: IASS 16.90360
    Type of Medium: Monograph available for loan
    Pages: vi, 186 pages , 24 cm
    ISBN: 1784714755 , 9781784714758
    Series Statement: New horizons in public policy
    Language: English
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 88
    Monograph available for loan
    Monograph available for loan
    Climate change and insect pests (2015)
    Wallingford [u.a.] : CAB International
    Details Availability
    Call number: PIK N 076-16-89478
    Type of Medium: Monograph available for loan
    Pages: XII, 279 S. , Ill., graph. Darst.
    ISBN: 9781780643786 (hbk : alk. paper)
    Series Statement: CABI climate change series 7
    Language: English
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 89
    Monograph available for loan
    Monograph available for loan
    Neue Energielandschaften : neue Perspektiven der Landschaftsforschung (2013)
    Wiesbaden : Springer VS
    Details Availability
    Call number: PIK E 719-15-89468
    Description / Table of Contents: Der Wandel der Energiewirtschaft hin zu mehr Stromerzeugung aus erneuerbaren Energien spielt sich in physisch-materieller Hinsicht in Landschaften ab. Er wird von Praktikern der Raum- und Landschaftsplanung teils mit Skepsis und teils mit positiven Erwartungen begleitet. In dem Band wird den Fragen nachgegangen, welche Folgen die Energiewende auf die ästhetische Bewertung von Landschaften hat, welche neuen Akteurskonstellationen entstanden sind und welche Konflikte um das Landschaftsbild, die Landnutzung oder die Verteilung von Macht zu verzeichnen sind. Es werden die Konsequenzen der Umbrüche hin zu "neuen Energielandschaften" für die Landschaftsforschung, aber auch für räumliche Planung und Governance thematisiert.
    Type of Medium: Monograph available for loan
    Pages: 219 S. , Ill., graph. Darst., Kt. , 240 mm x 168 mm
    ISBN: 3531197940 (Pb.) , 9783531197944 (Pb.)
    Series Statement: RaumFragen: Stadt - Region - Landschaft
    URL: Inhaltstext
    URL: http://www.gbv.de/dms/weimar/toc/733754457_toc.pdf
    Language: German
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 90
    Monograph available for loan
    Monograph available for loan
    Agent-based modelling in economics (2016)
    Chichester : Wiley
    Details Availability
    Call number: PIK B 020-16-89479
    Type of Medium: Monograph available for loan
    Pages: VII, 246 S. , graph. Darst.
    ISBN: 9781118456071
    Language: English
    Note: Why agent-based modelling is useful for economists -- Starting agent-based modelling -- Heterogeneous demand -- Social demand -- Benefits of barter -- The market -- Labour market -- International trade -- Banking -- The tragedy of the commons.
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 91
    Monograph available for loan
    Monograph available for loan
    The Changing Landscape of Food Governance : Public and Private Encounters (2015)
    Cheltenham : Edward Elgar Publishing
    Details
    Call number: IASS 16.89899
    Description / Table of Contents: As markets become more globalized, they have also become governed by an increasingly complex array of public and private regulation. This volume investigates the changing landscape of food governance. In so doing, the contributions to his volume provide insights into broader analytical issues that have concerned regulatory governance scholars. These include the legitimacy and effectiveness of public and private regulation, the interaction of networks of regulation, regulatory responses to crisis and the distribution of power in regulatory arrangements
    Type of Medium: Monograph available for loan
    Pages: XVI, 271 S.
    ISBN: 978-1-78471-540-3
    Language: English
    Note: Cover; Copyright; Contents; Figures; Tables; Contributors; Abbreviations; PART I Introduction; 1. Changing regulatory arrangements in food governance; 2. Conceptualizing regulatory arrangements: Complex networks and regulatory roles; PART II Public policy responses to food safety challenges; 3. Regulation of food safety in the EU: Explaining organizational diversity among Member States; 4. Buying biosecurity: UK compensation for animal diseases; 5. Being well fed: Food safety regimes in China. , 6. The political economy of Chinese food safety regulation: Distributing adulterated milk powder in mainland China and TaiwanPART III New forms of private food governance; 7. Authority and legitimacy in governing global food chains; 8. The effectiveness of private food governance in fostering sustainable development; 9. Food quality through networks in the European wine industry; 10. Markets regulating markets: Competitive private regulation by halal certificates; PART IV How public and private regulation meet. , 11. Are we being served? The relationship between public and private food safety regulation12. Between public and private requirements: Challenges and opportunities for the export of tropical fruits from developing countries to the EU; 13. The meta-governance of co-regulation: Safeguarding the quality of Dutch eggs; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 92
    Monograph available for loan
    Monograph available for loan
    Novel methods for monitoring and managing land and water resources in Siberia (2016)
    Cham [u.a.] : Springer
    Details
    Call number: PIK N 454-16-89861
    Description / Table of Contents: This book presents an analysis of land and water resources in Siberia, initially characterizing the landscapes, their ecosystems, crucial processes, human impacts on soil and water quality, and the status quo of available research. Further chapters deal with modern monitoring and management methods that can lead to a significant knowledge shift and initiate sustainable soil and water resources use. These include soil hydrological laboratory measurement methods; process-based field evaluation methods for land and water quality; remote sensing and GIS technology-based landscape monitoring methods; process and ecosystem modeling approaches; methods of resource and process evaluation and functional soil mapping; and tools for controlling agricultural land use systems. More than 15 of these concrete monitoring and management tools can immediately be incorporated into research and practice. Maintaining the functions of great landscapes for future generations will be the reward for these efforts
    Type of Medium: Monograph available for loan
    Pages: XXIII, 760 Seiten , Ill., graph. Darst.
    ISBN: 9783319244099 , 9783319244075
    Series Statement: Springer water
    Language: English
    Note: Land and Water Resources of Siberia, their Functioning and Ecological StateStatus Report about Understanding, Monitoring and Controlling Landscape Processes in Siberia -- Methods for Monitoring the Chemical Composition of Lake Baikal Water -- Microbiological Monitoring of Lake Baikal -- Developing the Regional Indicator Indexes of Zooplankton for Water Quality Class Determination of Water Bodies in Siberia -- Measuring and Estimating Fluxes of Carbon, Major and Trace Elements to the Arctic Ocean -- Measuring Snowmelt in Siberia: Causes, Process and Consequences -- Estimation of Biomass and Net Primary Production (NPP) in West Siberian Boreal Ecosystems: In-Situ and Remote Sensing Methods -- GIS and Remote Sensing Data Based Methods for Monitoring Water and Soil Objects in the Steppe Biome of Western Siberia -- Significant Siberian Vegetation Change is Inevitably Brought on by the Changing Climate..
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 93
    Monograph available for loan
    Monograph available for loan
    Das Hohe Haus : ein Jahr im Parlament (2015)
    Frankfurt, M. : Fischer Taschenbuch
    Details Availability
    Call number: IASS 16.89491
    Type of Medium: Monograph available for loan
    Pages: 429 S. , 19 cm
    Edition: 2. Auflage : September 2015
    ISBN: 3596198100 , 9783596198108
    Series Statement: Fischer 19810
    URL: Inhaltstext
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 94
    Monograph available for loan
    Monograph available for loan
    Die Nutzung von Kleinen und Großen Anfragen durch die Oppositionsparteien im Deutschen Bundestag (2013)
    GRIN Verlagdiplom.de
    Details Availability
    Call number: IASS 16.89937
    Type of Medium: Monograph available for loan
    ISBN: 978-3-95636-919-3
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 95
    Monograph available for loan
    Monograph available for loan
    Graphs, networks and algorithms (2013)
    Berlin [u.a.] : Springer
    Details Availability
    Call number: PIK M 370-16-89506
    Type of Medium: Monograph available for loan
    Pages: XX, 675 S. , graph. Darst. , 25 cm
    Edition: 4th ed.
    ISBN: 3642322778 (Pp.) , 9783642322778 (Pp.) , 9783642322785
    Series Statement: Algorithms and computation in mathematics 5
    Uniform Title: Graphen, Netzwerke und Algorithmen 〈engl.〉
    URL: Inhaltsverzeichnis
    URL: Inhaltstext
    Language: English
    Note: 1. Basic graph theory2. Algorithms and complexity -- 3. Shortest paths -- 4. Spanning trees -- 5. The greedy algorithm -- 6. Flows -- 7. Combinatorial applications -- 8. Connectivity and depth first search -- 9. Colorings -- 10. Circulations -- 11. The network simplex algorithm -- 12. Synthesis of networks -- 13. Matchings -- 14. Weighted matchings -- 15. A hard problem: the TSP -- Appendix A. Some NP-complete problems -- Appendix B. Solutions -- Appendix C. List of symbols..
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 96
    Monograph available for loan
    Monograph available for loan
    Europäisches Patentübereinkommen : Kommentar (2016)
    Köln : Carl Heymanns Verlag
    Details Availability
    Call number: AWI S5-16-89899
    Type of Medium: Monograph available for loan
    Pages: XXVIII, 2336 Seiten
    Edition: 7. Auflage
    ISBN: 9783452285713 (Gb.)
    Series Statement: Heymanns Taschenkommentare
    URL: Inhaltsverzeichnis
    Language: German
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 97
    Monograph available for loan
    Monograph available for loan
    Digital signal processing and spectral analysis for scientists : concepts and applications (2016)
    Cham : Springer
    Details Availability
    Call number: AWI S1-16-89841
    Description / Table of Contents: This book covers the basics of processing and spectral analysis of monovariate discrete-time signals. The approach is practical, the aim being to acquaint the reader with the indications for and drawbacks of the various methods and to highlight possible misuses. The book is rich in original ideas, visualized in new and illuminating ways, and is structured so that parts can be skipped without loss of continuity. Many examples are included, based on synthetic data and real measurements from the fields of physics, biology, medicine, macroeconomics etc., and a complete set of MATLAB exercises requiring no previous experience of programming is provided. Prior advanced mathematical skills are not needed in order to understand the contents: a good command of basic mathematical analysis is sufficient. Where more advanced mathematical tools are necessary, they are included in an Appendix and presented in an easy-to-follow way. With this book, digital signal processing leaves the domain of engineering to address the needs of scientists and scholars in traditionally less quantitative disciplines, now facing increasing amounts of data.
    Type of Medium: Monograph available for loan
    Pages: xxiv, 900 Seiten , Illustrationen
    ISBN: 978-3-319-25466-1
    Series Statement: Signals and Communication Technology
    URL: http://scans.hebis.de/48/11/24/48112409_toc.pdf
    Language: English
    Note: Contents: 1 Introduction. - 1.1 Chapter Summary. - 1.2 The Meaning of the Book’s Title. - 1.3 Historical Background. - 1.4 How to Read This Book. - 1.5 Further Reading. - References. - PART 1 BASIC THEORETICAL CONCEPTS. - 2 Discrete-Time Signals and Systems. - 2.1 Chapter Summary. - 2.2 Basic Definitions and Concepts. - 2.3 Discrete-Time Signals: Sequences. - 2.3.1 Basic Sequence Operations. - 2.3.2 Basic Sequences. - 2.3.3 Deterministic and Random Signals. - 2.4 Linear Time-Invariant (LTI) Systems. - 2.4.1 Impulse Response of an LTI System and Linear Convolution. - 2.4.2 An Example of Linear Convolution. - 2.4.3 Interconnections of LTI Systems. - 2.4.4 Effects of Stability and Causality Constraints on the Impulse Response of an LTI System. - 2.4.5 Finite (FIR) and Infinite (IIR) Impulse Response Systems. - 2.4.6 Linear Constant-Coefficient Difference Equation (LCCDE). - 2.4.7 Examples of LCCDE. - 2.4.8 The Solutions of an LCCDE. - 2.4.9 From the LCCDE to the Impulse Response: Examples. - 2.4.10 Eigenvalues and Eigenfunctions of LTI Systems. - References. - 3 Transforms of Discrete-Time Signals. - 3.1 Chapter Summary. - 3.2 z-Transform. - 3.2.1 Examples of z-Transforms and Special Cases. - 3.2.2 Rational z-Transforms. - 3.2.3 Inverse z-Transform. - 3.2.4 The z-Transform on the Unit Circle. - 3.2.5 Selected z-Transform Properties. - 3.2.6 Transfer Function of an LTI System. - 3.2.7 Output Sequence of an LTI System. - 3.2.8 Zeros and Poles: Forms for Rational Transfer Functions. - 3.2.9 Inverse System. - 3.3 Discrete-Time Fourier Transform (DTFT). - 3.3.1 An Example of DTFT Converging in the Mean-Square Sense. - 3.3.2 Line Spectra. - 3.3.3 Inverse DTFT. - 3.3.4 Selected DTFT Properties. - 3.3.5 The DTFT of a Finite-Length Causal Sequence. - 3.4 Discrete Fourier Series (DFS). - 3.4.1 Selected DFS Properties. - 3.4.2 Sampling in the Frequency Domain and Aliasing in the Time Domain. - 3.5 Discrete Fourier Transform (DFT). - 3.5.1 The Inverse DFT in Terms of the Direct DFT. - 3.5.2 Zero Padding. - 3.5.3 Selected DFT Properties. - 3.5.4 Circular Convolution Versus Linear Convolution. - 3.6 Fast Fourier Transform (FFT). - 3.7 Discrete Trigonometric Expansion. - 3.8 Appendix: Mathematical Foundations of Signal Representation. - 3.8.1 Vector Spaces. - 3.8.2 Inner Product Spaces. - 3.8.3 Bases in Vector Spaces. - 3.8.4 Signal Representation by Orthogonal Bases. - 3.8.5 Signal Representation by Standard Bases. - 3.8.6 Frames and Biorthogonal Bases. - 3.8.7 Summary and Complements. - References. - 4 Sampling of Continuous-Time Signals. - 4.1 Chapter Summary. - 4.2 Sampling Theorem. - 4.3 Reconstruction of a Continuous-Time Signal from Its Samples. - 4.4 Aliasing in the Frequency Domain and Anti-Aliasing Filter. - 4.5 The Uncertainty Principle for the Analog Fourier Transform. - 4.6 Support of a Continuous-Time Signal in the Time and Frequency Domains. - 4.7 Appendix: Analog and Digital Frequency Variables. - References. - 5 Spectral Analysis of Deterministic Discrete-Time Signals. - 5.1 Chapter Summary. - 5.2 Issues in Practical Spectral Analysis. - 5.2.1 The Effect of Windowing. - 5.2.2 The Effect of Spectral Sampling. - 5.3 Classical Windows. - 5.4 The Kaiser Window. - 5.5 Energy and Power Signals and Their Spectral Representations. - 5.6 Correlation of Deterministic Discrete-Time Signals. - 5.6.1 Correlation of Energy Signals. - 5.6.2 Correlation of Power Signals. - 5.6.3 Effect of an LTI System on Correlation Properties of Input and Output Signals. - 5.7 Wiener-Khinchin Theorem. - 5.7.1 Energy Signals and Energy Spectrum. - 5.7.2 Power Signals and Power Spectrum. - References. - PART 2 DIGITAL FILTERS. - 6 Digital Filter Properties and Filtering Implementation. - 6.1 Chapter Summary. - 6.2 Frequency-Selective Filters. - 6.3 Real-Causal-Stable-Rational (RCSR) Filters. - 6.4 Amplitude Response. - 6.5 Phase Response. - 6.5.1 Phase Discontinuities and Zero-Phase Response. - 6.5.2 Linear Phase (LP). - 6.5.3 Generalized Linear Phase (GLP). - 6.5.4 Constraints on GLP Filters. - 6.6 Digital Filtering Implementation. - 6.6.1 Direct Forms. - 6.6.2 Transposed-Direct Forms. - 6.6.3 FIR Direct and Transposed-Direct Forms. - 6.6.4 Direct and Transposed-Direct Forms for LP FIR Filters. - 6.6.5 Cascade and Parallel Forms. - 6.7 Zero-Phase Filtering. - 6.8 An Incorrect Approach to Filtering. - 6.9 Filtering After Downsampling. - 6.9.1 Theory of Downsampling. - 6.9.2 An Example of Filtering After Downsampling. - References. - 7 FIR Filter Design. - 7.1 Chapter Summary. - 7.2 Design Process. - 7.3 Specifications of Digital Filters. - 7.3.1 Constraints on the Magnitude Response. - 7.3.2 Constraints on the Phase Response. - 7.4 Selection of Filter Type: IIR or FIR?. - 7.5 FIR-Filter Design Methods and Approximation Criteria. - 7.6 Properties of GLP FIR Filters. - 7.6.1 Factorization of the Zero-Phase Response. - 7.6.2 Zeros of the Transfer Function. - 7.6.3 Another Form of the Adjustable Term. - 7.7 Equiripple FIR Filter Approximations: Minimax Design. - 7.8 Predicting the Minimum Filter Order. - 7.9 MPR Algorithm. - 7.10 Properties of Equiripple FIR Filters. - 7.11 The Minimax Method for Bandpass Filters. - References. - 8 IIR Filter Design. - 8.1 Chapter Summary. - 8.2 Design Process. - 8.3 Lowpass Analog Filters. - 8.3.1 Laplace Transform. - 8.3.2 Transfer Function and Design Parameters. - 8.4 Butterworth Filters. - 8.5 Chebyshev Filters. - 8.5.1 Chebyshev-I Filters. - 8.5.2 Chebyshev-II Filters. - 8.6 Elliptic Filters. - 8.7 Normalized and Non-normalized Filters. - 8.8 Comparison Among the Four Analog Filter Types. - 8.9 From the Analog Lowpass Filter to the Digital One. - 8.9.1 Bilinear Transformation. - 8.9.2 Design Procedure. - 8.9.3 Examples. - 8.10 Frequency Transformations. - 8.10.1 From a Lowpass to a Highpass Filter. - 8.10.2 From a Lowpass to a Bandpass Filter. - 8.10.3 From a Lowpass to a Bandstop Filter . - 8.11 Direct Design of IIR Filters. - 8.12 Appendix. - 8.12.1 Trigonometric Functions with Complex Argument. - 8.12.2 Elliptic Integrals. - 8.12.3 Jacobi Elliptic Functions. - 8.12.4 Landen-Gauss Transformation. - 8.12.5 Elliptic Rational Function. - References. - PART 3 SPECTRAL ANALYSIS. - 9 Statistical Approach to Signal Analysis. - 9.1 Chapter Summary. - 9.2 Preliminary Considerations. - 9.3 Random Variables. - 9.4 Ensemble Averages. - 9.5 Stationary Random Processes and Signals. - 9.6 Ergodicity. - 9.7 Wiener-Khinchin Theorem for Random Signals and Power Spectrum. - 9.8 Cross-Power Spectrum of Two Random Signals. - 9.9 Effect of an LTI System on a Random Signal. - 9.10 Estimation of the Averages of Ergodic Stationary Signals. - 9.10.1 General Concepts in Estimation Theory. - 9.10.2 Mean and Variance Estimation. - 9.10.3 Autocovariance Estimation. - 9.10.4 Cross-Covariance Estimation. - 9.11 Appendix: A Road Map to the Analysis of a Data Record. - References. - 10 Non-Parametric Spectral Methods. - 10.1 Chapter Summary. - 10.2 Power Spectrum Estimation. - 10.3 Periodogram. - 10.3.1 Bias. - 10.3.2 Variance. - 10.3.3 Examples. - 10.3.4 Variance Reduction by Band- and Ensemble-Averaging. - 10.4 Bartlett’s Method. - 10.5 Modified Periodogram. - 10.6 Welch’s Method. - 10.7 Blackman-Tukey Method. - 10.8 Statistical Significance of Spectral Peaks. - 10.9 MultiTaper Method. - 10.10 Estimation of the Cross-Power Spectrum of Two Random Signals. - 10.11 Use of the FFT in Power Spectrum Estimation. - 10.12 Power Spectrum Normalization. - References. - 11 Parametric Spectral Methods. - 11.1 Chapter Summary. - 11.2 Signals with Rational Spectra . - 11.3 Stochastic Models and Processes. - 11.3.1 Autoregressive-Moving Average (ARMA) Model. - 11.3.2 Autoregressive (AR) Model. - 11.3.3 Moving Average (MA) Model. - 11.3.4 How the AR and MA Modeling Approaches Are Theoretically Related. - 11.3.5 First-Order AR and MA Models: White, Red and Blue Noise. - 11.3.6 Higher-Order AR Models. - 11.4 The AR Approach to Spectral Estimation. - 11.5 AR Modeling and Linear Prediction. - 11.6
    Location: AWI Reading room
    Branch Library: AWI Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 98
    Monograph available for loan
    Monograph available for loan
    Political opportunities for climate policy : California, New York, and the federal government (2016)
    New York, NY : Cambridge University Press
    Details Availability
    Call number: PIK N 071-16-89901
    Type of Medium: Monograph available for loan
    Pages: XVII, 344 Seiten , graph. Darst.
    ISBN: 9781107425545 (softcover)
    Language: English
    Note: Introduction and overview -- Climate policies in the United States -- Theories of climate policy -- The structural theory applied to the cases -- Causes of climate policies in the fifty states -- Air-pollution and energy policy making in California (the 1940s to the 1980s) -- Climate policy making in California (the 2000s to the present) -- Energy and climate policy making in New York State -- Energy and climate policy making by the federal government -- Conclusions : political opportunities for climate policy in the United States.
    Location: A 18 - must be ordered
    Branch Library: PIK Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
  • 99
    Monograph available for loan
    Monograph available for loan
    Routledge International Handbook of Social and Environmental Change (2013)
    Hoboken : Taylor and Francis
    Details
    Call number: IASS 16.90022
    Description / Table of Contents: Today, the risks associated with global environmental change and the dangers of extreme climatic and geological events remind us of humanity's dependence on favourable environmental conditions. Our relationships with the landscapes and ecologies that we are a part of, the plants and animals that we share them with, and the natural resources that we extract, lie at the heart of contemporary social and political debates. It is no longer possible to understand key social scientific concerns without at the same time also understanding contemporary patterns of ecosystem change.The Routledge Interna
    Type of Medium: Monograph available for loan
    Pages: xv, 338 Seiten
    ISBN: 9781138645332
    Series Statement: Routledge International Handbooks
    Language: English
    Note: Cover; Title Page; Copyright Page; Table of Contents; List of illustrations; Notes on contributors; Acknowledgements; 1 Socio-ecological transformations and the social sciences; PART I Challenges, contradictions and consequences of global socio-ecological change; 2 Ecological modernization theory: taking stock, moving forward; 3 The emergence of new world-systems perspectives on global environmental change; 4 China's economic growth and environmental protection: approaching a 'win-win' situation? A discussion of ecological modernization theory; 5 Eco-imperialism and environmental justice. , 6 Neoliberalism by design: changing modalities of market-based environmental governance7 Dilemmas for standardizers of sustainable consumption; PART II Climate change, energy and adaptation; 8 Climate, scenario-building and governance: comprehending the temporalities of social-ecological change; 9 From Rio to Copenhagen: multilateral agreements, disagreements and situated actions; 10 Marriage on the rocks: sociology's counsel for our struggling energy-society relationships; 11 Sustainability as social practice: new perspectives on the theory and policies of reducing energy consumption. , 12 Environmental migration: nature, society and population movementPART III Urban environmental change, governance and adaptation; 13 Climate change and urban governance: a new politics?; 14 Recovering the city level in the global environmental struggle: going beyond carbon trading; 15 Hybrid arrangements within the environmental state; 16 The new mobilities paradigm and sustainable transport: finding synergies and creating new methods; PART IV Risk, uncertainty and social learning; 17 Towards a socio-ecological foundation for environmental risk research. , 18 Uncertainty and claims of uncertainty as impediments to risk management19 Transboundary risk governance: co-constructing environmental issues and political solutions; 20 The role of professionals in managing technological hazards: the Montara blowout; 21 Social learning to cope with global environmental change and unsustainability; PART V (Re)assembling social-ecological systems; 22 The social-ecological co-constitution of nature through ecological restoration: experimentally coping with inevitable ignorance and surprise. , 23 Biological invasions as cause and consequence of 'our' changing world: social and environmental paradoxes24 Biological resources, knowledge and property; 25 Disassembling and reassembling socionatural networks: integrated natural resource management in the Great Bear Rainforest; 26 Land use tensions for the development of renewable sources of energy; Index.
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    E-BOOK
  • 100
    Monograph available for loan
    Monograph available for loan
    Verlustdemokratie : Die drei Verlustebenen der Demokratie (2016)
    Tübingen : Mohr Siebeck
    Details Availability
    Call number: IASS 16.90029
    Type of Medium: Monograph available for loan
    Pages: XII, 302 Seiten , 18.1 cm x 11.1 cm, 272 g
    ISBN: 3161546393 , 9783161546396
    URL: Inhaltstext
    Language: German
    Branch Library: RIFS Library
    Location Call Number Expected Availability
    BibTip Others were also interested in ...
    BOOK
    Link to Library Catalog
    get availability status
Close ⊗
This website uses cookies and the analysis tool Matomo. More information can be found here...