ALBERT

Note: Cover; Copyright; Praise; Introduction; Contents; Section 1: THINK IT; The First Thing to Do When You Find Yourself in a Hole: Stop Digging; Stay Positive; Never Lose Faith; Seven Career Lessons I Learned from Selling Ginsu Knives; A Turning Point; Stop. Breathe. Think. Then Act.; Overcoming Inertia; Overcoming Fear; Keep Swimming; Section 2: DO IT; What Is a Resume?; What Are Managers Looking For?; Dirty Little Resume Secrets; The T-Bomb; Current Experience; What You Do Is More Important than What You're Called; The Top Ten Mistakes Professionals Make When Looking for Work. , Resumes: A SummaryCover Your Letter; Following Up; Getting Interviews; Be Proactive; Be Visible; Social Networking; Four Critical Steps to Getting a Job Offer; Send Out Ships; Gold Calling; Section 3: HAVE IT; Creating the Path; Recession-Proof Your Career; Creating a PR Campaign; Taking the Initiative; Increase Your Ability to Find Work; Advancing Your Career through Personal Branding; Advancing Your Career through Progressive Information Disclosure; Honing Your Workplace Negotiation Skills; The Sky's the Limit; What Are You Waiting For?; About Making Money; Creating the Life You Want. , Recommended ReadingAbout the Author.

Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..

Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.

Note: Konstruktionsgrundlagen Toleranzen und Passungen -- Festigkeitsberechnung -- Tribologie -- Kleb- und Lötverbindungen -- Schweiß-, Niet- u. Schraubverbindungen -- Bolzen- und Stiftverbindungen -- Elastische Federn -- Achsen, Wellen, Zapfen -- Wellen/Nabenverbindungen -- Kupplungen -- Bremsen -- Wälz- und Gleitlager -- Riemen- und Kettengetriebe -- Rohrleitungen -- Dichtungen -- Zahnräder und Zahnradgetriebe -- Außenverzahnte Stirnräder, Kegelräder, Schraubrad- und Schneckengetriebe..

Note: I Einleitung und MotivationII CO2 Eigenschaften, Herkunft, Verwendung und Mengen -- III CO2-Abtrennung und -Speicherung -- IV CO2-Nutzung (CCR) -- V Multikriterielle Bewertung von CCS und CCR -- VI Szenarien -- VII CCS aktuell..

Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System

Note: IntroductionMain Assumptions of the Assignment Process -- Definition of Collapse -- Proposing a Range for Fatality Rates in a Collapsed Building -- Assignments of judgment-based fatality rates -- Conclusions. ..

Note: Master and use copy. Digital master created according to Benchmark for Faithful Digital Reproductions of Monographs and Serials, Version 1. Digital Library Federation, December 2002

Note: Berlin, Humboldt-Univ., Diss., 2011

Note: Preface; Contributors; Content; Introduction; Cosmology - The Largest Possible Model?; The Standard Model of Cosmology as a Tool for Interpretation and Discovery; Patterns in Physical and Biological Systems; Symmetry and the Explanation of Organismal Form; Pluralistic Modeling of Complex Systems; The Methodological Challenges of Complex Systems; Contested Modeling: The Case of Economics; A Unifying Approach to High- and Low-Level Cognition; High-vs Low-Level Cognition and the Neuro- Emulative Theory of Mental Representation. , Evaluating a Computational Model of Eye-Movement Control in ReadingConsidering Criteria for Model Modification and Theory Change in Psychology; Identification of Kinetic Models by Incremental Refinement; Kinetics, Models, and Mechanism; Modeling Complexity: The Case of Climate Science; Chaos, Plurality, and Model Metrics in Climate Science; Subject Index; Author Index.

Note: Nonlinear Mesoscopic Elasticity; Contents; Preface; Acknowledgements; 1 Introduction; 1.1 Systems; 1.2 Examples of Phenomena; 1.3 The Domain of Exploration; 1.4 Outline; References; 2 Microscopic/Macroscopic Formulation of the Traditional Theory of Linear and Nonlinear Elasticity; 2.1 Prefatory Remarks; 2.2 From Microscopic to Continuum; 2.2.1 A Microscopic Description; 2.2.2 Microscopic Description and Thermodynamics; 2.2.3 From Microscopic Model to Continuum Elasticity; 2.3 Continuum Elasticity and Macroscopic Phenomenology; 2.3.1 Displacement, Strain, and Stress. , 2.3.2 Dynamics of the Displacement Field2.3.3 Coupling Continuum Elasticity to Auxiliary Fields; 2.3.4 Inhomogeneous Elastic Systems; 2.4 Thermodynamics; 2.4.1 Thermodynamic Derivatives; 2.4.2 Series Expansion for ES; 2.4.3 Series Expansion for EZ; 2.4.4 Series Expansion for FT; 2.4.5 Assemble the Pieces; 2.5 Energy Scales; References; 3 Traditional Theory of Nonlinear Elasticity, Results; 3.1 Quasistatic Response; Linear and Nonlinear; 3.1.1 Quasistatic Response; Linear; 3.1.2 Quasistatic Response; Nonlinear; 3.2 Dynamic Response; Linear; 3.3 Quasistatic/Dynamic Response; Nonlinear. , 3.4 Dynamic Response Nonlinear; 3.4.1 Basic Equations; 3.4.2 Wave Propagation; 3.4.3 Resonant Bar; 3.5 Exotic Response; Nonlinear; 3.6 Green Functions; 3.6.1 Green Function, Free Space; 3.6.2 Green Function, Resonant Bar; References; 4 Mesoscopic Elastic Elements and Macroscopic Equations of State; 4.1 Background; 4.2 Elastic Elements; 4.2.1 Hertz-Mindlin Contacts; 4.2.2 Hysteretic Hertzian Contacts; 4.2.3 Hertzian Asperities; 4.2.4 Van der Waals Surfaces; 4.2.5 Other; 4.3 Effective Medium Theory; 4.4 Equations of State; Examples; 4.4.1 Hertzian Contacts; 4.4.2 Van der Waals Surfaces. , 4.4.3 Generalization and CaveatsReferences; 5 Auxiliary Fields; 5.1 Temperature; 5.2 Saturation; 5.2.1 Saturation/Strain Coupling; 5.2.2 Saturation/Strain Response; 5.3 The Conditioning Field, X; References; 6 Hysteretic Elastic Elements; 6.1 Finite Displacement Elastic Elements; Quasistatic Response; 6.1.1 Finite Displacement Elastic Elements: The Model; 6.1.2 Finite Displacement Elastic Element: Implementing the Model; 6.2 Finite Displacement Elastic Elements: Inversion; 6.3 Finite Displacement Elastic Elements: Dynamic Response; 6.3.1 Finite Displacement Elastic Element: Resonant Bar. , 6.3.2 Finite Displacement Elastic Element: Wave Mixing6.4 Models with Hysteresis; 6.5 Summary; 6.6 Models with Hysteresis, Detail; 6.6.1 Hertzian Contacts; 6.6.2 The Masing Rules; 6.6.3 The Endochronic Formalism; References; 7 The Dynamics of Elastic Systems; Fast and Slow; 7.1 Fast/Slow Linear Dynamics; 7.1.1 Quasistatic Response; 7.1.2 AC Response; 7.2 Fast Nonlinear Dynamics; 7.3 Auxiliary Fields and Slow Dynamics; 7.3.1 X = The Conditioning Field; 7.3.2 X = Temperature; 7.4 Summary; References; 8 Q and Issues of Data Modeling/Analysis; 8.1 Attenuation in Linear Elastic Systems. , 8.1.1 Wave Vector Dispersion.

Note: Enth. u.a.: Zur Bestimmung der Ausdehnung von Materialien am Abbe-Fizeauschen Dilatometer / von W. Bein

Note: ""Preface""; ""Acknowledgments""; ""Contents""; ""Chapter 1 Structure and Composition of the Lower and Middle Atmosphere""; ""Chapter 2 Radiative Processes in the Lower and Middle Atmosphere""; ""Chapter 3 Dynamics of the Troposphere and Stratosphere""; ""Chapter 4 Waves in the Troposphere and Stratosphere""; ""Chapter 5 Chemical Processes in the Stratosphere and Troposphere""; ""Chapter 6 Stratospheric Ozone Depletion and Antarctic Ozone Hole""; ""Chapter 7 Transport Processes in the Stratosphere and Troposphere""; ""Chapter 8 Stratosphere�Troposphere Exchange"". , ""Chapter 9 Stratospheric Influence on Tropospheric Weather and Climate""""Acronyms""; ""List of Symbols""; ""Table of Physical Constants""; ""Answers to Selected Problems""; ""Index"".

Note: Introduction -- Statistical Preliminaries -- Information Theory -- Transfer Entropy -- Information Transfer in Canonical Systems -- Information Transfer in Financial Markets -- Miscellaneous Applications of Transfer Entropy -- Concluding Remarks

Note: The Application of IR Spectroscopy to the Investigation of MineralsThe Discrete Approach -- The Full-Profile Analysis -- Polymerization of coordination polyhedra and structure topology -- Hydrogen-bearing groups and hydrogen bonding -- Solid-solution series -- Force parameters of cations in silicates -- IR spectra of minerals and reference samples data -- Borates, including sulfato-borates and arsenato-borates -- Carbides and carbonates -- Organic compounds and salts of organic acids -- Ammino-complexes, nitrates and sulfato-nitrates -- Oxides and hydroxides -- Fluorides -- Silicates -- Phosphates -- Sulfates, carbonato-sulfates, phosphato-sulfates and sulfides -- Chlorides -- Vanadates and vanadium oxides -- Chromates -- Arsenates, arsenites and sulfato-arsenates -- Selenites, molybdates, tellurites, tellurates, iodites, wolframates and wolfram oxides..

Note: IntroductionMethodology of Seismic Tomography -- Subduction Zone Tomography -- Large Earthquakes and Seismotectonics -- Hotspots and Mantle Plumes -- East Asia Structure and Tectonics -- Global Tomography and Deep Earth dynamics -- Seismic Tomography of the Moon..

Note: IntroductionSingle-particle motions -- Plasmas as fluids -- Waves in plasmas -- Diffusion and resistivity -- Equilibrium and stability -- Kinetic theory -- Nonlinear effects -- Special plasmas -- Plasma applications..

Note: German

Note: Zugl.: Regensburg, Univ., Diss., 2007

Note: German

Note: Cover -- Titel -- Impressum -- Inhaltsverzeichnis -- Nichts als Stress mit der Textverarbeitung -- Über dieses Buch -- Teil I: Gute Vorbereitung ist alles! -- Kapitel 1: Dokument vorbereiten und einrichten -- 1.1 Der Aufbau des Dokuments -- 1.1.1 Abschnitte und Umbrüche -- 1.1.2 Das Deckblatt -- 1.2 Seite einrichten -- 1.2.1 Satzspiegel nach Vorgaben einrichten -- 1.2.2 Satzspiegel frei gestalten -- 1.2.3 Satzspiegel anzeigen -- 1.2.4 Gültigkeit der Seiteneinstellungen -- 1.2.5 Seiteneinstellungen übertragen -- 1.3 Seiten rahmen -- 1.4 Ein- oder mehrspaltig? -- 1.4.1 Abstand oder Trennlinie? -- 1.4.2 Registerhaltigkeit -- 1.4.3 Spaltenaufteilung im Text wechseln -- 1.4.4 Ungleiche Spaltenbreiten -- 1.5 Außerhalb des Satzspiegels -- 1.5.1 Positionsrahmen und Textfelder -- 1.5.2 Seitenrand nutzen -- 1.5.3 Textfelder mit Überlauf -- 1.5.4 Textfelder drehen -- Kapitel 2: Dokument in Fließtext und Überschriften gliedern -- 2.1 Schriftart auswählen -- 2.1.1 Die Schrift für den Textkörper -- 2.1.2 Schrift mit Serifen oder ohne Serifen? -- 2.1.3 Die passende Schriftgröße -- 2.2 Formatvorlagen verwenden -- 2.2.1 Arbeit erleichtern mit Formatvorlagen -- 2.2.2 Einem Text eine Formatvorlage zuweisen -- 2.2.3 Formatvorlagen den Vorgaben anpassen -- 2.2.4 Neue Formatvorlagen aus manuell formatiertem Text erstellen -- 2.3 Überschriften verwenden -- 2.3.1 Was macht eine Überschrift aus? -- 2.3.2 Überschriften per Formatvorlage -- 2.3.3 Überschriften automatisch formatieren lassen -- 2.3.4 Handformatierte Überschriften nachträglich in Formatvorlagen-Überschriften umwandeln -- 2.4 Nummerierte Überschriften -- 2.4.1 Lineare Nummerierungen -- 2.4.2 Hierarchische Überschriften mit Gruppenwechsel -- 2.4.3 Separate Überschriften-Nummerierung für den Nachtext -- 2.5 Problembehandlung für die Überschriftennummerierung -- 2.6 Überschriften in der Kopfzeile wiederholen (Kolumnentitel) -- 2.6.1 Überschriftentext mit Nummer in der Kopfzeile zeigen -- 2.6.2 Mehrere Überschriften in die Kopfzeile -- 2.6.3 Die Suchreihenfolge der {StyleRef}-Felder -- 2.6.4 Problembehandlung für Kolumnentitel -- Kapitel 3: Kopf- und Fußzeilen -- 3.1 Kopf- und Fußzeilen einrichten -- 3.1.1 Kopf- und Fußzeilen ausblenden -- 3.1.2 Die erste Seite anders gestalten -- 3.1.3 Seiten ohne Kopfzeileneinträge -- 3.2 Kopf- und Fußzeilen bearbeiten -- 3.2.1 Abstände einrichten -- 3.2.2 Kopf- und Fußzeilen für beidseitigen Druck spiegeln -- Kapitel 4: Seiten nummerieren -- 4.1 Seitennummern in die Kopf- oder Fußzeile einbringen -- 4.1.1 Seite X von Y -- 4.1.2 Erste Seite von der Paginierung ausnehmen -- 4.1.3 Mehrere Seiten von der Paginierung ausnehmen -- 4.1.4 Kapitelweise paginieren -- 4.2 Paginierungs-Spezialitäten -- 4.2.1 Welche Seiten wie nummerieren? -- 4.2.2 Vortext und Nachtext mit eigener Seitenzählung -- 4.2.3 Nummerierung im Nachtext -- 4.2.4 Seitennummern bei querformatigen Seiten platzieren -- 4.2.5 Wechselnde Seitennummerierung gerade/ungerade -- 4.2.6 Hinweis auf Folgeseite -- Kapitel 5: Verweise und Verzeichnisse -- 5.1 Querverweise -- 5.1.1 Querverweis einrichten -- 5.1.2 Auf mehrere Ziele verweisen -- 5.1.3 Textmarke als Verweisziel -- 5.1.4 Verweise auf andere Dateien -- 5.2 Fuß- und Endnoten -- 5.2.1 Wann Fußnoten, wann Endnoten? -- 5.2.2 Fuß- und Endnoten einfügen -- 5.2.3 Fuß- und Endnoten löschen -- 5.2.4 Fuß- und Endnotennummer gestalten -- 5.2.5 Fußnotentext einrücken -- 5.2.6 Fußnotentrennlinie gestalten -- 5.2.7 Fußnoten mit Platzproblemen -- 5.3 Verzeichnisse -- 5.3.1 Wohin mit welchen Verzeichnissen? -- 5.3.2 Unterschiedliche Grunddaten für Verzeichnisse -- 5.4 Inhaltsverzeichnis -- 5.4.1 Überschriften vorbereiten -- 5.4.2 Inhaltsverzeichnis generieren -- 5.4.3 Inhaltsverzeichnis aktualisieren -- 5.4.4 Weitere Formatvorlagen zum Inhaltsverzeichnis hinzufügen -- 5.4.5 Andere Texte zum Inhaltsverzeichnis hinzufügen -- 5.4.6 Inhaltsverzeichnis formatieren -- 5.4.7 Inhaltsverzeichnis »einfrieren« -- 5.5 Abbildungs-, Tabellen- und Formelverzeichnis -- 5.5.1 Verzeichnis der Abbildungen, Tabellen oder Formeln einfügen -- 5.5.2 Quellenangaben für Illustrationen -- 5.6 Zitate, Quellen, Literaturhinweise -- 5.6.1 Quellen eintragen -- 5.6.2 Quellen organisieren -- 5.6.3 Quellenhinweis einfügen -- 5.6.4 Zitierweisen anpassen -- 5.6.5 Zitatverweis mit Platzhalter -- 5.6.6 Literatur- oder Quellenverzeichnis einfügen -- 5.6.7 Mehrere Quellenverzeichnisse -- 5.7 Rechtsgrundlagenverzeichnis -- 5.7.1 Zitate eintragen -- 5.7.2 Einträge hinzufügen -- 5.7.3 Zitate wiederverwenden -- 5.7.4 Rechtsgrundlagenverzeichnis einfügen -- 5.8 Index (Stichwortverzeichnis) -- 5.8.1 Stichworte (Einträge) erfassen -- 5.8.2 Einträge hinzufügen -- 5.8.3 Untereinträge -- 5.8.4 Verweisoptionen -- 5.8.5 Index erstellen -- 5.8.6 Glossar und Abk.-Verz. -- 5.9 Verzeichnis-Spezialitäten -- 5.9.1 Verzeichnisse und Hyperlinks -- 5.9.2 Verzeichnisse über mehrere Dokumente -- Kapitel 6: Formatvorlagen professionell -- 6.1 Alle Formatvorlagen anzeigen -- 6.2 Formatvorlagen verwenden -- 6.2.1 Zeichen- oder Absatzformat? -- 6.2.2 Formatvorlagen auf handformatierte Texte anwenden -- 6.2.3 Einen Absatz mit mehreren Absatz-Formatvorlagen formatieren -- 6.3 Formatvorlagen bearbeiten -- 6.3.1 Eigenschaften einer Formatvorlage anzeigen -- 6.3.2 Formatvorlagen erstellen und ändern -- 6.3.3 Formatvorlage aus handformatiertem Text erstellen -- 6.3.4 Überschriften-Formatvorlagen -- 6.3.5 Formatvorlage löschen -- 6.4 Dokumentvorlagen -- 6.4.1 Das Mysterium Normal.dot/m/x -- 6.4.2 Formatvorlagen wiederverwenden -- 6.5 Formatfehler finden -- 6.5.1 Formatierungen analysieren und vergleichen -- 6.5.2 Automatische Formatierungsüberwachung -- 6.5.3 Der Formatinspektor -- Teil II: Word ist keine Schreibmaschine -- Kapitel 7: Text eingeben und bearbeiten -- 7.1 Text eingeben -- 7.2 Text bearbeiten -- 7.2.1 Steuerzeichen anzeigen lassen -- 7.2.2 Text ändern -- 7.3 Interpunktion -- 7.3.1 Die Satzzeichen -- 7.3.2 Leerzeichen, aber wo und welche? -- 7.3.3 Striche - verbindend und trennend -- 7.3.4 Problemfall Apostroph -- 7.3.5 Anführungszeichen -- 7.4 Zahlen -- 7.4.1 Zahlwörter bis zwölf -- 7.4.2 Zahlenbreiten und -abstände -- 7.4.3 Die Tausender-Trennung -- 7.4.4 Brüche -- 7.4.5 Englische Ordinalzahlen -- 7.5 Sonderzeichen -- 7.5.1 Das große Eszett -- 7.5.2 Sonderzeichen per Tastatur -- 7.5.3 Sonderzeichen per Symbolauswahl -- 7.5.4 Sonderzeichen per Zahlencode -- 7.5.5 Sonderzeichen per AutoKorrektur -- 7.5.6 Sonderzeichen per Mathematischer AutoKorrektur -- 7.6 Zeichenkombinationen -- 7.6.1 Diakritische Zeichen -- 7.6.2 Zeichenkombinationen der Mathematischen AutoKorrektur -- 7.6.3 Zeichenkombination per Feldfunktion -- Kapitel 8: Navigieren und markieren -- 8.1 Im Text navigieren -- 8.1.1 Bildlauftasten und Bildlaufleiste verwenden -- 8.1.2 Den Navigationsbereich nutzen -- 8.1.3 Die Navigationswerkzeuge einsetzen -- 8.1.4 Rücksprung zum Bearbeitungspunkt -- 8.2 Text markieren -- 8.2.1 Text markieren mit der Tastatur -- 8.2.2 Speziell: Markieren im Markierungsmodus -- 8.2.3 Text markieren mit der Maus -- 8.2.4 Text markieren auf dem Tablet -- 8.2.5 Markierung aufheben -- 8.3 Text verschieben und kopieren -- 8.3.1 Verschieben strukturierter Texte -- 8.3.2 Text umstrukturieren -- Kapitel 9: Zeilen und Absätze -- 9.1 Zeilenumbruch und Silbentrennung -- 9.1.1 Silbentrennung vorgeben mit Trennfugen -- 9.1.2 Silbentrennung unterdrücken -- 9.1.3 Trennfugen an Sonderzeichen -- 9.2 Zeilenabstände -- 9.3 Text drehen -- 9.4 Absätze -- 9.4.1 Durchschuss zwischen Absätzen -- 9.4.2 Absatzeinzüge -- 9.4.3 Absätze durch Linien trennen -- 9.5 Absatzausrichtung -- 9.5.1 Blocksatz -- 9.5.2 Zentrierter Text -- 9.5.3 Rechtsbündig -- 9.6 Tabulatoren -- 9.6.1 Eigene Tabulatoren einrichten -- 9.6.2 Tabulatoren ändern -- 9.6.3 Tabulatoren mit der Maus bearbeiten -- 9.7 Absätze vor Umbruch bewahren -- 9.7.1 Überschriften am Folgetext halten -- 9.7.2 Seitenumbruch im Absatz vermeiden -- Kapitel 10: Text importieren und anpassen -- 10.1 Vorsorge bei E-Mail-Anhängen und Download

Note: Contents 1 The Conifers Conifer Taxonomy Geographic Distribution and Biogeography Life History Ecological Tolerance Conifer Mating System, Life Cycle, and Reproduction The Largest, Tallest, and Oldest Organisms on the Planet Genetic Diversity Summary Part I Genomes 2 Genomes: Classical Era The Beginnings of Genome Research in Conifers Chromosome Number and Polyploidy Genome Size Karyotype Analysis Genome Content Organelle Genomes: Chloroplast and Mitochondria Size and Structure Gene Content Inheritance Variation Summary 3 Gene and Genome Sequencing in Conifers: Modern Era A Short History of DNA Sequencing in Conifers Expressed Sequence Tag Sequencing Gene Discovery Using Next-Generation Sequencing Conifer Reference Genome Sequences Sequencing, Assembly, and Annotation Strategies Summary Statistics of Published Conifer Genome Sequences Discovery of the Noncoding DNA Content of Conifer Genomes Discovery of the Number and Types of Coding Genes in Conifers Chloroplast and Mitochondrial Genome Sequencing Summary 4 Noncoding and Repetitive DNA Introduction Ribosomal DNA Tandem Repeats: Satellite, Minisatellite, and Microsatellite DNA Transposons and Retrotransposons Pseudogenes Summary 5 Gene Structure and Gene Families A Short History of Early Conifer Gene Sequencing Wood-Forming Genes Vegetative Growth Genes Floral Genes Light-Regulated Genes Defense-Related Genes Disease-Resistant Genes Summary 6 Gene Expression and the Transcriptome A Short History of Gene Expression Studies in Conifers Wood Formation Biotic Factors Abiotic Factors Seasonal Patterns Epigenetic Control of Gene Expression Summary 7 Proteomics and Metabolomics A Short History of Proteomic and Metabolomic Research in Conifers Wood Formation Biotic Factors Abiotic Factors Seed Development and Somatic Embryogenesis Summary Part II Variation 8 Phenotypic Variation in Natural Populations Introduction Definitions Terms for Describing the Identity of Experimental Plant Materials: Provenance, Population, Seed Source, and Accession Terms for Describing Patterns of Genetic Variation on the Natural Landscape: Cline, Race, and Ecotype Historical Perspectives Application of Common Garden Experiments Experimental Approaches and Analytical Methods Experimental Approaches Analytical Methods Dependent and Independent Variables Common Garden Testing Literature Amount, Distribution, and Pattern of Genetic Variation in Phenotypic Traits of Conifers Amount and Distribution of Genetic Variation Patterns of Variation Are Local Sources Best? Case Studies Pseudotsuga menziesii (Douglas-fir) Pinus Summary 9 Neutral Genetic Variation Introduction and Background Molecular Markers Used in the Study of Neutral Variation Three Conifer Genomes Purpose and Applications of Neutral Genetic Variation Studies General Diversity Results: Allozymes Variation Within Species Variation Within Populations Distribution of Variation Among Populations (Based on Polymorphic Loci only) Differences in Measures of Diversity Among Conifer Genera and Families Allozyme Summary General Diversity Results: Molecular Markers Organelle Markers Nuclear Markers Population Differentiation Factors Affecting Amount and Distribution of Genetic Variation Mating Systems Gene Flow Genetic Drift Case Studies Diversity, Population Structure, and Biogeography Conservation and Mating Systems Effects of Forest Management and Tree Improvement on Genetic Diversity Summary 10 Adaptive Genetic Variation A Short History of Adaptive Genetic Variation in Conifers General Trends in Patterns of Adaptive Genetic Diversity in Conifers Observed from Neutrality and FST Outlier Tests Detection of Nonneutral Genes in a Few Conifer Species Pinus taeda Pinus sylvestris Pinus mugo, P. uncinata, and P. uliginosa Pinus pinaster and P. halepensis Pinus radiata Pinus contorta Pinus massoniana and P. hwangshanensis Pinus lambertiana and Other Subgenus Strobus Species Pseudotsuga menziesii Larix Species Abies Species Picea Species Cryptomeria japonica and Taxodium distichum Summary 11 Quantitative Trait Dissection A Short History of Complex Trait Dissection in Conifers Pinus taeda Pinus elliottii Pinus radiata Pinus sylvestris Pinus pinaster Pinus contorta Pseudotsuga menziesii Picea ssp. Larix ssp. Cryptomeria japonica Summary 12 Landscape Genomics A Short History of Landscape Genomics Studies in Conifers Pinus Subgenus Pinus Pinus Subgenus Strobus Picea Abies and Larix Summary 13 Conservation Genetics A Brief Introduction to Conservation Genetics in Forestry Fragmentation Habitat Loss Forest Practice Disease Insects Climate Change Summary 14 Forest Health Introduction The Growing Relevance of Forest Health Genetic Variation in Forest Health Traits Insects and Disease Abiotic Stress Mechanisms of Resistance and Tolerance Case Studies Resistance to Pissodes strobi (White Pine Weevil) Found in Picea sitchensis (Sitka spruce) Resistance to an Introduced Pathogen (Phytophthora lateralis) in Chamaecyparis lawsoniana (Port-Orford-cedar) Resistance to Stem Rusts in North American White Pines and Southern Yellow Pines Summary Part III Evolution 15 Hybridization and Introgression Introduction Definitions and Background Definitions Background Approaches to Identifying Hybrids and Quantifying Levels of Introgression Evolving Insights Case Studies of Introgressive Hybridization in Conifers Pinus contorta (Lodgepole Pine) x P. banksiana (Jack Pine) Picea sitchensis (Sitka Spruce) x P. glauca (White Spruce) and P. engelmannii (Engelmann Spruce) x P. glauca Pinus taeda (Loblolly Pine) x P. echinata (Shortleaf Pine) Hybrid Speciation Artificial Hybrids Summary 16 Paleobotany, Taxonomic Classification, and Phylogenetics Introduction Paleobotany Taxonomic Classification Cupressus Pinus Phylogenetics Character Selection The Conifers and Related Gymnosperms Araucariaceae Cupressaceae Pinaceae Podocarpaceae Sciadopityaceae Taxaceae Summary 17 Comparative Genomics Introduction to Comparative Genomics Comparative Mapping Comparative Gene Content and Transcriptomics Comparative Genome Sequences Summary 18 Historical Perspective and Future Directions in Forest Genetics and Genomics Historical Perspective Current Situation Future Directions Primary Commercial Species (Group A) Appendix 1 Appendix 2 References Index

Note: Dissertation

Note: Contents: Introduction Section I - Arctic Seas 1 Loss of Sea Ice 2 Rising Sea Surface Temperatures 3 Changes in Ocean Circulation Patterns 4 Sea Level Change 5 Impacts of Ocean Acidification on Arctic Marine Ecosystems 6 Impacts of Chemical Pollution on Marine Ecosystems 7 Impacts of Overfishing in Arctic and Sub-Arctic Waters 8 Impacts of Global Shipping to Arctic Ocean Ecosystems Section II Arctic ice 9 Decline in Arctic glaciers Section III Arctic Lands 10 Greenland Ice Sheet 11 Changes in terrestrial environments 12 Impacts of global change 13 Impacts of oil and mineral extraction Section IV Arctic people 14 Impacts of permafrost degradation 15 Threats to native ways of life 16 Changing political landscape of the Arctic Index

Note: CONTENTS List of Figures and Tables Acknowledgments Introduction: German Histories and Pacific Histories / Ulrike Strasser, Frank Biess, and Hartmut Berghoff Part I. Missionaries, Explorers, and Knowledge Transfer 1. German Apothecaries and Botanists in Early Modern Indonesia, the Philippines, and Japan / Raquel A. G. Reyes 2. A Bohemian Mapmaker in Manila: Travels, Transfers, and Traces between the Pacific Ocean and Germans Lands / Ulrike Strasser 3. German Naturalists in the Pacific around 1800: Entanglement, Autonomy, and a Transnational Culture of Expertise / Andreas W. Daum 4. Georg Wilhelm Steller and Carl Heinrich Merck: German Scientists in Russian Service as Explorers in the North Pacific in the Eighteenth Century / Kristina Küntzel-Witt 5. Johann Reinhold Forster and the Ship Resolution as a Space of Knowledge Production / Anne Mariss 6. Engineering Empire: German Influence on Chinese Industrialization, 1880-1925 / Shellen Wu Part II. Expansion, Entanglements, and Colonialism in the Long Nineteenth Century 7. Expanding the Frontier(s): The Spreckels Family and the German-American Penetration of the Pacific, 1 870-1920 / Uwe Spiekermann 8. Work and Non-work in the "Paradise of the South Sea": Samoa, ca. 1890-1914 195 / Jürgen Schmidt 9. German Women in the South Sea Colonies, 1884-1919 / Livia Rivotti 10. Sacrifice, Heroism, Professionalization, and Empowerment: Colonial New Guinea in the Lives of German Religious Women, 1899-1919 / Katharina Stornig 11. Rape, Indenture, and the Colonial Courts in German New Guinea / Emma Thomas 12. The Trans-Pacific "Ghadar" Movement: The Role of the Pacific in the Indo-German Plot to Overthrow the British Empire during World War I / Douglas T. McGetchin 13. The Vava'u Germans: History and Identity Construction of a Transcultural Community with Tongan and Pomeranian Roots / Reinhard Wendt Epilogue German Histories and Pacific Histories: New Directions / Matt Matsuda Index

Note: Table of Contents Introductory perspectives Chapter 1: Introduction: Cold War science in the North American Arctic / by Stephen Bocking, Daniel Heidt Strategic science Chapter 2: Ice and the depths of the ocean: probing Greenland's Melville Bay during the Cold War / by Mark Nuttall Chapter 3: Leadership, cultures, the Cold War and the establishment of Arctic scientific stations: situating the Joint Arctic Weather Stations (JAWS) / by P. Whitney Lackenbauer, Daniel Heidt Chapter 4: Frontier footage: science and colonial attitudes on film in Northern Canada, 1948–1954 / by Matthew S. Wiseman Chapter 5: Portraying America's last frontier: Alaska in the media during the Second World War and the Cold War / by Victoria Herrmann Chapter 6: Making “Man in the Arctic”: academic and military entanglements, 1944–49 / by Matthew Farish Cold War economies Chapter 7: Arctic pipelines and permafrost science: North American rivalries in the shadow of the Cold War, 1968–1982 / by Robert Page Chapter 8: Cold oil: linking strategic and resource science in the Canadian Arctic / by Stephen Bocking Chapter 9: Icebergs in Iowa: Saudi dreams, Antarctic hydrologics and the production of Cold War environmental knowledge / by Rafico Ruiz Chapter 10: Science and Indigenous knowledge in land claims settlements: negotiating the Inuvialuit Final Agreement, 1977–1978 / by Andrew Stuhl Science crossing borders Chapter 11: Knowledge base: polar explorers and the integration of science, security, and US foreign policy in Greenland, from the Great War to the Cold War / by Dawn Alexandrea Berry Chapter 12: Institutions and the changing nature of Arctic research during the early Cold War / by Lize-Marié van der Watt, Peder Roberts, Julia Lajus Chapter 13: Rockets over Thule? American hegemony, ionosphere research and the politics of rockets in the wake of the 1968 Thule B-52 accident / by Henrik Knudsen Chapter 14: Applied science and practical cooperation: Operation Morning Light and the recovery of cosmos 954 in the Northwest Territories, 1978 / by P. Whitney Lackenbauer, Ryan Dean Chapter 15: Melting the ice curtain: indigeneity and the Alaska Siberia Medical Research Program, 1982–1988 / by Tess Lanzarotta Epilogue: global Cold War—the Antarctic and the Arctic Chapter 16: Antarctic science and the Cold War / by Adrian Howkins

Note: Inhalt Vorwort Bibliothek als Bauaufgabe Bibliothek als architektonische Aufgabe : Von der Entwicklung der Gebäudetypologie und der Verschiebung der Schwerpunkte in der Bibliotheksarchitektur / Marina Stankovic und Tobias Jortzick Herausragende Bibliotheksbauten der vergangenen zehn Jahre - eine Aufforderung / Ulrich Niederer Die Grüne Bibliothek : ökologische Nachhaltigkeit bei Bibliotheksbau und -ausstattung / Melanie Padilla Segarra und Petra Hauke Standortwahl / Konrad Umlauf Außenraumtypologien an Bibliotheken / Irene Lohaus Verfahrensschritte zur Realisierung eines innovativen Bauvorhabens : Das Beispiel des Gemeinsamen Bibliotheksgebäudes von Universität und Hochschule Osnabrück auf dem Campus Westerberg / Felicitas Hundhausen Flächenbedarf von Hochschulbibliotheken / Bernd Vogel Bibliotheken bauen im Bestand Bibliotheksbau im Bestand - oder: Die Liebe zum Unikat / Robert Niess Modernisierung und Sanierung von Bibliotheksbauten : Aus einem bestehenden Gebäude etwas Neues machen / Oliver Kohl-Frey Sanierung und Neukonzeption bestehender Bausubstanz : Das Beispiel der Universitätsbibliothek Konstanz / Michael B. Frank Nachnutzung versus Neubau : Das Beispiel RW21 Stadtbibliothek Bayreuth / Jörg Weinreich Räume gestalten Lernräume der Zukunft - Perspektiven junger Gestalter / Klaus Ulrich Werner Die Schulbibliothek / Birgit Lücke und Angelika Flolderried Die Jugendbibliothek : Erlebnis- und Kommunikationsort / Kerstin Keller-Loibl Die Kinderbibliothek / Sabine Brunner Makerspaces - Bibliotheksräume für Macher / Gabriela Lüthi-Esposito Das zukunftsfähige Bib-Office / Jutta Eiberger Barrierefreiheit - eine Herausforderung?! / Särka Vonskovä Umgebungsbedingung: Licht Bodenbeläge für Bibliotheken / Roman Rabe Partizipatives Gestalten / Jens llg und Robert Zepf Bibliothekstechnik Leitsysteme - Funktion und Entwicklungsprozesse / Anna-Katharina Huth RFID und moderne technische Infrastruktur / Frank Seeliger, Jan Kissigund Ricardo Frommholz Präsentation digitaler Medien im physischen Raum / Janin Präßler Hochregallager - ein neuer Weg der Magazinierung : Die Kooperative Speicherbibtiothek Schweiz. Eine Luzerner Fallgeschichte mit Exkursen / Ulrich Niederer Brandschutz, Sicherheit und Notfallvorsorge / Milena Pfafferott Klimaregulierung : Bau- und Klimakonzepte für Räume zur Aufbewahrung, Nutzung und Präsentation von Altbeständen / Christine Sauer Management im Kontext von Bauprojekten Bibliotheksumzug / Martin Lee Change Management - Best Practice wider den Widerstand : Beispiele aus der Stadtbibliothek Nürnberg und der Staatsbibliothek Bamberg / Ilona Munique Betriebsmanagement : Dargestellt am Beispiel der ETH-Bibliothek Zürich / Susanne Benitz und André Reichmuth Gebäudemanagement / Christian Kuhlmann Aufenthalt und Aufenthaltsmessung im physischen Bibliotheksraum / Julia Weis Öffentlichkeit durch Bibliotheksarchitektur - von innen und außen betrachtet / Dirk Wissen Bibliotheksgebäude auf dem Prüfstand : Kennzeichen, Betrieb und Evaluation - ein Fragenkatalog / IFLA Library Buildings and Equipment Section Anhang Bibliotheken planen, bauen und ausstatten : Eine Auswahlbibliografie / Petra Hauke Autoren & Herausgeber Abkürzungen Index

Note: Inhaltsverzeichnis Vorwort zur Reihe Vorwort Einleitung 1 Begriffskontexte 1.1 Information 1.2 Wissen 1.3 Kompetenz 1.4 Lernen / Aneignung 1.4.1 Einführung 1.4.2 Lerntheorien 1.4.3 Lebenslanges und selbstgesteuertes Lernen 1.4.4 Lernstile und Lerntypen 1.4.5 Lernraum 1.4.6 Kontextualisierungen 1.5 Lehren / Vermittlung / Didaktisches Handeln 1.5.1 Einführung 1.5.2 Didaktische Theorien, Modelle und Konzepte 1.5.3 Lernbegleitung / Lernberatung 1.5.4 Kontextualisierungen 1.6 Bildung 1.7 Zusammenfassung 2 Lernwelten im Wandel 2.1 Einführung 2.2 Begriffskontexte Lernwelten 2.3 Hochschulen und Wissenschaftliche Bibliotheken 2.3.1 Überblick 2.3.2 Angebotskonzepte 2.3.3 Raumkonzepte 2.3.4 Organisationskonzepte 2.3.5 Zusammenfassung 2.4 öffentliche Bibliotheken 2.4.1 Überblick 2.4.2 Angebotskonzepte 2.4.3 Raumkonzepte 2.4.4 Organisationskonzepte 2.4.5 Zusammenfassung 2.5 Erwachsenenbildung / Weiterbildung 2.5.1 Überblick 2.5.2 Angebotskonzepte 2.5.3 Raumkonzepte 2.5.4 Organisationskonzepte 2.5.5 Zusammenfassung 2.6 Bildungs- und Kulturzentren - Learning Centres 2.6.1 Überblick 2.6.2 Angebotskonzepte 2.6.3 Raumkonzepte 2.6.4 Organisationskonzepte 2.6.5 Zusammenfassung 3 Zukünftige Perspektiven 3.1 Wandlungsprozesse 3.1.1 Herausforderungen 3.1.2 Vom Produkt zum Prozess 3.1.3 Vom Lehren zum Lernen 3.1.4 Vom Konsum zur Produktion 3.1.5 Von der Lehrumgebung zur Lernumgebung 3.1.6 Von der Addition zur Integration 3.2 Optionsraum Lebenslanges Lernen 3.2.1 Herausforderungen 3.2.2 Angebotsentwicklung 3.2.3 Lernraumentwicklung 3.2.4 Organisationsentwicklung 3.2.5 Kooperationsentwicklung 3.2.6 Stadt- / Regionalentwicklung 3.2.7 Perspektiven Literatur Abkürzungsverzeichnis Abbildungsverzeichnis Tabellenverzeichnis Zum Autor Register

Note: Table of Contents Preface Chapter 1. North-East Eurasia (Siberia) in the Context of World History: New Concepts / Vladislav Kokoulin and Igor Likhomanov Chapter 2. The Past, Present, and Future of the use of the Agricultural Soils of Siberia / W. Halicki and K. Kita Chapter 3. Agroecological Monitoring of the Carbon Transformation in Agroecosystems on Gray Forest Soils of the Baikal Region under Current Climatic Changes and Conditions of Fluoride Pollution / L. V. Pomazkina and Yu. V. Semenova Chapter 4. Ecology of Avian Influenza Viruses in Siberia / Maria Alessandra De Marco, Kirill Sharshov, Marina Gulyaeva, Mauro Delogu, Lorenzo Ciccarese, Maria Rita Castrucci, Alexander Shestopalov Chapter 5. Assessment of Biogenic Substances of Selected Terrestrial Waters in the Northern Part of Western Siberia: Significance for Ecology and Climate Change / W. Halicki, M. W. Kochanska and S. N. Kirpotin Chapter 6. Quality Assessment of Selected Surface Waters of the Arctic Tundra of Western Siberia in the Context of Climate Change / W. Halicki, M.W. Kochanska and S.N. Kirpotin Index

Note: Table of Contents Introduction: Thermokarst Lakes of Western Siberia as Dominant Forms of Landscape and Regulators of Greenhouse Gas Exchange with the Atmosphere Chapter 1. Thermokarst Lakes: Distribution, Cycle of Development, Surface Coverage and Evolution Chapter 2. Sources of Dissolved Components in Thermokarst Lakes Chapter 3. Temperature and Gas Regime Chapter 4. Dissolved Organic Carbon Chapter 5. Microbiology of Thermokarst Lake Systems Chapter 6. Trace Elements in Thermokarst Lakes Chapter 7. Colloids in Thermokarst Lakes Chapter 8. Latitude Profile Gradients of Lakes: Substituting Space for Time Chapter 9. Possible Impact of Climate Warming on Stocks and Fluxes of Carbon and Related Elements in Western Siberian Lakes Conclusions: Thaw Lakes as Indicators of Climate Change References Index

Note: 1. Einleitung 2. Die Beobachtungen des Mondes 2.1. Entfernungsmessungen zum Mond 2.2. Der astronomische Anschluß des Mondes 3. Die Beobachtungen der Radiosterne 3.1. Interferometrische Beobachtungen eines Quasars 3.2. Der astronomische Anschluß eines Quasars 4. Koordinatensysteme 5. Die Fehlergleichungen für Entfernungsmessungen zum Mond an einer Station 5.1. Rechtwinklige kartesische Koordinaten für die Station und den Mond 5.2. Räumliche Polarkoordinaten für die Station und Rektaszension und Deklination als Koordinaten für den Mond 5.3. Räumliche Polarkoordinaten für die Station und ekliptikale Länge und Breite als Koordinaten für den Mond 5.4. Räumliche Polarkoordinaten für die Station und Bahnelemente in bezug auf die Ekliptik für den Mond 5.5. Räumliche Polarkoordinaten für die Station und Bahnelemente in bezug auf den Äquator für den Mond 6. Die Fehlergleichungen für simultane Entfernungsmessungen zum Mond an zwei Stationen 6.1. Rechtwinklige kartesische Koordinaten für die Station und den Mond 6.2. Rechtwinklige kartesische Koordinaten für die Station und Rektaszension und Deklination als Koordinaten für den Mond 6.3. Rechtwinklige kartesische Koordinaten für die Station und ekliptikale Länge und Breite als Koordinaten für den Mond 6.4. Rechtwinklige kartesische Koordinaten für die Station und Bahnelemente in bezug auf die Ekliptik für den Mond 7. Die Fehlergleichungen für simultane Entfernungsmessungen zum Mond an zwei Stationen bei astronomischem Anschluß des Mondes 7.1. Rechtwinklige kartesische Koordinaten für die Station und Rektaszension und Deklination als Koordinaten für den Mond 7.2. Rechtwinklige kartesische Koordinaten für die Station und ekliptikale Länge und Breite als Koordinaten für den Mond 7.3. Rechtwinklige kartesische Koordinaten für die Station und Bahnelemente in bezug auf die Ekliptik für den Mond 8. Die Fehlergleichungen für radiointerferometrisohe Beobachtungen der Laufzeitdifferenz 8.1 . Rechtwinklige kartesische Koordinaten für die Station und Rektaszension und Deklination als Koordinaten für den Quasar 9. Die Fehlergleichungen für radiointerferometrische Beobachtungen der Streifenfrequenz 9.1. Rechtwinklige kartesische Koordinaten für die Station und Rektaszension und Deklination als Koordinaten für den Quasar 10. Interferometrische Beobachtungen künstlicher Erdsatelliten und künstlicher Radioquellen auf dem Mond Literatur

Note: Zusammenfassung Vorwort Kautzleben: Aufgaben und Entwicklungstendenzen des Zentralinstitute für Physik der Erde Jubitz, K.-B.: Zu einigen allgemeinen Aspekten geotektonischer Forschung Janšin, A.L.: Uber sogenannte weltweite Transgressionen und Regressionen Chain, V.E.: Über die gegenwärtige Situation in der theoretischen Geotektonik und zu den daraus resultierenden Aufgaben Kölbel, H.: Zur Methodik der Zusammenstellung tektonischer Übersichtskarten am Beispiel Mitteleuropas Gluško,V.V.; Dikenštejn, G.Ch.; Kravčenko, K.N.: Einige Besonderheiten der Tektonik der südlichen UdSSR (Zu den Ergebnissen der Zusammenstellung einer Kartenserie dieses Gebietes) Jubitz, K.-B.: Zur Problematik tektonischer Untersuchungen im Deckgebirge STILLEs (Tafeldeokgebirge und Molassenstockwerk) Schwab, G.; Jubitz, K.-B.; Meier, R.: Zu .einigen Aspekten der stofflichen und strukturellen Entwicklung im Tafeldeokgebirge des nördlichen Mitteleuropas, speziell zu Fragen der Postumität Beutler, G.: Beziehungen zwischen dem altkimmerischen Strukturplan und dem tieferen Untergrund Wendland, F.: Zu einigen Aspekten der Tektonik von salinaren Strukturen Möbus, G.: Die strukturtektonische Bearbeitung des Kernmaterials von Bohrungen Žuravlev, V.S.: Der Erdkrustenbau tiefreichender Senken auf alten Tafeln Kopf, M.: Petrophysik der Stockwerke des Tafeldeckgebirges Grumbt, E.; Lützner, H.; Ellenberg, J.; Falk, F.; Ludwig, A.: Zur Sedimentation und Tektonik im Übergangsbereich zwischen Molassestadium und Tafelentwicklung der Varisziden in Mitteleuropa Sobolevskaja, V.N.: Die taphrogene Entwicklungsetappe epivariazischer Tafeln Benek, R.; Röllig, G.; Eigenfeld, F.; Schwab,M.: Zur strukturellen Stellung des Magmatiamus der Subsequenzperiode im DDR-Anteil der mitteleuropäischen Varieziden Buš, V.A.; Gareckij, R.G.; Kirjuchin, L.G.: Die strukturelle Lage der subsequenten Effusiva der Varisziden Zentraleuropas, Mittelasiens und Kasachstans Milanovskij, E.E.; Kornovskij, N.V.: Der orogene spätkänozoische Vulkanismus Eurasiens und seine Beziehungen zur Tektonik Bogolepov, K.V.: Die Deuteroorogenese

Note: Bankwitz, P.; Bankwitz, E.: Einige Aspekte der Bruchmechanik in der Lithosphäre Mundt, W.: Gemeinsame Korrelationsanalyse geologischer und geophysikalischer Karten zum Nachweis tektonischer Störungen Watznauer, A.; Lindner, H.; Behr, H.-J.; Tröger, K.-A.: Versuch einer Stockwerkskorrelation im SUüdabschnitt des Elbe-Lineamentes (Raum Meißen - Bad Schandau) Brause, H.: Paläomobilität und Paläodynamik in Mitteleuropa Lauterbach, R.; Lauterbach, J.: Zur Rolle der Bruchsysteme in Ost--West Richtung Teschke, H.-J.: Zu einigen Fragen der Entwicklung dee Südwestrandes der Osteuropäischen Tafel Bončev, E.: Zu einigen Grundfragen der Rhegmagenese des östlichen Teile der Balkanhalbinsel Porstendorfer, G.: Abbildungen des geotektonischen Baues im Erscheinungsbild natürlicher geoelektromagnetischer Variationen Hurtig, E.; Schlosser, P.: Analyse der Wärmeflußdaten Mitteleuropas

Note: Schroeder, E.: Probleme tektonischer Untersuchungen im Orogen, speziell in den Varisziden Ažgirej, G.D.: Geosynklinalfaltung (Die Entstehung der Hauptfaltentypen) Schwan, W.: Zur Ableitung der Großtektonik eines Gebirges aus leitenden Strukturen seiner Kleintektonik. Möglichkeiten und Grenzen einer geotektonischen Arbeitsmethode Paech, H.-J.: Zur Grenze zwischen Flysch und Molasse im variszischen Orogen Mitteleuropas Lutzens, H.: Zum Baustil des Unter- und Mittelharzes auf der Grundlage neuer stratigraphisch-fazieller Untersuchungen Neumann, W.: Zum Stockwerkbau im Bereich der "Mitteldeutschen Kristallinzone" (speziell im Ruhlaer Kristallin) Holubec, J.: Assyntische Strukturen im Barrandium der Böhmischen Masse Beneš, K.: Zur Gefügeanalyse von Plutonen der Böhmischen Masse Oberc, J.: Einige Grundfragen der Varisziden Südpolens Schönenberg, R.: Zur Frage der Verbindung von Sudetikum und ostalpinem Variezikum Mahel, M.: Grundfragen der Beziehungen von Lithofazies und Tektonik im alpinen Orogen Balogh, K.; Barabás, A.; Majoros, G.: Der heutige Stand der Kenntnis des Karbons und Perms in Ungarn Brinkmann, R.: Geologische Beziehungen zwischen dem schwarzen Meer und Anatolien Senčenko, G.S.: Faltungsmorphologie der verschiedenen Strukturformationszonen des Südurals Kamaletdinov, M.A.; Kazanceva, T.T.: Über allochthone Ophiolithe im Ural Matveevskaja, A.L.: Einige Gesetzmäßigkeiten der Entwicklung von Geosynklinalgebieten am Beispiel variszischer Strukturen in Südsibirien Cloos, E.: Über Appalachentektonik und Kontinentalrand. Eine vorläufige Skizze

Note: Vorwort Zusammenfassung 1. Einleitung 2. Konstruktionsprinzip des mechanischen Empfängers 3. Theorie des mechanischen Empfängers mit schräggestelltem Gehänge 3.1. Kinematik 3.2. Dynamik 3.3. Das Moment der konservativen Kräfte 3.4. Die Neigungswinkel der Blattfedern 3.5. Die Differentialgleichung des mechanischen Empfängers bei elektronischer Rückkopplung 3.6. Die stabilisierende Wirkung der Rückkopplung 3.7. Die Kompensation von Gleichgewichtsstörungen 4. Das Magnetsystem 4.1. Berechnung des Magnetsystems 4.2. Prüfung des Magnetsystems 5. Die Schraubenfeder 5.1. Berechnung der Schraubenfeder 5.2. Prüfung der Schraubenfeder 6. Prüfung des mechanischen Empfängers 6.1. Das Gehänge 6.2. Einflüsse auf die Eigenperiode des mechanischen Empfängers 6.3. Schütteltischversuche 7. Zur Theorie der Rückkopplung 7.1. Der Einfluß eines stabilisierenden Tiefpasses 7.2. Die Hochpässe zur Erzeugung einer verrückungsproportionalen Charakteristik 7.3. Der Hochpaß zur Erzeugung einer geschwindigkeitsproportionalen Charakteristik 8. Forderungen an die elektronische Meßwerterfassung 9. Die Realisierung der elektronischen Meßwerterfassung 9.1. Das Prinzip der Signalwandlung 9.2. Der Aufbau des Wandlerbausteins 9.3. Linearisierung und f(Do) -Überprüfung 10. Die Signalaufbereitung im EDS 1 10.1. Signalfluß und Filterstruktur 10.2. Der Aufbau der Signalfilter 11. Die Einrichtungen zur Parameterstabilisierung und -korrektur 11.1. Die integrale Rückführung 11.2. Die automatische Korrektur größerer Nullpunktabweichungen 11.3. Die Korrektur von Eigenperiode und Gleichgewichtslage durch Handbetrieb 12. Einweisung in die Bedienung des EDS 1 13. Installation und Erprobung 14. Die Fernübertragungsendstelle 15. Applikation und Ausbau des EDS-1-Systems 16. Beispiele von EDS-1-Registrierungen Parameterübersicht Formelzeichenzusammenstellung Literatur

Note: Contents List of Abbreviations List of Symbols Part A Basics of Atmospheric Measurement Techniques 1 Introduction to Atmospheric Measurements / Thomas Foken, Frank Beyrich, Volker Wulfmeyer 1.1 Measuring Meteorological Elements 1.2 History 1.3 The Structure of the Atmosphere 1.4 Devices, Systems, and Typical Specifications 1.5 Applications 1.6 Future Developments 1.7 Further Reading References 2 Principles of Measurements / Wolfgang Foken 2.1 Basics of Measurements 2.2 History 2.3 Errors in Measurement 2.4 Regression Analysis 2.5 Time Domain and Frequency Domain for Signals and Systems 2.6 Dynamics of Measuring Systems 2.7 Analog and Digital Signal Processing 2.8 Hardware for Digital Measurement Systems 2.9 Further Reading References 3 Quality Assurance and Control / Cove Sturtevant, Stefan Metzger, Sascha Nehr, Thomas Foken 3.1 Principles and Definition 3.2 History 3.3 Elements of Quality Management 3.4 Application 3.5 Future Developments 3.6 Further Reading References 4 Standardization in Atmospheric Measurements / Simon Jäckel, Annette Borowiak, Brian Stacey 4.1 Background and Definitions 4.2 History 4.3 Principles and Procedures 4.4 Standardization in the Field of Atmospheric Measurements 4.5 Future Developments 4.6 Further Reading References 5 Physical Quantities / Thomas Foken, Olaf Hellmuth, Bernd Huwe, Dietrich Sonntag 5.1 Selection of Parameters 5.2 History and Thermodynamic Standards 5.3 Units and Constants 5.4 Parameters of Air, Water Vapor, Water, and Ice 5.5 Parameterization of Optical Properties of Clouds 5.6 Absorption Coefficients for Water Vapor, Ozone, and Carbon Dioxide 5.7 Parameters of Soil 5.8 Time and Astronomical Quantities 5.9 Tables in Other Chapters 5.10 Future Developments 5.11 Further Reading References Part B In situ Measurement Techniques 6 Ground-Based Platforms / Olaf Kolle, Norbert Kalthoff, Christoph Kottmeier, J. William Munger 6.1 Principles of Platforms 6.2 History 6.3 Theory 6.4 Platforms and Sensor Installations 6.5 Specification 6.6 Quality Control and Safety 6.7 Maintenance 6.8 Applications 6.9 Future Developments 6.10 Further Reading References 7 Temperature Sensors / Thomas Foken, Jens Bange 7.1 Measurement Principles and Parameters 7.2 History 7.3 Theory 7.4 Devices and Systems 7.5 Specifications 7.6 Quality Control 7.7 Maintenance 7.8 Applications. 7.9 Future Developments 7.10 Further Reading References 8 Humidity Sensors / Dietrich Sonntag, Thomas Foken, Holger Vömel, Olaf Hellmuth 8.1 Measurement Principles and Parameters 8.2 History 8.3 Theory 8.4 Devices and Systems 8.5 Specifications 8.6 Quality Control 8.7 Maintenance 8.8 Application 8.9 Future Developments 8.10 Further Readings References 9 Wind Sensors / Thomas Foken, Jens Bange 9.1 Measurement Principles and Parameters 9.2 History 9.3 Theory 9.4 Devices and Systems 9.5 Specifications 9.6 Quality Control 9.7 Maintenance 9.8 Application 9.9 Future Developments 9.10 Further Reading References 10 Pressure Sensors / Anni Torri, Thomas Foken, Jens Bange 10.1 Measurement Principles and Parameters 10.2 History 10.3 Theory 10.4 Devices and Systems 10.5 Specifications 10.6 Quality Control 10.7 Maintenance 10.8 Application 10.9 Future Developments 10.10 Further Reading References 11 Radiation Sensors / Klaus Behrens 11.1 Measurement Principles and Parameters 11.2 History 11.3 Theory 11.4 Devices and Systems 11.5 Specifications 11.6 Quality Control 11.7 Maintenance 11.8 Applications 11.9 Future Developments 11.10 Further Reading References 12 In-situ Precipitation Measurements / Arianna Cauteruccio, Matteo Colli, Mattia Stagnaro, Luca G. Lanza, Emanuele Vuerich 12.1 Measurement Principles and Parameters 12.2 History 12.3 Theory 12.4 Devices and Systems 12.5 Specifications 12.6 Quality Control, Uncertainty, and Calibration 12.7 Maintenance 12.8 Application 12.9 Future Developments 12.10 Further Reading References 13 Visibility Sensors / Martin Löffler-Mang, Klaus Heyn 13.1 Measurement Principles and Parameters 13.2 History 13.3 Theory 13.4 Devices and Systems 13.5 Specifications 13.6 Quality Control 13.7 Maintenance 13.8 Application 13.9 Future Developments 13.10 Further Reading References 14 Electricity Measurements / Giles Harrison, Alec Bennett 14.1 Measurement Principles and Parameters 14.2 History 14.3 Theory 14.4 Devices and Systems 14.5 Specifications 14.6 Quality Control 14.7 Maintenance 14.8 Applications 14.9 Future Developments 14.10 Further Reading References 15 Radioactivity Sensors / Jacqueline Bieringer, Thomas Steinkopff, Ulrich Stöhlker 15.1 Measurement Principles and Parameters 15.2 History 15.3 Theory 15.4 Devices and Systems 15.5 Specifications 15.6 Quality Control 15.7 Maintenance 15.8 Application 15.9 Future Developments 15.10 Further Reading References 16 Gas Analysers and Laser Techniques / Dwayne Heard, Lisa K. Whalley, Steven S. Brown 16.1 Measurement Principles and Parameters 16.2 History 16.3 Theory 16.4 Devices and Systems 16.5 Specifications 16.6 Quality Control 16.7 Maintenance 16.8 Applications 16.9 Future Developments 16.10 Further Reading References 17 Measurement of Stable Isotopes in Carbon Dioxide, Methane, and Water Vapor / Ingeborg Levin, Matthias Cuntz 17.1 Measurement Principles and Parameters 17.2 History of Stable Isotope Measurements in Atmospheric CO2, CH4 and H2O 17.3 Theory 17.4 Devices and Systems 17.5 Specifications 17.6 Quality Control 17.7 Maintenance 17.8 Application 17.9 Future Developments 17.10 Further Readings References 18 Measurement of Fundamental Aerosol Physical Properties / Andreas Held, Alexander Mangold 18.1 Measurement Principles and Parameters 18.2 History 18.3 Theory 18.4 Devices and Systems 18.5 Specifications 18.6 Quality Control 18.7 Maintenance 18.8 Application 18.9 Future Developments 18.10 Further Reading References 19 Methods of Sampling Trace Substances in Air / Christopher Pöhlker, Karsten Baumann, Gerhard Lammel 19.1 Measurement Principles and Parameters 19.2 History 19.3 Theory 19.4 Devices and Systems 19.5 Specifications 19.6 Quality Control 19.7 Maintenance 19.8 Application 19.9 Future Developments 19.10 Further Reading References 20 Optical Fiber-Based Distributed Sensing Methods / Christoph K. Thomas, John Selker 20.1 Measurement Principles and Parameters 20.2 History 20.3 Theory 20.4 Devices 20.5 Specifications 20.6 Quality Control 20.7 Maintenance 20.8 Applications 20.9 Future Developments 20.10 Further Reading References 21 Odor Measurements / Ralf Petrich, Axel Delan 21.1 Measurement Principles and Parameters 21.2 History 21.3 Theory 21.4 Devices and Systems 21.5 Specifications 21.6 Quality Control 21.7 Maintenance 21.8 Application 21.9 Future Developments 21.10 Further Readings References 22 Visual Observations / Thomas Foken, Raymond Rülke 22.1 Principles of Visual Observations 22.2 History 22.3 Theory 22.4 Observed Parameters 22.5 Quality Control 22.6 Application 22.7 Future Developments 22.8 Further Readings References Part C Remote-Sensing Techniques (Ground-Based) 23 Sodar and RASS / Stefan Emeis 23.1 Measurement Principles and Parameters 23.2 History 23.3 Theory 23.4 Devices and Systems 23.5 Specifications 23.6 Quality Control 23.7 Maintenance 23.8 Applications 23.9 Future Developments 23.10 Further Reading References 24 Backscatter Lidar for Aerosol and Cloud Profiling / Christoph Ritter, Christoph Münkel 24.1 Measurement Prinziples and Parameters 24.2 History 24.3 Theory 24.4 Devices and Systems 24.5 Specifications 24.6 Quality Control 24.7 Maintenance 24.8 Applications 24.9 Further Reading References 25 Raman Lidar for Water-Vapor and Temperature Profiling / Volker Wulfmeyer, Andreas Behrendt 25.1 Measurement Principles and Parameters 25.2 History 25.3 Theory 25.4 Devices and Systems 25.5 Specifications 25.6 Quality Control 25.7 Maintenance 25.8 Applications 25.9 Future Developments 25.10 Further Reading References 26 Water Vapor Differential Absorption Lidar / Scott M. Spuler, Matthew Hayman, Tammy M. Weckwerth 26.1 Measurement Principles and Param

Note: Contents Part I Natural Mangrove Systems 1 Australian Mangroves: Their Distribution and Protection / I. D. Cresswell and V. Semeniuk 2 The Dynamics of Expanding Mangroves in New Zealand / Erik M. Horstman, Carolyn J. Lundquist, Karin R. Bryan, Richard H. Bulmer, Julia C. Mullarney, and Debra J. Stokes 3 Mangrove Forests of the Persian Gulf and the Gulf of Oman / Alireza Salehipour Milani 4 Current Status of Mangrove Wetlands in Sinaloa: A Biological Corridor Along the Eastern Margin of the Gulf of California, México / Marlenne Manzano-Sarabia, Olivia Millán-Aguilar, Francisco Flores-Cárdenas, Lidia Rodríguez-Arredondo, Mayra I. Grano-Maldonado, and Mario Nieves-Soto 5 Geospatial Assessment of Spatio-Temporal Changes in Mangrove Vegetation of Pichavaram Region, Tamil Nadu, India / M. Vani and P. Rama Chandra Prasad Part II Threats, Vulnerability, and Impacts 6 Natural Threats and Impacts to Mangroves Within the Coastal Fringing Forests of India / Ashis Kr. Paul, Amrit Kamila, and Ratnadip Ray 7 An Assessment of Vulnerability and Adaptation of Coastal Mangroves of West Africa in the Face of Climate Change / Isaac Boateng 8 Historical Losses of Mangrove Systems in South America from Human-Induced and Natural Impacts / Daniel Gorman 9 Australian Mangroves: Anthropogenic Impacts by Industry, Agriculture, Ports, and Urbanisation / V. Semeniuk and I. D. Cresswell 10 Determining the Influence of Urbanization on Mangrove Zones of Northeastern Brazil: Characterization of Ceará State Coastal Zone Organic Matter Inputs / Stéphane Jean Louis Mounier, Rozane Valente Marins, and Luiz Drude de Lacerda 11 Vulnerability of Mangrove Forests and Wetland Ecosystems in the Sundarbans Natural World Heritage Site (Bangladesh) / Shafi Noor Islam, Sandra Reinstädtler, and Albrecht Gnauck Part III Pollution and Contamination by Hydrocarbons and Heavy Metals 12 The Impact of Oil and Gas Exploration: Invasive Nypa Palm Species and Urbanization on Mangroves in the Niger River Delta, Nigeria / Aroloye O. Numbere 13 Oil-Related Mangrove Loss East of Bonny River, Nigeria / Erich R. Gundlach 14 Sediment Hydrocarbons in Former Mangrove Areas, Southern Ogoniland, Eastern Niger Delta, Nigeria / David I. Little, Kay Holtzmann, Erich R. Gundlach, and Yakov Galperin 15 Heavy Metal Distribution and Accumulation from Natural and Anthropogenic Sources in Tropical Mangroves of India and Bangladesh / Prabhat Ranjan, Karuna Rao, Alok Kumar, and A. L. Ramanathan Part IV Assessment Techniques, Ecosystem Design, and Management Strategies 16 Ecosystem Design: When Mangrove Ecology Meets Human Needs / Martin Zimmer 17 Towards Sustainability and Protection of Threatened Coastal Ecosystems: Management Strategies for a Rare Stone Mangrove in Gorda Beach, Armação dos Búzios, Brazil / Marcelo Obraczka, Kátia Leite Mansur, and Gerson Cardoso da Silva, Jr. 18 Assessment and Management Strategies of Mangrove Forests Alongside the Mangsalut River Basin (Brunei Darussalam, on the Island of Borneo) / Shafi Noor Islam, Nurin Hidayati Hj Abd Rahman, Sandra Reinstädtler, and Mohd Nur Azri Bin Aladin 19 Mangrove Establishment in an Artificially Constructed Estuarine Channel, Sungei Api-Api, Singapore / Suzanna Ramos and Patrick A. Hesp 20 Interaction of Mangroves, Coastal Hydrodynamics, and Morphodynamics Along the Coastal Fringes of the Guianas / Erik A. Toorman, Edward Anthony, Pieter G. E. F. Augustinus, Antoine Gardel, Nicolas Gratiot, Oudho Homenauth, Nicolas Huybrechts, Jaak Monbaliu, Kene Moseley, and Sieuwnath Naipal 21 The Beneficial Effects of Mangrove Forest to Sea Defence Structures / Henk Jan Verhagen 22 Remote Sensing of Mangrove Forests: Current Techniques and Existing Databases / Stuart E. Hamilton, Gustavo A. Castellanos-Galindo, Marco Millones-Mayer, and Mara Chen 23 Urban Mangrove Biology and Ecology: Emergent Patterns and Management Implications / Benjamin Branoff 24 High-Throughput Techniques As Support for Knowledge-Based Spatial Conservation Prioritization in Mangrove Ecosystems / Véronique Helfer and Martin Zimmer Part V Conservation, Rehabilitation, and Governance 25 Mangrove Concessions: An Innovative Strategy for Community Mangrove Conservation in Ecuador / Fausto Vinicio López Rodríguez 26 Conserving Mangroves for Their Blue Carbon: Insights and Prospects for Community-Based Mangrove Management in Southeast Asia / Dixon T. Gevaña, Leni D. Camacho, and Juan M. Pulhin 27 Mangrove Habitats in São Tomé and Príncipe (Gulf of Guinea, Africa): Conservation and Management Status / R. Haroun, A. Herrero Barrencua, and A. D. Abreu 28 The Success of Hydrological Rehabilitation in Mangrove Wetlands Using Box Culverts Across Coastal Roads in Northern Yucatán (SE, México) / Claudia Teutli-Hernández and Jorge A. Herrera-Silveira 29 Mangroves on the Brazilian Amazon Coast: Uses and Rehabilitation / Marcus E. B. Fernandes, Francisco Pereira Oliveira, and Indira A. L. Eyzaguirre 30 Mangrove Restoration and Mitigation After Oil Spills and Development Projects in East Africa and the Middle East / David I. Little 31 Environmental Governance As a Framework for Mangrove Sustainability on the Brazilian Amazon Coast / Indira A. L. Eyzaguirre and Marcus E. B. Fernandes Erratum Index

Note: Contents: 1 The ecosystem of Kongsfjorden, Svalbard / Haakon Hop and Christian Wiencke Part I. Atmospheric conditions 2 The atmosphere above Ny-Ålesund : climate and global warming, ozone and surface UV radiation / Marion Maturilli, Inger Hanssen-Bauer, Roland Neuber, Markus Rex, and Kåre Edvardsen Part II. Oceanography, sea ice and underwater light regime 3 The Kongsfjorden Transect : seasonal and inter-annual variability in hydrography / Vigdis Tverberg, Ragnheid Skogseth, Finlo Cottier, Arild Sundfjord, Waldemar Walczowski, Mark E. Inall, Eva Falck, Olga Pavlova, and Frank Nilsen 4 Changes in sea-ice extent and thickness in Kongsfjorden, Svalbard (2003-2016) / Olga Pavlova, Sebastian Gerland, and Haakon Hop 5 The underwater light climate in Kongsfjorden and its ecological implications / Alexey K. Pavlov, Eva Leu, Dieter Hanelt, Inka Bartsch, Ulf Karsten, Stephen R. Hudson, Jean-Charles Gallet, Finlo Cottier, Jonathan H. Cohen, Jørgen Berge, Geir Johnsen, Marion Maturilli, Piotr Kowalczuk, Sławomir Sagan, Justyna Meler, and Mats A. Granskog Part III. Pelagic production, phytoplankton and zooplankton 6 Phytoplankton seasonal dynamics in Kongsfjorden, Svalbard and the adjacent shelf / Else N. Hegseth, Philipp Assmy, Józef M. Wiktor, Józef Wiktor Jr., Svein Kristiansen, Eva Leu, Vigdis Tverberg, Tove M. Gabrielsen, Ragnheid Skogseth, and Finlo Cottier 7 Zooplankton in Kongsfjorden (1996-2016) in relation to climate change / Haakon Hop, Anette Wold, Mikko Vihtakari, Malin Daase, Slawomir Kwasniewski, Marta Gluchowska, Silke Lischka, Friedrich Buchholz and Stig Falk-Petersen Part IV. Benthic microbes, macroalgae and fauna 8 Living on cold substrata : new insights and approaches in the study of microphytobenthos ecophysiology and ecology in Kongsfjorden / Ulf Karsten, Iris Schaub, Jana Woelfel, Duygu S. Sevilgen, Carolin Schlie, Burkhard Becker, Angela Wulff, Martin Graeve, and Heiko Wagner 9 Biodiversity of benthic macro- and microalgae from Svalbard with special focus on Kongsfjorden / Stein Fredriksen, Ulf Karsten, Inka Bartsch, Jana Woelfel, Miriam Koblowsky, Rhena Schumann, Siri Røang Moy, Robert S. Steneck, Józef M. Wiktor, Haakon Hop, and Christian Wiencke 10. Kelps and environmental changes in Kongsfjorden : Stress perception and responses / Kai Bischof, Christian Buschbaum, Stein Frederiksen, Francisco J. L. Gordillo, Sandra Heinrich, Carlos Jiménez, Cornelius Lütz, Markus Molis, Michael Y. Roleda, Max Schwanitz, and Christian Wiencke 11. Ecological drivers of and responses by Arctic benthic communities, with an emphasis on Kongsfjorden, Svalbard / Markus Molis, Frank Beuchel, Jürgen Laudien, Maria Włodarska-Kowalczuk, and Christian Buschbaum Part V. Arctic fjord ecosystem model and autonomous marine observatories. 12. Outline of an Arctic fjord ecosystem model for Kongsfjorden-Krossfjorden, Svalbard / Pedro Duarte, Jan Marcin Weslawski, and Haakon Hop 13. Autonomous marine observatories in Kongsfjorden, Svalbard / Haakon Hop, Finlo Cottier, and Jørgen Berge Part VI. Kongsfjorden as harbinger of the future Arctic 14. Kongsfjorden as harbinger of the future Arctic : knowns, unknowns and research priorities / Kai Bischof, Peter Convey, Pedro Duarte, Jean-Pierre Gattuso, Maria Granberg, Haakon Hop, Clara Hoppe, Carlos Jiménez, Leonid Lisitsyn, Brezo Martinez, Michael Y. Roleda, Peter Thor, Józef M. Wiktor, and Geir Wing Gabrielsen

Note: Contents Part I Atmosphere-Ocean Interaction and Physical Oceanography 1 Geostrophic and Wind-Driven Components of the Antarctic Circumpolar Current / Nikolay A. Diansky, Varvara V. Bagatinskaya, Anatoly V. Gusev, and Eugene G. Morozov 2 Multi-jet Structure of the Antarctic Circumpolar Current / Roman Yu Tarakanov 3 Frontal Zone Between Relatively Warm and Cold Waters in the Northern Weddell Sea / Eugene G. Morozov, Viktor A. Krechik, Dmitry I. Frey, Alexander A. Polukhin, Vladimir A. Artemiev, Valentina V. Kasyan, Philipp V. Sapozhnikov, and Rinat Z. Mukhametianov 4 Water Masses, Currents, and Phytoplankton in the Bransfield Strait in January 2020 / Eugene G. Morozov, Dmitry I. Frey, Viktor A. Krechik, Alexander A. Polukhin, and Philipp V. Sapozhnikov 5 Intra-annual Variability of Water Structure in the Atlantic Sector of the Southern Ocean Based on the ECMWF ORA-S3 and OI SST Reanalysis / Yuri V. Artamonov, Elena A. Skripaleva, Alexander V. Fedirko, and Nikolay V. Nikolsky 6 The Circulation and Mixing Zone in the Antarctic Sound in February 2020 / Alexander V. Krek, Elena V. Krek, and Viktor A. Krechik 7 Rogue Waves in the Drake Passage: Unpredictable Hazard / Ekaterina G. Didenkulova, Tatiana G. Talipova, and Efim N. Pelinovsky 8 Water Mass Transformation in the Powell Basin / Alina A. Fedotova and Svetlana V. Stepanova 9 Interannual Variations of Water Mass Properties in the Central Basin of the Bransfield Strait / Alina A. Fedotova and Sergey V. Kashin 10 Sea Surface Temperature and Ice Concentration Analysis Based on the NOAA Long-Term Satellite and Sea-Truth Data in the Atlantic Antarctic / Viktor V. Zamshin and Vladislav A. Shliupikov Part II Chemical Oceanography, Seawater Optical Properties, Productivity and Microbial Processes 11 Hydrochemical Structure of Waters in the Northern Weddell Sea in Austral Summer 2020 / Svetlana V. Stepanova, Alexander A. Polukhin, Gennadii V. Borisenko, Anna L. Chultsova, Evgeniia N. Marina, Oleg S. Popov, Anna M. Seliverstova, Anna V. Vidnichuk, and Petr P. Tishchenko 12 Features and Processes of the Oxygen and pCO2 Dynamics in the Surface Waters in the Western Parts of the Weddell and Scotia Seas (Southern Ocean) / Natalia A. Orekhova, Anna V. Vidnichuk, and Sergey K. Konovalov 13 Earth’s Insolation and Spatiotemporal Variability of Albedo in the Antarctic / Anton A. Bukatov and Margarita V. Babiy 14 Quantitative and Productional Characteristics of Microplankton in the Powell Basin and Bransfield Strait in Summer / Nadezda D. Romanova, Sergey A. Mosharov, Olga V. Vorobieva, and Elena V. Bardyukova 15 Detection of Thermophilic Methanotrophic Microbial Communities in the Water Column of the Bransfield Strait (Antarctica) / Anna L. Ponomareva, Nikita S. Polonik, Aleksandra V. Kim, and Renat B. Shakirov 16 Spectral Bio-optical Properties of Waters in the Bransfield Strait and Powell Basin / Tanya Ya Churilova, Nataliia A. Moiseeva, Tatiana V. Efimova, Vladimir A. Artemiev, Elena Y. Skorokhod, and Anatoly S. Buchelnikov 17 Variability of Seawater Optical Properties in the Adjacent Water Basins of the Antarctic Peninsula in January and February 2020 / Alexandr A. Latushkin, Vladimir A. Artemiev, Anton V. Garmashov, Pavel A. Salyuk, Inna V. Sahling, and Dmitry I. Glukhovets 18 Bio-Optical Models for Estimating Euphotic Zone Depth in the Western Atlantic Sector of the Southern Ocean in the Antarctic Summer / Pavel A. Salyuk, Vladimir A. Artemiev, Dmitry I. Glukhovets, Alexander N. Khrapko, Anatoly V. Grigoriev, Alexandr A. Latushkin, and Nadezda D. Romanova 19 Phycoerythrin Pigment Distribution in the Upper Water Layer Across the Weddell-Scotia Confluence Zone and Drake Passage / Pavel A. Salyuk, Dmitry I. Glukhovets, Alexander Yu. Mayor, Natalia A. Moiseeva, Vladimir A. Artemiev, and Alexander N. Khrapko 20 Nanophytoplankton in the Bransfield Strait: Contribution of Cryptophyta to the Community Abundance and Biomass During Austral Summer / Vladimir S. Mukhanov, Evgeny G. Sakhon, Aleksander A. Polukhin, and Vladimir A. Artemiev Part III Section Marine Ecosystems and Their Oceanographical Background 21 Phytopelagic Communities of the Powell Basin in the Summer of 2020 / Philipp V. Sapozhnikov, Olga Yu. Kalinina, and Tatiana V. Morozova 22 Bioluminescence in the Atlantic Sector of the Southern Ocean Based on the Field Observations and Sounding Data / Aleksandr V. Melnik, Viktor V. Melnikov, Lidiya A. Melnik, Olga V. Mashukova, and Sergei V. Kapranov 23 Parasites as an Inseparable Part of Antarctic and Subantarctic Marine Biodiversity / Tatyana A. Polyakova and Ilya I. Gordeev 24 Spatial Distribution, Species Composition, and Number of Seabirds in the Argentine Basin, Drake Passage, East of Antarctic Peninsula, and Powell Basin in January–March 2020 / Sergey P. Kharitonov, Alexander L. Mischenko, Nikolai B. Konyukhov, Alexander E. Dmitriyev, Andrey V. Tretyakov, Gleb Yu. Pilipenko, Svetlana M. Artemyeva, and Matvey S. Mamayev 25 Spatial Distribution, Species Composition, and Number of Marine Mammals in the Argentine Basin, Drake Passage, East of Antarctic Peninsula, and Powell Basin in January–March 2020 / Sergey P. Kharitonov, Andrey V. Tretyakov, Alexander L. Mischenko, Nikolai B. Konyukhov, Svetlana M. Artemyeva, Gleb Yu. Pilipenko, Matvey S. Mamayev, and Alexander E. Dmitriyev 26 Meat in the Ocean: How Much and Who Is to Blame? / Sergey P. Kharitonov, Andrey V. Tretyakov, and Alexander L. Mischenko 27 Macro- and Mesozooplankton in the Powell Basin (Antarctica): Species Composition and Distribution of Abundance and Biomass in February 2020 / Vladimir A. Yakovenko, Vassily A. Spiridonov, Konstantin M. Gorbatenko, Nickolai V. Shadrin, Ernest Z. Samyshev, and Natalia I. Minkina 28 Application of Autonomous Underwater Vehicles for Research of Ecosystems in the Southern Ocean / Alexander Yu. Konoplin, Alexey I. Borovik, Denis N. Mikhailov, Yuriy V. Vaulin, Alexander F. Scherbatyuk, Alexey A. Boreiko, Roman A. Babaev, Dmitriy A. Bolovin, and Dmitriy I. Tregubenko 29 Heavy Metals and Anthropogenic Radionuclides in the Region of the Antarctic Peninsula / Artem A. Paraskiv, Natalia Yu. Mirzoeva, Nataliya N. Tereshchenko, Vladislav Yu. Proskurnin, Ilya G. Sidorov, Svetlana I. Arkhipova, and Eugene G. Morozov

Note: Dittfeld, H.-J.: Results of an eight years' gravimetric earth tide registration series at Potsdam Elstner, C.; Harnisch, M.; Schwahn, W.: On the determination of the gravimetric Mf tide at Potsdam

Note: Contents Additives and Chemicals in Plastics / Anthony L. Andrady and Nepali Rajapakse Food Containers and Packaging Materials as Possible Source of Hazardous Chemicals to Food / Evangelia Manoli and Dimitra Voutsa Release of Additives and Monomers from Plastic Wastes / Charita S. Kwan and Hideshige Takada Degradation of Various Plastics in the Environment / Kalliopi N. Fotopoulou and Hrissi K. Karapanagioti Occurrence of Marine Litter in the Marine Environment: A World Panorama of Floating and Seafloor Plastics / Christos Ioakeimidis, François Galgani, and George Papatheodorou Sources, Distribution, and Fate of Microscopic Plastics in Marine Environments / Richard C. Thompson Nature of Plastic Marine Pollution in the Subtropical Gyres / Marcus Eriksen, Martin Thiel, and Laurent Lebreton Hazardous Chemicals in Plastics in Marine Environments: International Pellet Watch / Rei Yamashita, Kosuke Tanaka, Bee Geok Yeo, Hideshige Takada, Jan A. van Franeker, Megan Dalton, and Eric Dale Sorption of Hydrophobic Organic Compounds to Plastics in the Marine Environment: Equilibrium / Satoshi Endo and Albert A. Koelmans Sorption of Hydrophobic Organic Compounds to Plastics in the Marine Environment: Sorption and Desorption Kinetics / Hrissi K. Karapanagioti and David Werner Biofilms on Plastic Debris and Their Influence on Marine Nutrient Cycling, Productivity, and Hazardous Chemical Mobility / Tracy J. Mincer, Erik R. Zettler, and Linda A. Amaral-Zettler Ingestion of Plastics by Marine Organisms / Peter G. Ryan Transfer of Hazardous Chemicals from Ingested Plastics to Higher-Trophic-Level Organisms / Kosuke Tanaka, Rei Yamashita, and Hideshige Takada The Role of Plastic Debris as Another Source of Hazardous Chemicals in Lower-Trophic Level Organisms / Chelsea M. Rochman Conclusions of “Hazardous Chemicals Associated with Plastics in Environment” / Hrissi K. Karapanagioti and Hideshige Takada Erratum to: Food Containers and Packaging Materials as Possible Source of Hazardous Chemicals to Food / Evangelia Manoli and Dimitra Voutsa Index

Note: Contents 1 Solar Thermal Energy Production in DSF Applied in the Human Comfort Improvements / Eusébio Conceição, Ma Inês Conceição, Ma Manuela Lúcio, João Gomes, André Ramos, and Hazim Awbi 2 Hydraulics Geometry Analysis of UPNM Channel / Zuliziana Suif, Saiful Syazwan Wahi Anuar, Nordila Ahmad, Maidiana Othman, and Siti Khadijah Che Osmi 3 Productivity Enhancement of Solar Still Distillation System Using Immersion-Type Water Heater / Nordila Ahmad, Norhasirah Mohd Isa, Zuliziana Suif, Maidana Othman, Jestin Jelani, and Jaafar Adnan 4 Stability Analysis of a Man-Made Slope: A Case Study on the UPNM Campus, Sg Besi, Kuala Lumpur / Jestin Jelani, Mohamad Saiful Adli Hah, Mohd Nazrin Mohd Daud, Nordila Ahmad, Maidiana Othman, and Wan Mohamed Syafuan Wan Mohamed Sabri 5 Comparison of the Full-Scale Municipal Wastewater Treatment Plant Designs Consisting of Modified Bardenpho Process with and Without Membrane Bioreactor for Nutrient Removal: Cost Analysis / Shahryar Jafarinejad 6 Analysis of the Influence of Wax Precipitation and Paraffin Control Technology on Environmental Protection / Deyin Zhao, Yi Zhao, Rongqiang Zhong, Lirong Yao, and Gaojie Liang 7 Impact of Abandoned Oil Well on Ecological Environment and Analysis of Geothermal Exploitation / Lirong Yao, Yi Zhao, Deyin Zhao, Rongqiang Zhong, and Jinbao Li 8 Numerical Evaluation of the Temperature Distribution in a Tree Trunk in a Forest Fire Environment / Eusébio Conceição, João Gomes, Maria Manuela Lúcio, Jorge Raposo, Domingos Xavier, and Maria Teresa Viegas 9 Analysis of Soluble Organic Polar Fractions from Sea Salt by GC–MS / Guo-hua Chang, Kang-ping Zhao, Bin Yue, Zhuo-xin Yin, Xiao-ke Li, and Hai-li Sun 10 Microplastics in Industrial Wastewater Treatment Plants: Dynamic Distribution, Seasonal Variation, and Removal Efficiencies / Sujarat Saiwaree and Vorapot Kanokkantapong 11 Spatial–Temporal Variation Analysis on Ecosystem Service Values in a Typical Inland River Basin, Northwest China / Mingtao Li, Lingfen Kang, and Chuancheng Zhao 12 Transportation of Chromium(VI) from Hydrochloric Acid Medium via a Dispersion Supported Liquid Membrane Using N235 / Yingxue Li, Yijian Zhong, Jiaheng Wu, Qingsong Shao, Xiaoyan Chen, and Yan Zhu 13 Effects of Important Factors on Determination of Metals in Soil Samples Using Hand-Held X-ray Fluorescence / Zhuoxin Yin, Yijun Wen, Weidong Chen, Fanxiang Han, Guohua Chang, and Caiping Yao 14 Collaboration Mapping in Sustainable Development: A Case Study from Haze in Chiang Mai / Pongtip Thiengburanathum 15 Greywater Treatment in Continuous Flow Solar Photocatalytic Reactor Using Graphite Supported Nitrogen-Doped TiO2 / Kumari Priyanka, Neelancherry Remya, and Manaswini Behera 16 Effect of Current and Electrodes Area to Color Removal Efficiency and Energy Consumption by Electrocoagulation Process / Bang-on Nareerob and Ponlakit Jitto 17 Accessing the Sustainable Developments Principle of Protection of the Mekong River’s Water Resources / Thuy Hang Tran, Hong Hanh Pham, and Thanh Hoa Ha 18 Key Technology and Economic Analysis of Using Fujiang River Water as the Cooling and Heating Sources for Air Conditioning System / Zhang Wei, Fu Daoyou, Yao Mingqiang, and Gan Shiyuan 19 Highly Effective Magnetic Silica-Chitosan Hybrid for Sulfate Ion Adsorption / Sukamto, Yuichi Kamiya, Bambang Rusdiarso, and Nuryono 20 Statistical Analysis of Water and Sediment Research in Heilongjiang River Basin / Ning Yu, Lei Zhang, Jun Li, and Yousheng Wang 21 Empowering Citizens’ Resilience - The FLOODLABEL / P. Meier, H. Meyer, A. Schüttrumpf, and G. Johann 22 Sustainable Environmental Planning of a Tourist Destination Bulgaria - State and Trends / Elenita Velikova 23 Analytical Approach for Sustainable Multi-Objective Management of Sediment-Algae Dynamics / Hidekazu Yoshioka and Saya Hashimoto 24 From Convergent to Ecological Transition—Challenges for the Management and Regional Development of Bulgaria / Georgi Tsolov and Nikola Tanakov 25 Comparison Methods of Carbon Oil Sorbents Hardening / Elena Ushakova, Liliya Soloveva, and Andrey Ushakov 26 Integration of Experimental and Numerical Methods to Investigate the Effect of Hydraulic Retention Time on Ultrafiltration Membrane Fouling / Meng Yao, Ting Chen, Zhilin Ran, Xiaoqing Dong, and Guosheng Wang 27 Using Electrodialysis to Recycle Chemical Polishing Agent from Anodizing Industry / Jih-Hsing Chang, Mohanraj Kumar, and Shan-Yi Shen 28 Methodological Aspects of Strategic Regional Planning for Achieving Sustainable Development in Bulgaria / Georgi Nikolov, Elka Vasileva, and Desislava Botseva 29 Study on the Model of Construction Safety Risk Evaluation Coupling Multiple Factors in Navigable Waters / Hui Sun, Yuchi Hao, Jiaming Qu, Ping Zhu, and Runli Tao 30 Distribution Characteristics of Plastic Particles in Coastal and Beach of Hsinchu, Taiwan / Ying-Fang Hsu, Feng-Hsin Chang, Pei-Yi Feng, Hsiao-Chien Huang, Chi-Yu Chuang, Shinhao Yang, and Wei-Ting Liu

Note: Contents 1 Introduction References 2 Meteorology as a Natural Science 2.1 Definition of the Atmosphere 2.2 Methods of Research of the Atmosphere 2.2.1 Experimental Method of Research 2.3 Relationship Between Meteorology and Other Sciences 2.4 Classification of Meteorology 2.4.1 Classification Based on the Studied Area 2.4.2 Classification According to the Scale of Processes 2.5 The Modern Term of Meteorology References 3 Historical Background 3.1 Aristotle’s Meteorologica 3.2 Early Research Period 3.3 Modern Research Period References 4 Structure and Composition of the Atmosphere 4.1 Earth Spheres 4.2 Basic Characteristics of the Atmosphere 4.3 Origin of the Atmosphere 4.4 Chemical Composition of the Atmosphere 4.5 Significant Atmospheric Gases 4.5.1 General Facts About the Atmosphere 4.6 Atmospheric Structure 4.6.1 Thermal Structure of the Atmosphere 4.7 Magneto-electronic Structure References 5 Energy and Radiation 5.1 Basic Features 5.2 Radiation Laws 5.3 Electromagnetic Radiation 5.4 Solar Radiation 5.4.1 Solar Constant 5.4.2 Direct Solar Radiation 5.4.3 Diffused Solar Radiation (D) 5.4.4 Solar Radiation Factors 5.4.5 Temporal and Spatial Changes in Insolation 5.5 Optical Radiation 5.5.1 UV Index 5.5.2 UV Index Factors 5.6 Ozone Layer 5.7 Earth Longwave Radiation 5.7.1 Earth’s Annual and Global Mean Energy Budget 5.7.2 Earth’s Heat Balance 5.7.3 Earth Radiation Budget and the Planetary Temperature 5.7.4 The Simple Greenhouse Model References 6 Atmospheric Thermodynamics 6.1 Definition 6.1.1 Thermodynamic System 6.2 An Ideal Gas Law 6.2.1 The Equation of State of Dry Air 6.2.2 The Equation of State of Moist Air 6.3 First Principle of Thermodynamics 6.3.1 The First Principle of Thermodynamics for an Ideal Gas 6.3.2 Enthalpy 6.3.3 Poisson Equations 6.3.4 Potential Temperature 6.3.5 Implementation of the First Principle of Thermodynamics 6.4 The Second Principle of Thermodynamics 6.4.1 Definition of Entropy 6.4.2 Summary on Reversible and Irreversible Processes References 7 Air Temperature 7.1 Air Temperature Definition 7.2 Heat and Temperature 7.2.1 Heat Transfer 7.3 Temperature Factors 7.3.1 Heat Advection 7.4 Temperature Changes 7.4.1 Daily Insolation and Pure Radiation 7.4.2 Daily Air Temperature Distribution 7.4.3 Vertical Temperature Change 7.4.4 Adiabatic Changes of Temperature 7.4.5 Temperature Inversion 7.4.6 Global Distributions of Temperature 7.4.7 Surface Temperatures 7.4.8 Urban Heat Island 7.5 Temperature Scales 7.6 Isotherms 7.7 Latitudinal Heat Balance References 8 Atmospheric Pressure and Wind 8.1 Mass of the Atmosphere 8.2 Definition of Atmospheric Pressure 8.3 Geopotential 8.4 Barometric Pressure Distribution 8.4.1 Pressure Gradient 8.4.2 Isobars 8.4.3 Isohypses 8.4.4 Hydrostatic Balance 8.5 Pressure Systems 8.6 Daily Pressure Distribution 8.7 Reduction of the Surface Pressure to Mean Sea Level Pressure (MSL) 8.8 Hydrostatic Equilibrium (Approximation) 8.9 Standard Atmosphere 8.10 Barotropic vs Baroclinic Atmosphere 8.11 Reduction on Atmospheric Pressure to Mean Sea Level Pressure 8.12 Stream Field 8.13 Definition of Wind 8.14 Classification of the Winds 8.14.1 Permanent Wind 8.14.2 Trade Winds 8.14.3 Anti-trade Winds 8.14.4 Periodic Winds 8.14.5 Local Winds 8.14.6 Land and Sea Breezes 8.14.7 Mountain and Valley Winds 8.14.8 Katabatic Winds References 9 Atmospheric Stability 9.1 Air Stability 9.2 Static Atmospheric Stability 9.3 Stability Due to Air Movement 9.4 Convective Instability 9.5 Low-Level Inversions References 10 Atmospheric Moisture 10.1 Water Vapour in the Atmosphere 10.2 Air Moisture Quantities 10.3 The Relative Humidity 10.4 The Moisture Deficit 10.5 A Dew Point Temperature 10.6 The Phase Changes 10.7 Condensation and Evaporation References 11 Clouds and Precipitation 11.1 Formation of Clouds 11.1.1 Air Saturation Mechanism 11.1.2 Adiabatic Cooling 11.1.3 Water Vapour Supply by Air Mixing 11.1.4 Mixing and Diffusion 11.1.5 Diabatic Cooling 11.1.6 Formation of Cloud Elements 11.1.7 Precipitation 11.1.8 The Mechanism of Ice Nucleation 11.1.9 Classification of the Microprocesses 11.2 Cloud Definition and Classification 11.2.1 Cloud Classification 11.2.2 Cloud Classification by Form 11.2.3 Cloud Classification Based on Height 11.2.4 International Cloud Classification 11.2.5 Cloud Classification by Composition 11.2.6 Classification by Mechanism of Formation 11.2.7 Special Clouds 11.3 Fog 11.3.1 Fog Types and Formation 11.4 Hydrometeors 11.4.1 Precipitation 11.4.2 Orographic Rainfall 11.4.3 Convective Rainfall 11.4.4 Frontal Rainfall References 12 Atmospheric Motion 12.1 Real Forces 12.1.1 Pressure Gradient Force 12.1.2 Gravity 12.1.3 Friction 12.2 The Forces That Are the Effects of Earth’s Rotation 12.2.1 Centrifugal Force 12.2.2 Coriolis Force (C) 12.3 Some Common Resultant Forces 12.3.1 Earth’s Gravity Force 12.3.2 Buoyancy Force 12.4 Atmospheric Motion 12.4.1 The Equation of Motion in a System Rotating Together with the Earth 12.5 Application of the Equations of Horizontal Motion 12.5.1 Geostrophic Wind (V g) 12.5.2 Thermal Wind (V T ) 12.5.3 Gradient Wind 12.5.4 Quasi-geostrophic Equations of Motion 12.6 Vertical Motions in the Atmosphere 12.7 Vorticity Equation 12.8 Basic Characteristics of Vorticity 12.8.1 Positive Vorticity Advection PVA and Upward Air Motion References 13 Atmospheric Waves 13.1 Waves: General Features 13.2 Wave Equation 13.2.1 Mathematical Description of 1-D Waves 13.3 Atmospheric Waves 13.3.1 History Studying Atmospheric Waves 13.3.2 Atmospheric Waves: Definition 13.3.3 Factors that Form a Wave 13.3.4 Basic Wave Properties and Classification 13.4 The Mathematical Concept of Atmospheric Waves 13.4.1 Atmospheric Sound Waves 13.4.2 Gravity Waves 13.4.3 Inertial-Gravity Waves 13.4.4 Rossby Waves References 14 Atmospheric Boundary Layer (ABL) 14.1 ABL Historical Overview 14.2 ABL Definition and Basic Characteristics 14.2.1 ABL Significance 14.3 ABL Structure 14.3.1 Surface Layer 14.3.2 Mixing Layer 14.3.3 Residual Layer 14.3.4 Stable Boundary Layer 14.3.5 Free Atmosphere 14.4 Factors Influence on ABL Structure 14.4.1 The Neutral PBL 14.4.2 The Ekman Wind Spiral 14.4.3 Unstable Stratified Atmospheric Boundary Layer References 15 General Circulation of the Atmosphere 15.1 General Atmospheric Circulation Definition 15.2 Conceptual Model of the General Atmospheric Circulation 15.3 Three-Cell Model of Circulation 15.3.1 Circulation in Hadley Cell 15.3.2 Intertropical Convergence Zone 15.3.3 Zonal Pressure Patterns 15.3.4 Upper Tropospheric Wind and Pressure Patterns 15.4 The Wind Patterns 15.4.1 Eastern and Western Winds 15.5 Global Distribution of Pressure, Rainfall, and Climate 15.6 Ocean Circulation 15.6.1 Major Ocean Currents 15.7 Ocean Waves 15.8 Large-Scale Circulation Modes 15.8.1 North Atlantic (NAO) and Artic Oscillation (AO) 15.8.2 El Niño-Southern Oscillation 15.8.3 La Nina 15.9 Winds at the Regional Scale: Monsoon 15.10 Jet Streams 15.10.1 A Waiver Jet Stream 15.11 Rossby Planetary Waves References 16 Air Masses and Fronts 16.1 Definition of Air Masses 16.1.1 Air Mass Source Region 16.1.2 Formation Criteria 16.2 Air Mass Classification 16.2.1 Polar Continental and Artic Continental Air Masses (cP and cA) 16.2.2 Maritime Polar Air Masses (mP) 16.2.3 Tropical Maritime Air Masses (mT) 16.3 Air Mass Modification 16.4 Fronts (Frontal Boundaries) 16.4.1 Types of Weather Fronts 16.4.2 Occluded Fronts References 17 Cyclones and Anticyclones 17.1 General Terms 17.2 Low-Pressure Systems: Cyclones 17.2.1 Formation of Extratropical Cyclone 17.2.2 Life Cycle of the Extratropical Cyclone 17.2.3 Cyclone Movement 17.2.4 Upper Level Low 17.3 High-Pressure System: Anticyclone 17.4 Weather Conditions Associate with Cyclones and Anticyclones References 18 Tropical Storms 18.1 General Overview 18.2 Tropical Cyclone Formation 18.2.1 General Factors 18.2.2 The Basic Ingredients 18.3 Areas of Formation 18.4 Classification of Tropical Cyclones 18.5 Tropical Storm Structure 18.5.1 Cyclonic Eye 18.5.2 Eyewall

Note: Contents The Impact of Microplastics on Filter-Feeding Megafauna / Maria Cristina Fossi, Matteo Baini, and Cristina Panti Microplastic Contamination of Sediment and Water Column in the Seine River Estuary / Soline Alligant, Johnny Gasperi, Aline Gangnery, Frank Maheux, Benjamin Simon, Marie-Pierre Halm-Lemille, Maria El Rakwe, Catherine Dreanno, Jérôme Cachot, and Bruno Tassin Plastic Debris in Urban Water and in Freshwater: Lessons Learned from Research Projects Launched in the Seine Basin Catchment / Johnny Gasperi, Soline Alligant, Rachid Dris, Romain Tramoy, Robin Treilles, and Bruno Tassin Insights on Ecotoxicological Effects of Microplastics in Marine Ecosystems: The EPHEMARE Project / Francesco Regoli, Marina Albentosa, Carlo Giacomo Avio, Annika Batel, Maria João Bebianno, Marie-Laure Bégout, Ricardo Beiras, Juan Bellas, Ronny Blust, Agathe Bour, Thomas Braunbeck, Jérôme Cachot, Camilla Catarci Carteny, Bettie Cormier, Xavier Cousin, Alberto Cuesta, María Ángeles Esteban, Marco Faimali, Chiara Gambardella, Francesca Garaventa, Stefania Gorbi, Lúcia Guilhermino, Ketil Hylland, Steffen H. Keiter, Kathrin Kopke, Bénédicte Morin, Alexandre Pacheco, Lucia Pittura, Raewyn M. Town, and Luis R. Vieira What Can Model Polystyrene Nanoparticles Can Teach Us on the Impact of Nanoplastics in Bivalves? Studies in Mytilus from the Molecular to the Organism Level / Manon Auguste, Teresa Balbi, Caterina Ciacci, and Laura Canesi In Vitro Effects of Mercury (Hg) on the Immune Function of Mediterranean Mussel (Mytilus Galloprovincialis) Are Enhanced in Presence of Microplastics in the Extracellular Medium / Concepción Martínez-Gómez, Juan Santos-Echeandía, José R. Rivera-Hernández, Ramón Ortuño, Marina Albentosa, and Víctor M. León Study of Chemical Pollutants over Marine Microplastics Based on Their Composition and Degradation Rate / Bárbara Abaroa-Pérez, Daura Vega-Moreno, and J. Joaquín Hernández-Brito Marine Litter: Are There Solutions to This Environmental Challenge? / Richard C. Thompson and Francesca De Falco Development of a Thermo Degradation Method to Assess Levels and Distribution of Microplastics in Marine Sediments and Its Application in Two Case Studies: The Northern Adriatic Sea (Italy) and Boknafjord (Norway) / Alessio Gomiero, Kjell Birger Øysæd, Pierluigi Strafella, Gianna Fabi, and Giuseppe Scarcella Microplastics Extraction and Counting from Wastewater and Sludge Through Elutriation and Hydrocyclone / Rubén Rodríguez-Alegre, Javier Eduardo Sánchez-Ramírez, Laura Pastor, Silvia Doñate, Adrián Marí, Abel Lara, and Edxon Licon Microfiber Pollution from Source to Mitigation / Francesca De Falco, Emilia Di Pace, Gennaro Gentile, Roberto Avolio, Maria Emanuela Errico, Maurizio Avella, and Mariacristina Cocca Textile Fibres in Mediterranean Surface Waters: Abundance and Composition / Giuseppe Suaria, Marta Musso, Aikaterini Achtypi, Deborah Bassotto, and Stefano Aliani When Size Matters – Textile Microfibers into the Environment / Francisco Belzagui, Carmen Gutiérrez-Bouzán, Antonio Álvarez-Sánchez, and Mercedes Vilaseca Derelict Fishing Gear – Removing a Source of Microplastics from the Marine Environment / Andrea Stolte, Jochen Lamp, Gabriele Dederer, Falk Schneider, Marta Kalinowska, Sylwia Migdal, Marek Press, Vesa Tschernij, and Andreas Frössberg Biodegradable Plastics Do not Form Chemically Persistent Microplastics / Francesco Degli Innocenti Controlled Aging and Degradation of Selected Plastics in Marine Environment: 12 Months of Follow-up / Luca Fambri, Roberto Caria, Fabrizio Atzori, Riccardo Ceccato, and Denis Lorenzi Inhalable Microplastics: A New Cause for Concern? / Frank J. Kelly, Joseph Levermore, and Stephanie Wright Microplastics and Nanoplastics Occurrence and Composition in Drinking Water from Akureyri Urban Area, Iceland / Ásta Margrét Ásmundsdóttir, Alessio Gomiero, and Kjell Birger Øysæd Association of Potential Human Pathogens with Microplastics in Freshwater Systems / Loriane Murphy, Kieran Germaine, David N. Dowling, Thomais Kakouli-Duarte, and John Cleary Sample Preparation and Analysis Methods of Microplastics / Tiziano Battistini, Masenka Mikuz, Giulia Dalla Fontana, Alessio Montarsolo, and Raffaella Mossotti INTO THE MED: Searching for Microplastics from Space to Deep-Sea / Catharina Pieper, Ana Martins, Erik Zettler, Clara Magalhães Loureiro, Victor Onink, Anu Heikkilä, Alexandre Epinoux, Ethan Edson, Vincenzo Donnarumma, Fons de Vogel, Kara Lavender Law, and Linda Amaral-Zettler Analysis of Marine Microplastics in the Water Column Sampled up to 300 M Depth / Daura Vega-Moreno, Bárbara Abaroa-Pérez, and J. Joaquín Hernández-Brito Macro and Microplastics in Stormwater and Combined Sewer Overflows in Paris Megacity / Robin Treilles, Johnny Gasperi, Mohamed Saad, Alain Rabier, Jérôme Breton, Vincent Rocher, Sabrina Guérin, and Bruno Tassin The Effect of Drinking Water Ozonation on Different Types of Submicron Plastic Particles / Gerardo Pulido-Reyes, Denise M. Mitrano, Ralf Kägi, and Urs von Gunten Microplastic in Coastal Areas - Impact of Waves, Sediments and Saltwater on the Degradation Behaviour / Maximilian P. Born and Holger Schüttrumpf The Role of Humic Acids on the Effects of Nanoplastics in Fish / I. Brandts, J. C. Balasch, A. Tvarijonaviciute, A. Barreto, M. A. Martins, L. Tort, M. Oliveira, and M. Teles Preliminary Data on the Polymer Type Identification from Estuarine Environmental Samples / Gonçalo Brás Gomes, Vanessa Morgado, and Carla Palma Qualitative and Quantitative Screening of Organic Pollutants Associated on Microplastics from Ofanto River (South Italy) / Claudia Campanale, Giuseppe Bagnuolo, Georg Dierkes, Carmine Massarelli, and Vito Felice Uricchio Assessment of Microplastic Pollution in Sarno River / Francesca De Falco, Emilia Di Pace, Gennaro Gentile, Rachele Castaldo, Roberto Avolio, Maria Emanuela Errico, Maurizio Avella, Giancarlo Chiavazzo, Mariateresa Imaparato, Francesca Montuoro, Luca Pucci, Stefania Di Vito, and Mariacristina Cocca Holistic Approach to the Marine Microplastics: Sampling, Characterization, Consequences / Agnieszka Dąbrowska Marine Microplastics at Santuario Pelagos / Agnieszka Dąbrowska Microplastics Uptake and Egestion Dynamics in Pacific Oysters, Magallana Gigas (Thunberg, 1793), Under Controlled Conditions / Philip Graham, Luca Palazzo, Stefano Carboni, Trevor Telfer, Maura Baroli, and Giuseppe Andrea de Lucia Extraction Protocol Optimization for Detection of Microplastics in Digestive System Contents of Loggerhead Turtle (Caretta Caretta) / Ludovica Di Renzo, Giuseppina Mascilongo, Federica Di Giacinto, Daniela Zezza, Gabriella Di Francesco, Vincenzo Olivieri, Miriam Berti, Antonio Petrini, and Nicola Ferri Study of Plastics Debris Collected on the North Beaches of the Garda Lake After the Severe Storm Vaia in Autumn 2018 / Luca Fambri, Giada Bombardelli, Claudia Gavazza, Alfredo Casagranda, Paola Battocchi, and Renzo Tomasi Microplastics and Polycyclic Aromatic Hydrocarbons Occurrence in a Demersal Fish (Solea solea) in the Adriatic Sea / Emanuela Frapiccini, Giulio Pellini, Alessio Gomiero, Giuseppe Scarcella, Stefano Guicciardi, Anna Annibaldi, Mattia Betti, and Mauro Marini Ecotoxicological Effects of Microplastics in Marine Zooplankton / Silvia Morgana, Chiara Gambardella, Elisa Costa, Veronica Piazza, Francesca Garaventa, and Marco Faimali Occurrence of Microplastics in the Gastrointestinal Tracts (GITs) of the Common Dolphinfish, Coryphaena Hippurus, from the Western Mediterranean Sea / Gabriella Schirinzi, Cristina Pedà, Franco Andaloro, Matteo Baini, Pietro Battaglia, Michela D’Alessandro, Martina Genovese, Marinella Farré, Cristina Panti, Maria Cristina Fossi, and Teresa Romeo Effects of Polymethacrylate Nanoplastics on Lipid Metabolism in Sparus Aurata / C. Barría, I. Brandts, J. C. Balasch, A. Tvarijonaviciute, A. Barreto, M. A. Martins, L. Tort, M. Oliveira, and M. Teles Measuring the Size and the Charge of Microplastics in Aqueous Suspensions With and With

Note: Contents Introduction 1 An Introduction to the Research on Mediterranean Cold-Water Corals / Covadonga Orejas and Carlos Jiménez Part I Past 2 Paleoecology of Mediterranean Cold-Water Corals / Marco Taviani, Agostina Vertino, Lorenzo Angeletti, Paolo Montagna, and Alessandro Remia 3 Cold-Water Corals in the Mediterranean: A History of Discovery / Julian Evans, Leyla Knittweis, Joseph A. Borg, and Patrick J. Schembri 4 A Turbulent Story: Mediterranean Contourites and Cold-Water Corals / Michele Rebesco and Marco Taviani 5 Messinian Salinity Crisis: What Happened to Cold-Water Corals? / André Freiwald 6 Did Quaternary Climate Fluctuations Affect Mediterranean Deep-Sea Coral Communities? / Agostina Vertino and Cesare Corselli 7 A Deglacial Cold-Water Coral Boom in the Alborán Sea: From Coral Mounds and Species Dominance / Claudia Wienberg 8 Highly Variable Submarine Landscapes in the Alborán Sea Created by Cold-Water Corals / Dierk Hebbeln 9 Spatio-Temporal Distribution of Mediterranean Cold-Water Corals / Agostina Vertino, Marco Taviani, and Cesare Corselli 10 Bathyal Corals Within the Aegean Sea and the Adjacent Hellenic Trench / Jürgen Titschack 11 Mediterranean Cold-Water Corals as Paleoclimate Archives / Paolo Montagna and Marco Taviani 12 Tomography of Cold-Water Corals-Bearing Cores / Lorenzo Angeletti, Matteo Bettuzzi, and Maria Pia Morigi 13 Changing Views About Mediterranean Cold-Water Corals / Marco Taviani Part II Present 14 Taxonomy, Genetics and Biodiversity of Mediterranean Deep-Sea Corals and Cold-Water Corals / Alvaro Altuna and Angelo Poliseno 15 Habitat Mapping of Cold-Water Corals in the Mediterranean Sea / Claudio Lo Iacono, Alessandra Savini, Veerle A. I. Huvenne, and Eulàlia Gràcia 16 Cold-Water Coral Habitat Mapping in the Mediterranean Sea: Methodologies and Perspectives / Lorenzo Angeletti, Annaëlle Bargain, Elisabetta Campiani, Federica Foglini, Valentina Grande, Elisa Leidi, Alessandra Mercorella, Mariacristina Prampolini, and Marco Taviani 17 Working with Visual Methods, Comparison Among the French Deep-Sea Canyons / Maïa Fourt, Adrien Goujard, and Pierre Chevaldonné 18 Review of the Circulation and Characteristics of Intermediate Water Masses of the Mediterranean: Implications for Cold-Water Coral Habitats / Daniel R. Hayes, Katrin Schroeder, Pierre-Marie Poulain, Pierre Testor, Laurent Mortier, Anthony Bosse, and Xavier du Madron 19 Occurrence and Biogeography of Mediterranean Cold-Water Corals / Giovanni Chimienti, Marzia Bo, Marco Taviani, and Francesco Mastrototaro 20 Gorgonian and Black Coral Assemblages in Deep Coastal Bottoms and Continental Shelves of the Mediterranean Sea / Andrea Gori, Jordi Grinyó, Carlos Dominguez-Carrió, Stefano Ambroso, Pablo J. López-González, Josep-Maria Gili, Giorgio Bavestrello, and Marzia Bo 21 Mediterranean Black Coral Communities / Marzia Bo and Giorgio Bavestrello 22 Recent Discoveries of Extensive Cold-Water Coral Assemblages in Maltese Waters / Leyla Knittweis, Julian Evans, Ricardo Aguilar, Helena Álvarez, Joseph A. Borg, Silvia García, and Patrick J. Schembri 23 Corals of Aphrodite: Dendrophyllia ramea Populations of Cyprus / Covadonga Orejas, Carlos Jiménez, Andrea Gori, Jesús Rivera, Claudio Lo Iacono, Didier Aurelle, Louis Hadjioannou, Antonis Petrou, and Katerina Achilleos 24 Cold-Water Corals in Fluid Venting Submarine Structures / Desirée Palomino, José Luis Rueda, Juan Tomás Vázquez, Javier Urra, Olga Sánchez-Guillamón, Emilio González-García, Nieves López-González, and Luis Miguel Fernández-Salas 25 Cold-Water Corals and Mud Volcanoes: Life on a Dynamic Substrate / Andres Rüggeberg and Anneleen Foubert 26 Occurrence of Living Cold-Water Corals at Large Depths Within Submarine Canyons of the Northwestern Mediterranean Sea / Anna Aymà, Jacopo Aguzzi, Miquel Canals, Joan Batista Company, Galderic Lastras, Ariadna Mecho, and Claudio Lo Iacono 27 Submarine Canyons in the Mediterranean: A Shelter for Cold-Water Corals / Pere Puig and Josep-Maria Gili 28 A Cold-Water Coral Habitat in La Fonera Submarine Canyon, Northwestern Mediterranean Sea / Galderic Lastras, Anna Sanchez-Vidal, and Miquel Canals 29 Cold-Water Coral Associated Fauna in the Mediterranean Sea and Adjacent Areas / José L. Rueda, Javier Urra, Ricardo Aguilar, Lorenzo Angeletti, Marzia Bo, Cristina García-Ruiz, Manuel M. González-Duarte, Eduardo López, Teresa Madurell, Manuel Maldonado, Ángel Mateo-Ramírez, César Megina, Juan Moreira, Francina Moya, Lais V. Ramalho, Antonietta Rosso, Cèlia Sitjà, and Marco Taviani 30 Cold-Water Corals as Shelter, Feeding and Life-History Critical Habitats for Fish Species: Ecological Interactions and Fishing Impact / Gianfranco D’Onghia 31 Past, Present and Future Connectivity of Mediterranean Cold-Water Corals: Patterns, Drivers and Fate in a Technically and Environmentally Changing World / Joana Boavida, Ronan Becheler, Anna Maria Addamo, Florent Sylvestre, and Sophie Arnaud-Haond 32 Desmophyllum dianthus Genetics and More / Anna Maria Addamo 33 Diversity of Bacteria Associated with the Cold Water Corals Lophelia pertusa and Madrepora oculata / Markus G. Weinbauer, Davide Oregioni, Anne Großkurth, Marie-Emanuelle Kerros, Tilmann Harder, Michael DuBow, Jean-Pierre Gattuso, and Cornelia Maier 34 Lophelia pertusa and Madrepora oculata: An Archaea Riddle? / Markus G. Weinbauer, Davide Oregioni, and Cornelia Maier 35 Biology and Ecophysiology of Mediterranean Cold–Water Corals / Stéphanie Reynaud and Christine Ferrier-Pagès 36 Growth Patterns of Mediterranean Calcifying Cold-Water Corals / Franck Lartaud, Vincent Mouchi, Leïla Chapron, Anne-Leïla Meistertzheim, and Nadine Le Bris 37 Demography and Conservation of Deep Corals: The Study of Population Structure and Dynamics / Lorenzo Bramanti, Giovanni Santangelo, Maria Carla Benedetti, Mimmo Iannelli, and Katell Guizien 38 Cold-Water Coral in Aquaria: Advances and Challenges. A Focus on the Mediterranean / Covadonga Orejas, Marco Taviani, Stefano Ambroso, Vasilis Andreou, Meri Bilan, Marzia Bo, Sandra Brooke, Paal Buhl-Mortensen, Erik Cordes, Carlos Dominguez-Carrió, Christine Ferrier-Pagès, Antonio Godinho, Andrea Gori, Jordi Grinyó, Cristina Gutiérrez-Zárate, Sebastian Hennige, Carlos Jiménez, Ann I. Larsson, Franck Lartaud, Jay Lunden, Cornelia Maier, Sandra R. Maier, Juancho Movilla, Fiona Murray, Erwan Peru, Autun Purser, Maria Rakka, Stéphanie Reynaud, J. Murray Roberts, Pedro Siles, Susanna M. Strömberg, Laurenz Thomsen, Dick van Oevelen, Alfredo Veiga, and Marina Carreiro-Silva 39 Approaching Cold-Water Corals to the Society: Novel Ways to Transfer Knowledge / Sergio Rossi and Covadonga Orejas Part III Future 40 Perspectives of Biophysical Modelling with Implications on Biological Connectivity of Mediterranean Cold-Water Corals / Matthew W. Johnston and Ann I. Larsson 41 The Interface Between Tectonic Evolution and Cold-Water Coral Dynamics in the Mediterranean / Rinus Wortel and Paul Meijer 42 The Mediterranean Is Getting Saltier: From the Past to the Future / Nikolaos Skliris 43 The Spread of Non-indigenous Species in the Mediterranean – A Threat to Cold-Water Corals? / Bella S. Galil 44 Fate of Mediterranean Scleractinian Cold-Water Corals as a Result of Global Climate Change. A Synthesis / Cornelia Maier, Markus G. Weinbauer, and Jean-Pierre Gattuso 45 A Case Study: Variability in the Calcification Response of Mediterranean Cold-Water Corals to Ocean Acidification / Juancho Movilla 46 Conservation of Cold-Water Corals in the Mediterranean: Current Status and Future Prospects for Improvement / Maria del Mar Otero and Pilar Marin Species Index Subject Index

Note: Marek, K.-H.: Vorwort Toth, K.: Grußwort der Delegation der UVR an die 2. Fernerkundungskonferenz 1. Grundsätzliche und perspektivische Fragen Kautzleben, H.; Marek, K.-H.: Einige grundlegende Probleme der weiteren Entwicklung der Fernerkundung der Erde Albert, K.-H.: Aufgaben bei der effektiven Nutzung von Daten der Fernerkundung der Erde in den Volkswirtschafts- und Wissenschaftszweigen Barthel, H.: Stand und künftige Gestaltung der Aus- und Weiterbildung zur Geofernerkundung im Hochschulwesen der DDR Bonau, U.: Beispiele für eine zweckmäßige Verbindung von Forschung und Lehre auf dem Gebiet der Fernerkundung 2. Nutzung von Fernerkundungsdaten zur Herstellung von Karten Guske, W.: Möglichkeiten und Grenzen der Nutzung von Fernerkundungsdaten bei der Kartenherstellung Wirth, H.; Schilbach, G.: Beitrag zur automatisierten Aktualisierung thematischer Karten Illhardt, E.; Krämer, J.; Sporbert, W.; Kern, H.-G.: Die Verwendung von MKF-6-Flugzeugaufnahmen mit dem Bildmaßstab 1 :20 000 für die Herstellung von großmaßstäbigen Karten Kugler, H.: Geomorphologische Fernerkundung und Photogrammetrie Wirth, H.; Harnisch, G.; Pilarski, M.: Flächennutzungsanalysen auf der Basis multispektraler Daten Hengelhaupt, U.; Henker, S.: Probleme der geographischen Interpretation von Ergebnissen digital-automatischer Flächennutzungsdechiffrierungen Siebert, R.; Söllner, R.; Marek, K.-H.: Probleme der geometrischen Auflösung bei der numerischen Klassifizierung und instrumentengestützten Photointerpretation Pross, E.: Verzerrungen in kosmischen photographischen Bildern und Möglichkeiten ihrer Beseitigung Harnisch, G.; Marek, G.: Nichtlineare geometrische Transformation von Fernerkundungsdaten 3. Technische Mittel zur Gewinnung und Auswertung von Fernerkundungsdaten Nicolai, G.: Die neue Multispektralkamera MSK-4 Voss, G.; Zeth, U.: Das Aufnahmesystem Luftbildmeßkammer LMK Kroitzsch, V.; Frubrich, M.: Anwendung der Multispektraltechnik in der terrestrischen Photogrammetrie Laack, U.: Das Film-Ein/Ausgabegerät FEAG Rulf, J.; Schumann, R.: RECTIMAT C - ein neues Präzisionsentzerrungsgerät aus Jena Marek, K.-H.; Söllner, R.; Weichelt, H.; Röser, S.; Marek, G.: Erste Erfahrungen beim Einsatz von RC-Bildflugzeugen für Grundlagenforschungen zur Fernerkundung Röser, S.: Nutzung von Fernerkundungsdaten im Mikrowellenbereich zur thematischen Kartierung Söllner, R.; Schmidt, K.; Weichelt, H.: Erkennungskonzepte für die Ableitung thematischer Informationen aus Fernerkundungsdaten Bieberstein; Schröder; Riedel: Entwicklung der Luftbildanwendung in der Forstwirtschaft der DDR Pelz, E.; Pofahl, U.: Prüfung qualitativer Zustandsmerkmale geschädigter Fichtenbestände aus spektrozonalen Luftbildern mit Hilfe mehrdimensionaler Varianzanalysen Storck, J.-H.;Opel, S.; Kramer, S.: Nutzung von Archivbildmaterial in Kombination mit Bildern aus der Spezialbefliegung für die retrospektivische Beurteilung von Obstanlagen Sporbert, W.; Haseloff, R.: Stereofotogrammetrische Vermessung von Rauchfahnen aus kosmischen Bildern Bankwitz, P.; Bankwitz, E.; Frischbutter, A.; Schäfer, U.: Fotogeologische Kartierung als Grundlage und Ergänzung thematischer Kartendarstellungen der Antarktis

Note: Contents Part I 1 An Introduction / Douglas C. Nord 2 NordForsk as a Facilitator of Integrated Research on the Arctic / Gunnel Gustafsson Part II 3 CLINF: Climate-Change Effects on the Epidemiology of Infectious Diseases, and the Associated Impacts on Northern Societies / Birgitta Evengård and Tomas Thierfelder 4 CLINF: An Integrated Project Design / Tomas Thierfelder and Birgitta Evengård 5 Modeling Climate Sensitive Infectious Diseases in the Arctic / Gia Destouni, Zahra Kalantari, Shaun Quegan, Didier Leibovici, Juha Lemmetyinen, and Jaakko Ikonen 6 Reindeer Herding and Coastal Pastures: Adaptation to Multiple Stressors and Cumulative Effects / Grete K. Hovelsrud, Camilla Risvoll, Jan Åge Riseth, Hans Tømmervik, Anna Omazic, and Ann Albihn Part III 7 The ARCPATH Project: Assessing Risky Environments and Rapid Change: Research on Climate, Adaptation and Coastal Communities in the North Atlantic Arctic / Astrid E. J. Ogilvie, Yongqi Gao, Níels Einarsson, Noel Keenlyside, and Leslie A. King 8 The Climate Model: An ARCPATH Tool to Understand and Predict Climate Change / Shuting Yang, Yongqi Gao, Koenigk Torben, Noel Keenlyside, and François Counillon 9 Whale Ecosystem Services and Co-production Processes Underpinning Human Wellbeing in the Arctic: Case Studies from Greenland, Iceland and Norway / Laura Malinauskaite, David Cook, Brynhildur Davíðsdóttir, and Helga Ögmundardóttir 10 “Small Science”: Community Engagement and Local Research in an Era of Big Science Agendas / Catherine Chambers, Leslie A. King, David Cook, Laura Malinauskaite, Margaret Willson, Astrid E. J. Ogilvie, and Níels Einarsson Part IV 11 Project ReiGN: Reindeer Husbandry in a Globalizing North–Resilience, Adaptations and Pathways for Actions / Øystein Holand, Jon Moen, Jouko Kumpula, Annette Löf, Sirpa Rasmus, and Knut Røed 12 What Drives the Number of Semi-domesticated Reindeer? Pasture Dynamics and Economic Incentives in Fennoscandian Reindeer Husbandry / Antti-Juhani Pekkarinen, Jouko Kumpula, and Olli Tahvonen 13 Reindeer Herders as Stakeholders or Rights-Holders? Introducing a Social Equity-Based Conceptualization Relevant for Indigenous and Local Communities / Simo Sarkki, Hannu I. Heikkinen, and Annette Löf 14 Working Together: Reflections on a Transdisciplinary Effort of Co-producing Knowledge on Supplementary Feeding in Reindeer Husbandry Across Fennoscandia / Tim Horstkotte, Élise Lépy, and Camilla Risvoll Part V 15 Is There Such a Thing as ‘Best Practice’? Exploring the Extraction/Sustainability Dilemma in the Arctic / Sverker Sörlin 16 When Mines Go Silent: Exploring the Afterlives of Extraction Sites / Dag Avango and Gunhild Rosqvist 17 Mining Emotions: Affective Approaches to Resource Extraction / Frank Sejersen and Kirsten Thisted Part VI 18 The Challenge of Synthesis: Lessons from Arctic Climate Predictions: Pathways to Resilient, Sustainable Societies (ARCPATH) / Leslie A. King and Astrid E. J. Ogilvie 19 The Assessment and Evaluation of Arctic Research – Where Have We Come From and Where Do We Need to Go in the Future? / Andre van Amstel, Amy Lauren Lovecraft, Maureen Biermann, Roberta Marinelli, and Douglas C. Nord 20 Findings and Conclusions: Pathways to Action / Douglas C. Nord

Note: Contents Chapter 1. Introduction on Coronavirus Disease (COVID-19) Pandemic: The Global Challenge / Nima Rezaei, Saboura Ashkevarian, Mahsa Keshavarz Fathi, Sara Hanaei, Zahra Kolahchi, Seyedeh-Sanam Ladi Seyedian, Elham Rayzan, Mojdeh Sarzaeim, Aida Vahed, Kawthar Mohamed, Sarah Momtazmanesh, Negar Moradian, Zahra Rahimi Pirkoohi, Noosha Sameeifar, Mahsa Yousefpour, Sepideh Sargoli, Saina Adiban, Aida Vahed, Niloufar Yazdanpanah, Heliya Ziaei, Amene Saghazadeh Chapter 2. Coronaviruses: What Should We Know About the Characteristics of Viruses? / Wei Ji Chapter 3. Ecology and Evolution of Betacoronaviruses / Eduardo Rodríguez-Román, Adrian J. Gibbs Chapter 4. The Epidemiologic Aspects of COVID-19 Outbreak: Spreading Beyond Expectations / Sara Hanaei, Farnam Mohebi, Maziar Moradi-Lakeh, Parnian Jabbari, Surinder Kumar Mehta, Liudmyla S. Kryvenko, Livio Luongo, Loďc Dupré, Nima Rezaei Chapter 5. The Incubation Period of COVID-19: Current Understanding and Modeling Technique / Char Leung Chapter 6. Coronavirus: Pure Infectious Disease or Genetic Predisposition / Farzaneh Darbeheshti, Hassan Abolhassani, Mohammad Bashashati, Saeid Ghavami, Sepideh Shahkarami, Samaneh Zoghi, Sudhir Gupta, Jordan S. Orange, Hans D. Ochs, Nima Rezaei Chapter 7. Genetic Polymorphisms in the Host and COVID-19 Infection / Joris R. Delanghe, Marc L. De Buyzere, Marijn M. Speeckaert Chapter 8. How COVID-19 Has Globalized: Unknown Origin, Rapid Transmission, and the Immune System Nourishment / Amene Saghazadeh, Nima Rezaei Chapter 9. Potential Anti-viral Immune Response Against COVID-19: Lessons Learned from SARS-CoV / Mahzad Akbarpour, Laleh Sharifi, Amir Reza Safdarian, Pooya Farhangnia, Mahdis Borjkhani, Nima Rezaei Chapter 10. COVID-19 and Cell Stress / Abdo A Elfiky, Ibrahim M Ibrahim, Fatma G Amin, Alaa M Ismail, Wael M Elshemey Chapter 11. Clinical Manifestations of COVID-19 / Mahsa Eskian, Nima Rezaei Chapter 12. Pediatrics and COVID-19 / Tuna Toptan, Sandra Ciesek, Sebastian Hoehl Chapter 13. Geriatrics and COVID-19 / Mona Mirbeyk, Amene Saghazadeh, Nima Rezaei Chapter 14. Coronavirus Diseases in Pregnant Women, the Placenta, Fetus, and Neonate / David A. Schwartz, Amareen Dhaliwal Chapter 15. COVID-19 in Patients with Hypertension / Thiago Quinaglia, Mahsima Shabani, Nima Rezaei Chapter 16. COVID-19 and Cardiovascular Diseases / Babak Geraiely, Niloufar Samiei, Parham Sadeghipour, Azita Haj Hossein Talasaz, Seyedeh Hamideh Mortazavi, Roya Sattarzadeh Badkoubeh Chapter 17. How Prevalent Is Cancer in Confirmed Cases with Coronaviruses and Severe Acute Respiratory Syndromes? / Maryam Fotouhi, Elham Samami, Sahar Mohseni, Amir Nasrollahizadeh, Mohammad Haddadi, Mona Mirbeyk, Amene Saghazadeh, Nima Rezaei Chapter 18. COVID-19 in Patients with Cancer / Ali Nowroozi, Sepideh Razi, Kamal Kant Sahu, Fabio Grizzi, Jann Arends, Mahsa Keshavarz-Fathi, Nima Rezaei Chapter 19. COVID-19 and Tropical Infection: Complexity and Concurrence / Pathum Sookaromdee, Viroj Wiwanitkit Chapter 20. Neurologic Manifestations of COVID-19 / Farnaz Delavari, Farnaz Najmi Varzaneh, Nima Rezaei Chapter 21. Autoimmune Processes Involved in Organ System Failure Following Infection with SARS-CoV-2 / Steven E. Kornguth, Robert J. Hawley Chapter 22. Clinical and Laboratory Predictors of Severity, Criticality, and Mortality in COVID-19: A Multisystem Disease / Bahareh Gholami, Samira Gholami, Amir Hossein Loghman, Behzad Khodaei, Simin Seyedpour, Nasrin Seyedpour, Amene Saghazadeh, Nima Rezaei Chapter 23. Diagnostic Tests for COVID-19 / Tung Phan, Kristin Nagaro Chapter 24. The Role of Medical Imaging in COVID-19 / Houman Sotoudeh, Masoumeh Gity Chapter 25. Therapeutic Development in COVID-19 / Chan Yang, Yuan Huang, Shuwen Liu Chapter 26. Immune-based Therapy for COVID-19 / Abdolreza Esmaeilzadeh, Davood Jafari, Safa Tahmasebi, Reza Elahi, Elnaz Khosh Chapter 27. Ventilatory Support in Patients with COVID-19 / Paolo Maria Leone, Matteo Siciliano, Jacopo Simonetti, Angelena Lopez, Tanzira Zaman, Francesco Varone, Luca Richeldi Chapter 28. Nutrition and Immunity in COVID-19 / Marjan Moallemian Isfahani, Zahra Emam-Djomeh, Idupulapati M. Rao, Nima Rezaei Chapter 29. Dietary Supplements for COVID-19 / Gerard E. Mullin, Berkeley Limektkai, Lin Wang, Patrick Hanaway, Loren Marks, Edward Giovannucci Chapter 30. Photobiomodulation and Antiviral Photodynamic Therapy in COVID-19 Management / Reza Fekrazad, Sohrab Asefi, Maryam Pourhajibagher, Farshid Vahdatinia, Sepehr Fekrazad, Abbas Bahador, Heidi Abrahamse, Michael R Hamblin Chapter 31. The COVID-19 Vaccine Landscape / Till Koch, Anahita Fathi, Marylyn M. Addo Chapter 32. Prevention of COVID-19: Preventive Strategies for General Population, Health Care Settings, and Various Professions / Shirin Moossavi, Kelsey Fehr, Hassan Maleki, Simin Seyedpour, Mahdis Keshavarz-Fath, Farhad Tabasi, Mehrdad Heravi, Rayka Sharifian, Golnaz Shafiei, Negin Badihian, Roya Kelishadi, Shahrzad Nematollahi, Majid Almasi, Saskia Popescu, Mahsa Keshavarz-Fathi, Nima Rezaei Chapter 33. Pharmacist Role and Pharmaceutical Care during the COVID-19 Pandemic / Pedro Amariles, Mónica Ledezma-Morales, Andrea Salazar-Ospina, Jaime Alejandro Hincapié-García Chapter 34. Impact of COVID-19 on Dentistry / Arghavan Tonkaboni, Mohammad Hosein Amirzade-Iranaq, Heliya Ziaei, Amber Ather Chapter 35. The Implications of COVID-19 to Ophthalmology / Tracy H.T. Lai, Emily W.H. Tang, Kenneth K.W. Li Chapter 36. Challenges of Cellular therapy during COVID-19 Pandemic / Kamal Kant Sahu, Sikander Ailawadhi, Natalie Malvik, Jan Cerny Chapter 37. COVID-19 Amid Rumours and Conspiracy Theories: The Interplay between Local and Global Worlds / Inayat Ali Chapter 38. Exploration of the Epidemiological and Emotional Impact of Quarantine and Isolation during COVID‐19 Pandemic / Helia Mojtabavi, Nasirudin Javidi, Anne-Frédérique Naviaux, Pascal Janne, Maximilien Gourdin, Mahsa Mohammadpour, Amene Saghazadeh, Nima Rezaei Chapter 39. The Main Sources and Potential Effects of COVID-19-related Prejudice and Discrimination / Piotr Rzymski, Hanna Mamzer, Michał Nowicki Chapter 40. Potential mechanisms of COVID-19-related psychological problems and mental disorders / Chunfeng Xiao Chapter 41. Mental Health in Health Professionals in the COVID-19 Pandemic / Antonia Bendau, Andreas Ströhle, Moritz Bruno Petzold Chapter 42. Treatment of Patients with Mental Illness Amid a Global COVID-19 Pandemic / Ankit Jain, Kamal Kant Sahu, Paroma Mitra Chapter 43. A Shift in Medical Education During the COVID-19 Pandemic / Farida Nentin, Nagaraj Gabbur, Adi Katz Chapter 44. Reopening Schools After a Novel Coronavirus Surge / Dan Li, Elizabeth Z. Lin, Marie A. Brault, Julie Paquette, Sten H. Vermund, Krystal J. Godri Pollitt Chapter 45. COVID-19 and Its Impact on Tourism Industry / Dimitrios G. Lagos, Panoraia Poulaki, Penny Lambrou Chapter 46. COVID-19 and Its Global Economic Impact / Zahra Kolahchi, Manlio De Domenico, Lucina Q. Uddin, Valentina Cauda, Igor Grossmann, Lucas Lacasa, Giulia Grancini, Morteza Mahmoudi, Nima Rezaei Chapter 47. Retrieval and Investigation of Data on SARS-CoV-2 and COVID-19 Using Bioinformatics Approach / Muhamad Fahmi, Viol Dhea Kharisma, Arif Nur Muhammad Ansori, Masahiro Ito Chapter 48. Answering the Challenge of COVID-19 Pandemic through Innovation and Ingenuity / Kathryn Clare Kelley, Jonathan Kamler, Manish Garg, Stanislaw P. Stawicki Chapter 49. COVID-19 Pandemic: The Influence of Culture and Lessons for Collaborative Activities / Linda Simon Paulo, George M. Bwire, Xingchen Pan, Tianyue Gao, Amene Saghazadeh, Chungen Pan Chapter 50. A Borderless Solution Is Needed for A Borderless Complexity, Like COVID-19, The Universal Invader / Kawthar Mohamed, Rangarirai Makuku, Eduardo Rodríguez-Román, Aram Pascal Abu Hejleh, Musa Joya, Mariya Ivanovska, Sara A. Makka, Md Shahidul Islam, Nesrine Radwan, Attig-Bahar Faten, Chunfeng Xiao, Leander Marquez, Nima Rezaei Chapter 51. Socialization During The COVID-19 Pandem

Note: Contents 1 Uncertainties in Urbanizing World and Nature-Based Resilience Building / Mahua Mukherjee and Rajib Shaw Part I Policy Analysis, Policy Framing and Recognition of Nature-Based Solution 2 Ecosystem-Based Adaptation (EbA) in the Hindu Kush Himalaya: Status, Progress and Challenges / Sunita Chaudhary, Basant Raj Adhikari, Pashupati Chaudhary, Tashi Dorji, and Renuka Poudel 3 Evaluation of Ecosystem-Based Approaches for Disaster and Climate Risk Resilience and Policy Perspectives in Pakistan / Muhammad Barkat Ali Khan, Atta-ur Rahman, and Rajib Shaw 4 Ecosystem-Based Approaches and Policy Perspectives in Nepal / Shobha Poudel, Bhogendra Mishra, and Rajib Shaw 5 Ecosystem-Based Approaches and Policy Perspective from India / Shweta Bhardwaj and Anil Kumar Gupta 6 Ecosystem-Based Approaches and Policy Perspectives: Towards an Integrated Blue–Green Solutions in Vietnam / Thi My Thi Tong and Ngoc Huy Nguyen 7 Turning Blue, Green and Gray: Opportunities for Blue-Green Infrastructure in the Philippines / Noralene Uy and Chris Tapnio 8 Making Resilience a Reality: The Contribution of Peri-urban Ecosystem Services (BGI) to Urban Resilience / Celeste Norman, Akhilesh Surjan, and Miranda Booth 9 Innovations to Reduce Disaster Risks of Water Challenges / Piyalee Biswas, Neelima Alam, and Sanjay Bajpai Part II Science Investigation, Technology and Planning Intervention 10 Future Heat Risk in South Asia and the Need for Ecosystem Mitigation / Peter J. Marcotullio and Michael T. Schmeltz 11 Urban Risk Assessment Tools and Techniques for Ecosystem-Based Solutions / Aditya Rahul, Siva Ram Edupuganti, Vickyson Naorem, Mahua Mukherjee, and Talbot Brooks 12 Scaling-up Nature-Based Solutions for Mainstreaming Resilience in Indian Cities / Shalini Dhyani, Rudrodip Majumdar, and Harini Santhanam 13 Incorporation of BIM Based Modeling in Sustainable Development of Green Building from Stakeholders Perspective / Raju Sarkar, Karan Narang, Abhinav Daalia, Vidushi Gautam, Ujjawal Nathani, and Rajib Shaw 14 Road to Ecosystem-Based Disaster Risk Reduction: Comprehensive Approach for Smart Urban Areas Management / Norio Maki Part III Case Studies 15 Path Towards Sustainable Water Management: A Case Study of Shimla, India / Kamakshi Thapa, Chetna Singh, Sameer Deshkar, and Rajib Shaw 16 Application of Remote Sensing Image in ECO-DRR for Dehradun City / Atul Kumar, Jeevan Madapala, Mahua Mukherjee, Shirish Ravana, and Sandeep Sharma 17 Ecosystem-Based Approaches for Water Stress Management—Lessons from Nagpur Metropolitan Area, India / Vibhas Sukhwani, Kamakshi Thapa, Rajib Shaw, Sameer Deshkar, Bijon Kumer Mitra, and Wanglin Yan 18 Challenges in Decision-Making for Building Resilience to Climate Risks / Anamitra Anurag Danda, Nilanjan Ghosh, Jayanta Bandyopadhyay, and Sugata Hazra 19 A “Greener” Alternative: The Sri Lankan Experience of Eco-DRR / Deepthi Wickramasinghe 20 The Watarase Retarding Basin—A Historical Example of Ecosystem-Based Disaster Risk Reduction in Japan / Tomohiro Ichinose, Jun Ishii, and Ikuko Imoto 21 Self-efficacy for EbA and Human Health in a Post-disaster Recovery Phase / Ai Tashiro 22 Freshwater Biomonitoring: An Ecosystem-Based Approach (EbA) for Building Climate Resilience Communities in Fiji / Bindiya Rashni 23 Forward-Looking Lens to Mainstream Blue-Green Infrastructure / Mahua Mukherjee and Rajib Shaw

Note: Contents Part I Catastrophic Landslides with Different Triggers Rock Avalanches: Basic Characteristics and Classification Criteria / Alexander Strom Study on the Phenomena of Liquefaction Induced Massive Landslides in 28 September 2018 Palu-Donggala Earthquake / Paulus P. Rahardjo The Krasnogorsk Landslide (Northern Caucasus): Its Evolution and Modern Activity / Igor K. Fomenko, Oleg V. Zerkal, Alexander Strom, Daria Shubina, and Ludmila Musaeva Earthquake-Triggered Landslides and Slope-Seismic Waves Interaction Inferring Induced Displacements / Salvatore Martino, Celine Bourdeau, Josè Delgado, and Luca Lenti Slope Deformation caused Jure Landslide 2014 Along Sun Koshi in Lesser Nepal Himalaya and Effect of Gorkha Earthquake 2015 / H. Yagi, G. Sato, H. P. Sato, D. Higaki, V. Dangol, and S. C. Amatya Inventory of Landslides Triggered by the Hejing Ms6.6 Earthquake, China, on 30 June 2012 / Chong Xu and Kai Li Pressure Head Dynamics on a Natural Slope in Eastern Iburi Struck by the 2018 Hokkaido Earthquake / Toshiya Aoki, Shin’ya Katsura, Takahiko Yoshino, Takashi Koi, Yasutaka Tanaka, and Takashi Yamada Investigation of 20 August 2019 Catastrophic Debris Flows Triggered by Extreme Rainstorms Near Epicentre of Wenchuan Earthquake / Dalei Peng, Limin Zhang, Hofai Wong, Ruilin Fan, and Shuai Zhang Spatial Distribution of Lakes in the Central Andes (31°–36°), Argentina: Implications for Outburst Flood Hazard / Mariana Correas-Gonzalez, Stella Maris Moreiras, and Jan Klimeš Rockfall/Rockslide Hazard, Lake Expansion and Dead-Ice Melting Assessment: Lake Imja, Nepal / Tomas Kroczek and Vit Vilimek Formation of the 2018 Bureya Landslide, Far East of Russia / Oleg V. Zerkal, Aleksey N. Makhinov, Alexander Strom, Vladimir I. Kim, Michael E. Kharitonov, and Igor K. Fomenko Landslide Dam Hazards: Assessing Their Formation, Failure Modes, Longevity and Downstream Impacts / Regine Morgenstern, Chris Massey, Brenda Rosser, and Garth Archibald The Sedimentology and Internal Structure of Landslide Dams—Implications for Internal Erosion and Piping Failure: A Review / Chukwueloka A. U. Okeke An Interdisciplinary Assessment of a Coal-Mining-Induced Catastrophic Landslide (Czech Republic) / Jan Burda and Vít Vilímek Could Glacial Retreat-Related Landslides Trigger Volcanic Eruptions? Insights from Mount Meager, British Columbia / Gioachino Roberti, Brent Ward, Benjamin van Wyk de Vries, Nicolas Le Corvec, Swetha Venugopal, Glyn Williams-Jones, John J. Clague, Pierre Friele, Giacomo Falorni, Geidy Baldeon, Luigi Perotti, Marco Giardino, and Brian Menounos Rock Avalanches in the Upper Reaches of the Mzymta River, Russia / Andrey A. Ponomarev, Kai Kang, and Oleg V. Zerkal Structural and Dynamic Numerical Models of Rockslides in the Carpathians and the Alps / Emilie Lemaire, Anne-Sophie Mreyen, and Hans-Balder Havenith Quantitative Investigation of a Mass Rock Creep Deforming Slope Through A-Din SAR and Geomorphometry / Michele Delchiaro, Emanuele Mele, Marta Della Seta, Salvatore Martino, Paolo Mazzanti, and Carlo Esposito Deformational Features of Deep-Seated Gravitational Slope Deformation of Slate Slopes in the Central Range, Taiwan / Ching-Ying Tsou, Masahiro Chigira, Yu-Chung Hsieh, Mien-Ming Chen, and Tai-Chieh He Bathymetric Analyses of Submarine Landslides on the Jan Mayen Ridge, Norwegian–Greenland Sea / Kiichiro Kawamura and Jan Sverre Laberg Forkastningsfjellet Rock Slide, Spitsbergen: State of Activity in a Changing Climate / Dirk Kuhn, Reginald L. Hermanns, Jewgenij Torizin, Michael Fuchs, Tim Redfield, Raymond Eilertsen, and Dirk Balzer Catastrophic Landslides in Indian Sector of Himalaya / Vinod K. Sharma Part II Frontiers of Landslide Science Enhancing Preparedness Against Impact of Climate Change on Slope Safety in Hong Kong / K. K. S. Ho, H. W. Sun, E. J. Lam, and F. L. C. Lo Climate Change and Surface Deformation Characteristics in Degradation Area of Permafrost in Lesser Khingan Mountain, China / Wei Shan, Chengcheng Zhang, Ying Guo, Monan Shan, Xujing Zeng, and Chunjiao Wang Climate Change Impact Evaluation on the Water Balance of the Koroška Bela Area, NW Slovenia / Nejc Bezak, Tina Peternel, Anže Medved, and Matjaž Mikoš Global Warming as a Predisposing Factor for Landslides in Glacial and Periglacial Areas: An Example from Western Alps (Aosta Valley, Italy) / Jessica Maria Chicco, Marco Frasca, Giuseppe Mandrone, Damiano Vacha, and Laurie Jayne Kurilla Characteristics and Causes of the Debris Flow in Shelong Gully, China / Qiang Zou, Peng Cui, Hu Jiang, Yanguo Liu, Cong Li, Sheng Hu, and Bin Zhou MPM Modelling of Buildings Impacted by Landslides / Sabatino Cuomo, Angela Di Perna, and Mario Martinelli Accelerating Landslide Hazard at Kandersteg, Swiss Alps; Combining 28 Years of Satellite InSAR and Single Campaign Terrestrial Radar Data / Rafael Caduff, Tazio Strozzi, Nils Hählen, and Jörg Häberle Identification Old Landslides in Permafrost Degradation Area in Northeast China by Difference Distribution of Surface Trees / Ying Guo, Wei Shan, Zhichao Xu, Chunjiao Wang, and Shuanglin Wang Forensic Geotechnical Investigation of the Skjeggestad Quick Clay Landslide, Norway / Thi Minh Hue Le, Vidar Gjelsvik, Suzanne Lacasse, Stein-Are Strand, Eirik Traae, and Vikas Thakur Accuracy Assessment of Unmanned Aerial Vehicle (UAV) Structure from Motion Photogrammetry Compared with Total Station for a Deformed Slope / Vera Hui Loo and Chou Khong Wong ARAS: A Web-Based Landslide Susceptibility and Hazard Mapping System / Murat Ercanoglu, Mehmet Balcılar, Fatih Aydın, Sedat Aydemir, Güler Deveci, and Bilgekağan Çintimur A Landform Evolution Model for the Mannen Area in Romsdal Valley, Norway / Paula Hilger, Reginald L. Hermanns, and Bernd Etzelmüller Multimethodological Study of Non-linear Strain Effects Induced by Thermal Stresses on Jointed Rock Masses / Guglielmo Grechi and Salvatore Martino Extreme Rainfall Induced Landslide Susceptibility Assessment Using Autoencoder Combined with Random Forest / Kounghoon Nam and Fawu Wang Economizing Soil Nailing Design by Drainage Improvement—Case History at Ginigathhena / S. O. A. D. Mihira Lakruwan and S. A. S. Kulathilaka Performances of Geosynthetics-Reinforced Barriers for Protection Against Debris Avalanches / Sabatino Cuomo, Sabrina Moretti, Lorenzo Frigo, and Stefano Aversa Large and Small Scale Multi-Sensors Remote Sensing for Landslide Characterisation and Monitoring / Carlo Tacconi Stefanelli, Teresa Gracchi, Guglielmo Rossi, and Sandro Moretti Novel Cosmogenic Datings in Landslide Deposits, San Juan, Argentina / Pilar Jeanneret, Stella Maris Moreiras, Silke Merchel, Andreas Gärtner, Steven Binnie, Maria Julia Orgeira, G. Aumaître, D. Bourlès, and K. Keddadouche Modeling Landslide Volumes: A Case Study in Whatcom County, Washington, USA / Gabriel Legorreta Paulin, Trevor A. Contreras, Katherine A. Mickelson, Kara E. Jacobacci, and William Gallin CRE Dating of Torrential Alluvial Deposits as an Approximation to Holocene Climate-Change Signatures in the Northwestern Andes of Colombia / Santiago Noriega-Londoño, Maria Isabel Marín-Cerón, Julien Carcaillet, Matthias Bernet, and Isandra Angel Features of Construction in Areas with Deep Block-Type Landslides / Andrey Kazeev and German Postoev Rock Glaciers and Landslides in the Waste Dump of High-Altitude Kumtor Goldmine (Kyrgyzstan) / Isakbek Torgoev and Salamat Toguzbaev Geosynthetic Reinforced Soil Structures for Slope Stabilization and Landslide Rehabilitation in Asia / Pietro Rimoldi, Matteo Lelli, Pietro Pezzano, and Fabrizia Trovato Cutting-Edge Technologies Aiming for Better Outcomes of Landslide Disaster Mitigation / Kazuo Konagai International Consortium on Landslides

Note: Contents 1 Trend Analyses of Seasonal Mean Temperature Series Pertaining to the Tapi River Basin Using Monthly Data / Ganesh D. Kale 2 Dry Spell and Wet Spell Characterisation of Nandani River Basin, Western Maharashtra, India / Abhijit Mohanrao Zende and Prashant Basavaraj Bhagawati 3 Assessment of Climate Change on Crop Water Requirement in Tandula Command of Chhattisgarh (India) / Rahul Kumar Jaiswal, H. L. Tiwari, and Anil Kumar Lohani 4 Impact of Climate Change on Hydrological Regime of Narmada River Basin / Deepak Kumar Tiwari, H. L. Tiwari, Raman Nateriya, and Satanand Mishra 5 Climate Change Impacts on Water Resources in Ethiopia / Abiot Ketema and G. S. Dwarakish 6 Spatio-Temporal Trend Analysis of Long-Term IMD-Gridded Precipitation in Godavari River Basin, India / C. H. Praveenkumar and V. Jothiprakash 7 Forecasting Reference Evapotranspiration Using Artificial Neural Network for Nagpur Region / Nikhil Band, Aniruddha Ghare, and Avinash Vasudeo 8 Time-Varying Downscaling Model (TVDM) and its Benefit to Capture Extreme Rainfall / Subbarao Pichuka and Rajib Maity 9 An Assessment of Impact of Land Use–Land Cover and Climate Change on Quality of River Using Water Quality Index / Manisha Jamgade and Shrikant Charhate 10 Assessment of Tail Behavior of Probability Distributions of Daily Precipitation Data Over India / Neha Gupta and Sagar Rohidas Chavan 11 Benefit of Time-Varying Models Developed Using Graphical Modeling Approach for Probabilistic Prediction of Monthly Streamflow / Riya Dutta and Rajib Maity 12 Determination of Effective Discharge Responsible for Sediment Transport in Cauvery River Basin / Shobhit Maheshwari and Sagar Rohidas Chavan 13 A Comparative Study of Potential Evapotranspiration in an Agroforestry Region of Western Ghats, India / Pandu Narayana and K. Varija 14 Influence of Air Temperature on Local Precipitation Extremes Across India / Sachidanand Kumar, Kironmala Chanda, and Srinivas Pasupuleti 15 Effect of Spatial and Temporal Land Use-Land Cover Change on the Rainfall Trend: A Case Study in Kerala / Lini R. Chandran and P. G. Jairaj 16 Innovations and Application of Operational Ocean Data Products for Security of Marine Environment / Madhulika Sinha and Shrikant Charhate 17 Statistical Downscaling of Sea Level by Support Vector Machine and Regression Tree Approaches / S. Sithara, S. K. Pramada, and Santosh G. Thampi 18 Assessing the Impacts of Climate Change on Crop Yield in Upper Godavari River Sub-basin Using H08 Hydrological Model / Pushpendra Raghav and T. I. Eldho 19 Evaluation of Time Discretization of Daily Rainfall From the Literature for a Specific Site / R. Harshanth, Saha Dauji, and P. K. Srivastava 20 Quality Checks on Continuous Rainfall Records: A Case Study / R. Harshanth, Saha Dauji, and P. K. Srivastava 21 Assuring Water Intake Sustainability Under Changing Climate / Gaurav Talukdar and Arup Kumar Sarma 22 Characteristics of Gldas Evapotranspiration and Its Response to Climate Variability Across Ganga Basin, India / Lalit Pal, C. S. P. Ojha, and Amit Kumar 23 Seasonal and Inter-Annual Variability of Sea Surface Temperature and Its Correlation with Maximum Sustained Wind Speed in Bay of Bengal / Jiya Albert and Prasad K. Bhaskaran 24 Comparison of CMIP5 Wind Speed from Global Climate Models with In-Situ Observations for the Bay of Bengal / Athira Krishnan and Prasad K. Bhaskaran 25 Trend Analysis of Temperature for Eastern Ganga Canal Command / Radha Krishan, Bhaskar R. Nikam, and Deepak Khare 26 Analysis of Long-Term Rainfall Trends in Rajasthan, India / Darshan Mehta and S. M. Yadav 27 Statistical Downscaling of GCM Output and Simulation of Rainfall Scenarios for Brahmani Basin / Lasyamayee Lopamudra Sahoo and Kanhu Charan Patra 28 Impact of Land Use–Land Cover Changes on the Streamflow of the Kolab River Basin Using SWAT Model / Partha Sarathi Bhunia and Kanhu Charan Patra 29 Statistical Downscaling of Climatic Variables in Indo-Gangatic Alluvial Plain / Prabhakar Shukla and Raj Mohan Singh 30 Comparing Global High-Resolution Precipitation Data with Rain Gauge Data in Assam, India / Pulendra Dutta, Dipsikha Devi, and Arup Kr. Sarma 31 Variability of Rainfall, Temperature and Potential Evapotranspiration at Annual Time Scale Over Tapi to Tadri River Basin, India / Prem Mahyavanshi, V. D. Loliyana, and Priyank J. Sharma 32 Climate Change and Water Resources: Emerging Challenges, Vulnerability and Adaptation in Indian Scenario / Y. Shiva Shankar, Abhishek Kumar, and Devendra Mohan 33 Observed Spatio-Temporal Trends of Precipitation and Temperature Over Afghanistan / S. Rehana, P. Krishna Reddy, N. Sai Bhaskar Reddy, Abdul Raheem Daud, Shoaib Saboory, Shoaib Khaksari, S. K. Tomer, and U. Sowjanya 34 Identification of Historical Shift, Dispersion, and Trend of the Monsoon Season for Guwahati City Using Fuzzy Segmentation and Trend Analyses / Amrutha Suresh and Pekkat Sreeja 35 Analysis of Intensity–Duration– Frequency and Depth–Duration– Frequency Curve Projections Under Climate Variability / Manish Kumar Sinha, Klaus Baier, Rafig Azzam, M. K. Verma, and Ramakar Jha 36 Changes in Monthly Hydro-Climatic Indices for Middle Tapi Basin, India / Priyank J. Sharma, P. L. Patel, and V. Jothiprakash 37 Multiobjective Automatic Calibration of a Physically Based Hydrologic Model Using Multiobjective Self-Adaptive Differential Evolution Algorithm / Saswata Nandi and M. Janga Reddy 38 Adaptive Neuro-Fuzzy Inference System-Based Yield Forecast Using Climatic Variables / Kalpesh Borse and P. G. Agnihotri 39 Impact of Climate Change on Hydrological Parameters / Arunima Priyadarsini Patnaik and Bandita Naik 40 Morphometric Analysis of Kosi River Basin, Bihar, India Using Remote Sensing and GIS Techniques / Niraj Kumar and Ramakar Jha 41 Simulation of Impact of Climate Change on the Performance of a Reservoir System in Eastern India / Satabdi Saha, Debasri Roy, and Rajib Das 42 Assessing the Impact of Spatial Resolution on Land Surface Model Based on Hydrologic Simulations / Aiendrila Dey and Renji Remesan 43 Infilling Missing Monthly Maximum and Minimum Temperature Dataset by EM Algorithm Followed by Distribution Based Statistical Assessment Using Eight Absolute Homogeneity Tests / P. Kabbilawsh, D. Sathish Kumar, and N. R. Chithra 44 Multisite Monthly to Daily Naturalised Streamflow Disaggregation Using Daily Flow Pattern Hydrograph / Vivek Verma 45 Error Analysis of TMPA Near Real-Time Precipitation Estimates for an Indian Monsoon Region / Ashish Kumar and RAAJ Ramsankaran 46 Comparison of Selection of Predictors for Statistical Downscaling of Precipitation Using Different Statistical Techniques / Kumar Keshav, Vivekanand Singh, and Roshni Thendiyath

Note: Contents Meteorology and Climatology of the Mediterranean and Black Seas: Introduction / Ivica Vilibić, Kristian Horvath und Jose Luis Palau An Extreme Hailstorm on 27 July 2017 in Istanbul, Turkey: Synoptic Scale Circulation and Thermodynamic Evaluation /Hakki Baltaci, Bulent Oktay Akkoyunlu und Mete Tayanc Hydraulic and Wave Aspects of Novorossiysk Bora / Anna A. Shestakova, Konstantin B. Moiseenko und Pavel A. Toropov Waterspout Forecasting Method Over the Eastern Adriatic Using a High-Resolution Numerical Weather Model / Tanja Renko, Sarah Ivušić, Maja Telišman Prtenjak, Vinko Šoljan und Igor Horvat Study of the Western Black Sea Storms with a Focus on the Storms Caused by Cyclones of North African Origin / Vasko Galabov und Hristo Chervenkov Operational Wave Modelling in the Adriatic Sea with the Wind Wave Model / Mathieu Dutour Sikirić, Damir Ivanković, Aron Roland, Stjepan Ivatek-Šahdan und Martina Tudor Atmospheric Forcing Conducive for the Adriatic 25 June 2014 Meteotsunami Event / Kristian Horvath, Jadranka Šepić und Maja TelišMan Prtenjak Impact of Geomorphological Changes to Harbor Resonance During Meteotsunamis: The Vela Luka Bay Test Case / Cléa Denamiel, Jadranka Šepić und Ivica Vilibić Analysis of long-term changes in extreme climatic indices: a case study of the Mediterranean climate, Marmara Region, Turkey / Mohsen Abbasnia und Hüseyin Toros Observed Changes in Daily Precipitation Extremes at Annual Timescale Over the Eastern Mediterranean During 1961–2012 / S. Mathbout, J.A. Lopez-Bustins, D. Royé, J. Martin-Vide, J. Bech und F.S. Rodrigo Modelling Dry Spells by Extreme Value Distribution with Bayesian Inference / Ksenija Cindrić und Zoran Pasarić Analyzing the Mediterranean Water Cycle Via Satellite Data Integration / Victor Pellet, Filipe Aires, Annarita Mariotti und Diego Fernández-Prieto Impact of the Surface–Atmosphere Variables on the Relation Between Air and Land Surface Temperatures / Gemma Simó, Daniel Martínez-Villagrasa, Maria A. Jiménez, Vicente Caselles und Joan Cuxart Assessing Shifts of Mediterranean and Arid Climates Under RCP4.5 and RCP8.5 Climate Projections in Europe / José I. Barredo, Achille Mauri, Giovanni Caudullo und Alessandro Dosio Mediterranean Sea-Level Variability in the Second Half of the Twentieth Century: A Bayesian Approach to Closing the Budget / Mirko Orlić, Miroslava Pasarić und Zoran Pasarić Mediterranean Surface Geostrophic Circulation from Satellite Gravity and Altimetry Observations / M.I. Vigo, M.D. Sempere, B.F. Chao und M. Trottini Variability of Wind-Driven Coastal Upwelling in the North-Eastern Black Sea in 1979–2016 According to NCEP/CFSR Data / Ksenia Silvestrova, Stanislav Myslenkov und Andrey Zatsepin Sea Surface Temperature in the Mediterranean: Trends and Spatial Patterns (1982–2016) / Francisco Pastor, Jose Antonio Valiente und José Luis Palau Long-Term Trends, Variability and Extremes of In Situ Sea Surface Temperature Measured Along the Eastern Adriatic Coast and its Relationship to Hemispheric Processes / Branka Grbec, Frano Matić, Gordana Beg Paklar, Mira Morović, Ružica Popović und Ivica Vilibić Water Masses in the Eastern Mediterranean Sea: An Analysis of Measured Isotopic Oxygen / Paola de Ruggiero, Davide Zanchettin, Manuel Bensi, Dagmar Hainbucher, Barbara Stenni, Stefano Pierini und Angelo Rubino Modelling Interannual Changes in Dense Water Formation on the Northern Adriatic Shelf / Hrvoje Mihanović, Ivica Janeković, Ivica Vilibić, Vedrana Kovačević und Manuel Bensi Mediterranean Thermohaline Response to Large-Scale Winter Atmospheric Forcing in a High-Resolution Ocean Model Simulation / Eleonora Cusinato, Davide Zanchettin, Gianmaria Sannino und Angelo Rubino Role of the Oceanic Vertical Thermal Structure in the Modulation of Heavy Precipitations Over the Ligurian Sea / A.N. Meroni, L. Renault, A. Parodi und C. Pasquero

Note: Zusammenfassung in englischer Sprache

Note: Contents Part I Exploring the Connections: Sustainability and Social Science Research Interplays of Sustainability, Resilience, Adaptation and Transformation / Jennifer L. Johnson, Laura Zanotti, Zhao Ma, David J. Yu, David R. Johnson, Alison Kirkham and Courtney Carothers Using Meta-Analysis in the Social Sciences to Improve Environmental Policy / Alexander Maki, Mark A. Cohen and Michael P. Vandenbergh Integrating Social Science Research to Advance Sustainability Education / Christine Jie Li, Martha C. Monroe and Tracey Ritchie Inclusive Sustainability: Environmental Justice in Higher Education / Flora Lu, Rebecca Hernandez Rosser, Adriana Renteria, Nancy Kim, Elida Erickson, Anna Sher and Lisa O’Connor Connective Methodologies: Visual Communication Design and Sustainability in Higher Education / Denielle Emans and Kelly M. Murdoch-Kitt The Teaching Green Building: Five Theoretical Perspectives / Laura B. Cole Blockchain for Good? Digital Ledger Technology and Sustainable Development Goals / Richard Adams, Beth Kewell and Glenn Parry Part II Research and Behavioral Interventions Psychological Distance and Response to Human Versus Non-Human Victims of Climate Change / Christie Manning, Hannah Mangas, Elise Amel, Hongyi Tang, Laura Humes, Rowena Foo, Vera Sidlova and Kelly Cargos Bridging the Gap Between Policy and Action in Residential Graywater Recycling / L. Bell Organizational Characteristics in Residential Rental Buildings: Exploring the Role of Centralization in Energy Outcomes / Elizabeth Hewitt Re-shuffling the Deck on Environmental Sustainability: Using a Card Sort to Uncover Perceived Behavioral Categories, Effort, and Impact in a College Environment / Casey G. Franklin and Abram Alebiosu Wind Energy and Rural Community Sustainability / Sarah Mills Achieving a Climate-Neutral Campus: A Psychological Analysis of the Participation Process with the Stage Model of Participation / Stefan Zimmermann, Thomas Bäumer and Patrick Müller Sustainability and Civic Engagement: A Communications Engagement and Education Plan / Madhavi Venkatesan, Jordan Remy and Andrew Sukeforth A Sustainable Touristic Place in Times of Crisis? The Case of Empuriabrava—A Superdiverse Mediterranean Resort / Dawid Wladyka and Ricard Morén-Alegret Social Justice and Sustainability Efforts in the U.S.-Mexico Transborder Region / Sylvia Gonzalez-Gorman Envisioning and Implementing Sustainable Bioenergy Systems in the U.S. South / John Schelhas, Sarah Hitchner and J. Peter Brosius Living Well and Living Green: Participant Conceptualizations of Green Citizenship / Erin Miller Hamilton, Meaghan L. Guckian and Raymond De Young Part III Methods and Evaluation Strategies Cognitive Mapping as Participatory Engagement in Social Science Research on Sustainability / Meaghan L. Guckian, Erin Miller Hamilton and Raymond De Young The Impact of Status and Brainstorming in Participation in Small Group Deliberations / Sandra Rodegher Promoting Participation in a Culture of Sustainability Web Survey / Heather M. Schroeder, Andrew L. Hupp and Andrew D. Piskorowski Use of Email Paradata in a Survey of Sustainability Culture / Andrew L. Hupp, Heather M. Schroeder and Andrew D. Piskorowski Innovative Instructional Module Uses Evaluation to Enhance Quality / Martha C. Monroe, Annie Oxarart, Tracey Ritchie and Christine Jie Li From Sustainable Cities to Sustainable People—Changing Behavior Towards Sustainability with the Five A Planning Approach / Petra Stieninger Hurtado Sustainability Knowledge and Attitudes - Assessing Latent Constructs / Adam Zwickle and Keith Jones Sustainability Literacy and Cultural Assessments / John Callewaert A Conceptual Framework for Designing, Embedding and Monitoring a University Sustainability Culture / Richard Adams, Stephen Martin and Katy Boom Epilogue

Note: Contents Part I Unraveling Microbial Diversity and Their Processes Phagotrophic Protists: Central Roles in Microbial Food Webs / Evelyn B. Sherr and Barry F. Sherr Overview Protists as Elemental Recyclers Protists as Consumers of Bacteria Protists as Consumers of Phytoplankton Protists in High Latitude Food Webs Looking to the Future References Drivers That Structure Biodiversity in the Plankton / Tatiana A. Rynearson and Susanne Menden-Deuer Plankton Biodiversity Alternate Hypotheses That Explain the Paradox of the Plankton An Organismal Perspective on the Paradox of the Plankton: A Biodiversity Explosion from Within? Linking Individual Level Behaviors with Plankton Ecology Pervasive Intra-specific Variability in the Genetic Diversity, Physiological Capacity, and Behavioral Repertoire of Plankton Evolution: Generating and Structuring Diversity over the Long Term Opportunities for Progress References The Elongated, the Squat and the Spherical: Selective Pressures for Phytoplankton Shape / Lee Karp-Boss and Emmanuel Boss Introduction Effects of Shape on Diffusion Other Selective Pressures References Crossing the Freshwater/Saline Barrier: A Phylogenetic Analysis of Bacteria Inhabiting Both Freshwater and Marine Ecosystems / Mina Bižić-Ionescu and Danny Ionescu Introduction Recent Data on Shared Taxa Synthesis of Published Sequence Data Future Perspectives References Approaches and Challenges for Linking Marine Biogeochemical Models with the “Omics” Revolution / Victoria J. Coles and Raleigh R. Hood Introduction Bridging the Cultural and Structural Divide Relating Existing Omics to Current Biogeochemical Models Near-Term Innovation Conclusions References Part II Viewing Growth and Trophodynamics Through a Stoichiometric Lens Out of Africa and into Stoichiometry / Susan S. Kilham and Peter Kilham References Exploring the Implications of the Stoichiometric Modulation of Planktonic Predation / Aditee Mitra and Kevin J. Flynn Introduction Characterising the Predator–Prey Stoichiometric Link Elemental Stoichiometry and Commercial Microalgal Production Effects of Temperature, Ocean Acidification and Nutrient Excess Avoiding Predation Stoichiometry and Mixotrophy Conclusions References . Part III Understanding the Mysteries of Light and Nitrogen On Saturating Response Curves from the Dual Perspectives of Photosynthesis and Nitrogen Metabolism / Todd M. Kana and Patricia M. Glibert Introduction Static vs. Dynamic Behavior Gradient Signals and Dynamics of Response Curves Overall Perspective on Dynamic Kinetics References Nitrate Reductase: A Nexus of Disciplines, Organisms, and Metabolism / Erica B. Young and John A. Berges Introduction Why Nitrate Reductase? Understanding That Has Emerged from Recent NR Measurements Recent Advances and Emerging Challenges Conclusion References The Ammonium Paradox of an Urban High- Nutrient Low-Growth Estuary / Frances Wilkerson and Richard Dugdale High-Nutrient Low-Growth Estuaries and Oligotrophication Observation of an Ammonium Paradox Ammonium: The Gatekeeper Controlling Access to Nitrate References Why Is Planktonic Nitrogen Fixation So Rare in Coastal Marine Ecosystems? Insights from a Cross-Systems Approach / Roxanne Marino and Robert W. Howarth References Where Light and Nutrients Collide: The Global Distribution and Activity of Subsurface Chlorophyll Maximum Layers / Greg M. Silsbe and Sairah Y. Malkin At the Confluence of Light and Nutrients Distribution of Marine SCMLs Phytoplankton Production in SCMLs Subsurface Chlorophyll Maximum Layers in Lakes References Part IV Looking in the Rear View Mirror: The Long View on Changing Ecosystems An Ecosystem in Transition: The Emergence of Mixotrophy in the Arabian Sea / Joaquim I. Goes and Helga do R. Gomes Introduction Materials and Methods Results and Discussion References The Saint Lawrence Island Polynya: A 25-Year Evaluation of an Analogue for Climate Change in Polar Regions / Jacqueline M. Grebmeier and Lee W. Cooper Introduction Synthesis Results and Discussion The Northern Bering Sea: Interannual Variability and Change Benthivores Overall Summary References Ecological Processes and Nutrient Transfers from Land to Sea: A 25-Year Perspective on Research and Management of the Seine River System / Josette Garnier and Gilles Billen Introduction 1850–1990: Organic Pollution and Oxygen 1990–2000: Eutrophication and Algal Bloom 2000–2015: Agricultural Pollution and Nitrate Contamination Conclusion: From Microbial Ecology to Territorial Biogeochemistry References A Historical Perspective on Eutrophication in the Pensacola Bay Estuary, FL, USA / Jane M. Caffrey and Michael C. Murrell Introduction Pensacola Bay Physical Setting Human Colonization of Pensacola Bay River and Estuarine Water Quality Controls on Primary Production, Organic Matter, and Nutrient Cycling Summary References Unpublished Reports Websites Meeting in the Middle: On the Interactions Between Microalgae and Their Predators or Zooplankton and Their Food / Karen H. Wiltshire and Maarten Boersma Introduction Materials and Methods Results Discussion References Lake Transparency: A Window into Decadal Variations in Dissolved Organic Carbon Concentrations in Lakes of Acadia National Park, Maine / Collin Roesler and Charles Culbertson Introduction Methods Results Discussion References Part V Focusing on Unique Systems, Processes and Dynamics Phytoplankton Biodiversity in the Oligotrophic Northwestern Sargasso Sea / James L. Pinckney and Tammi L. Richardson Introduction Materials and Methods Results Discussion References Biological Oceanography of the Gulf of Carpentaria, Australia: A Review / Peter C. Rothlisberg and Michele A. Burford Introduction Study Area Currents and Hydrography Phytoplankton and the Role of Nutrients Zooplankton Penaeid Prawn Larval Ecology Larval Dispersal Mechanisms Summary Points References Discerning the Causes of Toxic Cyanobacteria (Lyngbya majuscula) Blooms in Moreton Bay, Australia / Judith M. O’Neil and William C. Dennison Introduction Nutrient Interactions Light Interactions Conceptual Model Broader Significance References Copepod, Ctenophore, and Schyphomedusae Control in Structuring the Chesapeake Bay Summer Mesohaline Planktonic Food Web / Kevin G. Sellner and Stella G. Sellner Introduction Methods Results and Discussion References Microbiogeochemical Ecophysiology of Freshwater Hydrothermal Vents in Mary Bay Canyon, Yellowstone Lake, Yellowstone National Park WY / Carmen Aguilar and Russell Cuhel Introduction Methods Big Picture Outcomes Closing Remarks References Index

Note: Contents 1 An Observational Overview of the Equatorial Ocean 1.1 The Thermocline: The Tropical Ocean as a Two-Layer Model 1.2 Equatorial Currents 1.3 The Somali Current and the Monsoon 1.4 Deep Internal Jets 1.5 The El Niño/Southern Oscillation (ENSO) 1.6 Upwelling in the Gulf of Guinea 1.7 Seasonal Variations of the Thermocline 1.8 Summary References 2 Basic Equations and Normal Modes 2.1 Model 2.2 Boundary Conditions 2.3 Separation of Variables 2.4 Lamb’s Parameter, Equivalent Depths, Kelvin Phase Speeds and All that 2.5 Vertical Modes and Layer Models 2.6 Nondimensionalization References 3 Kelvin, Yanai, Rossby and Gravity Waves 3.1 Latitudinal Wave Modes: An Overview 3.2 Latitudinal Wave Modes: Structure and Spatial Symmetries 3.3 Dispersion Relations: Exact and Approximate Frequencies 3.4 Analytic Approximations to Equatorial Wave Frequencies 3.4.1 Explicit Formulas 3.4.2 Long Wave Series 3.5 Separation of Time Scales 3.6 Forced Waves 3.7 How the Mixed-Rossby Gravity Wave Earned Its Name 3.8 Hough-Hermite Vector Basis 3.8.1 Introduction 3.8.2 Inner Product and Orthogonality 3.8.3 Orthonormal Basis Functions 3.9 Applications of the Hough-Hermite Basis: Linear Initial-Value Problems 3.10 Initialization Through Hough-Hermite Expansion 3.11 Energy Relationships 3.12 The Equatorial Beta-Plane as the Thin Limit of the Nonlinear Shallow Water Equations on the Sphere References 4 The “Long Wave” Approximation & Geostrophy 4.1 Introduction 4.2 Quasi-Geostrophy 4.3 The “Meridional Geostrophy”, “Low Frequency” or “Long Wave” Approximation 4.4 Boundary Conditions 4.5 Frequency Separation of Slow [Rossby/Kelvin] and Fast [Gravity] Waves 4.6 Initial Value Problems in an Unbounded Ocean, Linearized About a State of Rest, in the Long Wave Approximation 4.7 Reflection from an Eastern Boundary in the Long Wave Approximation 4.7.1 The Method of Images 4.7.2 Dilated Images 4.7.3 Zonal Velocity 4.8 Forced Problems in the Long Wave Approximation References 5 The Equator as Wall: Coastally Trapped Waves and Ray-Tracing 5.1 Introduction 5.2 Coastally-Trapped Waves 5.3 Ray-Tracing For Coastal Waves 5.4 Ray-Tracing on the Equatorial Beta-Plane 5.5 Coastal and Equatorial Kelvin Waves 5.6 Topographic and Rotational Rossby Waves and Potential Vorticity References 6 Reflections and Boundaries 6.1 Introduction 6.2 Reflection of Midlatitude Rossby Waves from a Zonal Boundary 6.3 Reflection of Equatorial Waves from a Western Boundary 6.4 Reflection from an Eastern Boundary 6.5 The Meridional Geostrophy/Long Wave Approximation and Boundaries 6.6 Quasi-normal Modes: Definition and Other Weakly Non-existent Phenomena 6.7 Quasi-normal Modes in the Long Wave Approximation: Derivation 6.8 Quasi-normal Modes in the Long Wave Approximation: Discussion 6.9 High Frequency Quasi-free Equatorial Oscillations 6.10 Scattering and Reflection from Islands References 7 Response of the Equatorial Ocean to Periodic Forcing 7.1 Introduction 7.2 A Hierarchy of Models for Time-Periodic Forcing 7.3 Description of the Model and the Problem 7.4 Numerical Models: Reflections and “Ringing” 7.5 Atlantic Versus Pacific 7.6 Summary References 8 Impulsive Forcing and Spin-Up 8.1 Introduction 8.2 The Reflection of the Switched-On Kelvin Wave 8.3 Spin-Up of a Zonally-Bounded Ocean: Overview 8.4 The Interior (Yoshida) Solution 8.5 Inertial-Gravity Waves 8.6 Western Boundary Response 8.7 Sverdrup Flow on the Equatorial Beta-Plane 8.8 Spin-Up: General Considerations 8.9 Equatorial Spin-Up: Details 8.10 Equatorial Spin-Up: Summary References 9 Yoshida Jet and Theories of the Undercurrent 9.1 Introduction 9.2 Wind-Driven Circulation in an Unbounded Ocean: f-Plane 9.3 The Yoshida Jet 9.4 An Interlude: Solving Inhomogeneous Differential Equations at Low Latitudes 9.4.1 Forced Eigenoperators: Hermite Series 9.4.2 Hutton–Euler Acceleration of Slowly Converging Hermite Series 9.4.3 Regularized Forcing 9.4.4 Bessel Function Explicit Solution for the Yoshida Jet 9.4.5 Rational Approximations: Two-Point Padé Approximants and Rational Chebyshev Galerkin Methods 9.5 Unstratified Models of the Undercurrent 9.5.1 Theory of Fofonoff and Montgomery (1955) 9.5.2 Model of Stommel (1960) 9.5.3 Gill (1971) and Hidaka (1961) References 10 Stratified Models of Mean Currents 10.1 Introduction 10.2 Modal Decompositions for Linear, Stratified Flow 10.3 Different Balances of Forces 10.3.1 Bjerknes Balance 10.4 Forced Baroclinic Flow in the “Bjerknes” Approximation 10.4.1 Other Balances 10.5 The Sensitivity of the Undercurrent to Parameters 10.6 Observations of Subsurface Countercurrents (Tsuchiya Jets) 10.7 Alternate Methods for Vertical Structure with Viscosity 10.8 McPhaden’s Model of the EUC and SSCC’s: Results 10.9 A Critique of Linear Models of the Continuously-Stratified, Wind-Driven Ocean References 11 Waves and Beams in the Continuously Stratified Ocean 11.1 Introduction 11.1.1 Equatorial Beams: A Theoretical Inevitability 11.1.2 Slinky Physics and Impedance Mismatch, or How Water Can Be as Reflective as Silvered Glass 11.1.3 Shallow Barriers to Downward Beams 11.1.4 Equatorial Methodology 11.2 Alternate Form of the Vertical Structure Equation 11.3 The Thermocline as a Mirror 11.4 The Mirror-Thermocline Concept: A Critique 11.5 The Zonal Wavenumber Condition for Strong Excitation of a Mode 11.6 Kelvin Beams: Background 11.7 Equatorial Kelvin Beams: Results References 12 Stable Linearized Waves in a Shear Flow 12.1 Introduction 12.2 UðyÞ: Pure Latitudinal Shear 12.3 Neutral Waves in Flow Varying with Both Latitude and Height: Numerical Studies 12.4 Vertical Shear and the Method of Multiple Scales References 13 Inertial Instability, Pancakes and Deep Internal Jets 13.1 Introduction: Stratospheric Pancakes and Equatorial Deep Jets 13.2 Particle Argument 13.2.1 Linear Inertial Instability 13.3 Centrifugal Instability: Rayleigh’s Parcel Argument 13.4 Equatorial Gamma-Plane Approximation 13.5 Dynamical Equator 13.6 Gamma-Plane Instability 13.7 Mixed Kelvin-Inertial Instability 13.8 Summary References 14 Kelvin Wave Instability: Critical Latitudes and Exponentially Small Effects 14.1 Proxies and the Optical Theorem 14.2 Six Ways to Calculate Kelvin Instability 14.2.1 Power Series for the Eigenvalue 14.2.2 Hermite-Padé Approximants 14.2.3 Numerical Methods 14.3 Instability for the Equatorial Kelvin Wave in the Small Wavenumber Limit 14.3.1 Beyond-All-Orders Rossby Wave Instability 14.3.2 Beyond-All-Orders Kelvin Wave Instability in Weak Shear in the Long Wave Approximation 14.4 Kelvin Instability in Shear: The General Case References 15 Nonmodal Instability 15.1 Introduction 15.2 Couette and Poiseuille Flow and Subcritical Bifurcation 15.3 The Fundamental Orr Solution 15.4 Interpretation: The “Venetian Blind Effect” 15.5 Refinements to the Orr Solution 15.6 The “Checkerboard” and Bessel Solution 15.6.1 The “Checkerboard” Solution 15.7 The Dandelion Strategy 15.8 Three-Dimensional Transients 15.9 ODE Models and Nonnormal Matrices 15.10 Nonmodal Instability in the Tropics 15.11 Summary References 16 Nonlinear Equatorial Waves 16.1 Introduction 16.2 Weakly Nonlinear Multiple Scale Perturbation Theory 16.2.1 Reduction from Three Space Dimensions to One 16.2.2 Three Dimensions and Baroclinic Modes 16.3 Solitary and Cnoidal Waves 16.4 Dispersion and Waves 16.4.1 Derivation of the Group Velocity Through the Method of Multiple Scales 16.5 Integrability, Chaos and the Inverse Scattering Method 16.6 Low Order Spectral Truncation (LOST) 16.7 Nonlinear Equatorial Kelvin Waves 16.7.1 Physics of the One-Dimensional Advection (ODA) Equation: ut + cux + buux = 0 16.7.2 Post-Breaking: Overturning, Taylor Shock or “Soliton Clusters”? 16.7.3 Viscous Regularization of Kelvin Fronts: Burgers’ Equation And Matched Asymptotic Perturbation Theory 16.8 Kelvin-Gravity Wave Shortwave Resonance: Curving Fronts and Undulations 16.9 Kelvin Solitary and Cnoidal Waves 16.10 Corner Waves and the Cnoidal-Corner-Breaking Scenario 16.11 Rossby Solitary Waves 16.12 Antisymmetr

Note: Contents 1 Noise-Induced Hearing Loss: Permanent Versus Temporary Threshold Shifts and the Effects of Hair Cell Versus Neuronal Degeneration / M. Charles Liberman 2 Modeled and Measured Underwater Sound Isopleths and Implications for Marine Mammal Mitigation in Alaska / Lisanne A.M. Aerts and Bill Streever 3 Peer-Reviewed Studies on the Effects of Anthropogenic Noise on Marine Invertebrates: From Scallop Larvae to Giant Squid / Natacha Aguilar de Soto 4 Sources of Underwater Sound and Their Characterization / Michael A. Ainslie and Christ A.F. de Jong 5 Assessment of Marine Mammal Impact Zones for Use of Military Sonar in the Baltic Sea / Mathias H. Andersson and Torbjörn Johansson 6 Contribution to the Understanding of Particle Motion Perception in Marine Invertebrates / Michel André, Kenzo Kaifu, Marta Solé, Mike van der Schaar, Tomonari Akamatsu, Andreu Balastegui, Antonio M. Sánchez, and Joan V. Castell 7 Functional Morphology and Symmetry in the Odontocete Ear Complex / William Ary, Ted W. Cranford, Annalisa Berta, and Petr Krysl 8 A Low-Cost Open-Source Acoustic Recorder for Bioacoustics Research / John Atkins and Mark Johnson 9 Assessment of Impulsive and Continuous Low- Frequency Noise in Irish Waters / Suzanne Beck, Joanne O’Brien, Simon Berrow, Ian O’Connor, and Dave Wall 10 Is the Venice Lagoon Noisy? First Passive Listening Monitoring of the Venice Lagoon: Possible Effects on the Typical Fish Community / Marta Bolgan, Marta Picciulin, Antonio Codarin, Riccardo Fiorin, Matteo Zucchetta, and Stefano Malavasi 11 Effect of Pile-Driving Sounds on the Survival of Larval Fish / Loes J. Bolle, Christ A.F. de Jong, Stijn M. Bierman, Pieter J.G. van Beek, Peter W. Wessels, Ewout Blom, Cindy J.G. van Damme, Hendrik V. Winter, and René P.A. Dekeling 12 Challenge of Using Passive Acoustic Monitoring in High-Energy Environments: UK Tidal Environments and Other Case Studies / Cormac G. Booth 13 Hearing Mechanisms and Noise Metrics Related to Auditory Masking in Bottlenose Dolphins (Tursiops truncatus) / Brian K. Branstetter, Kimberly L. Bakhtiari, Jennifer S. Trickey, and James J. Finneran 14 Effects of Hatchery Rearing on the Structure and Function of Salmonid Mechanosensory Systems / Andrew D. Brown, Joseph A. Sisneros, Tyler Jurasin, and Allison B. Coffin 15 Effects of Impulsive Pile-Driving Exposure on Fishes / Brandon M. Casper, Thomas J. Carlson, Michele B. Halvorsen, and Arthur N. Popper 16 Review of the Effects of Offshore Seismic Surveys in Cetaceans: Are Mass Strandings a Possibility? / Manuel Castellote and Carlos Llorens 17 Addressing Challenges in Studies of Behavioral Responses of Whales to Noise / Douglas H. Cato, Rebecca A. Dunlop, Michael J. Noad, Robert D. McCauley, Eric Kniest, David Paton, and Ailbhe S. Kavanagh 18 Measurements of Operational Wind Turbine Noise in UK Waters / Samuel Cheesman 19 A Bioenergetics Approach to Understanding the Population Consequences of Disturbance: Elephant Seals as a Model System / Daniel P. Costa, Lisa Schwarz, Patrick Robinson, Robert S. Schick, Patricia A. Morris, Richard Condit, Daniel E. Crocker, and A. Marm Kilpatrick 20 Singing Fish in an Ocean of Noise: Effects of Boat Noise on the Plainfin Midshipman (Porichthys notatus) in a Natural Ecosystem / Sarika Cullis-Suzuki 21 Detection of Complex Sounds in Quiet Conditions by Seals and Sea Lions / Kane A. Cunningham, Brandon L. Southall, and Colleen Reichmuth 22 Offshore Dredger Sounds: Source Levels, Sound Maps, and Risk Assessment / Christ A.F. de Jong, Michael A. Ainslie, Floor Heinis, and Jeroen Janmaat 23 Effects of Offshore Wind Farms on the Early Life Stages of Dicentrarchus labrax / Elisabeth Debusschere, Bert de Coensel, Sofie Vandendriessche, Dick Botteldooren, Kris Hostens, Magda Vincx, and Steven Degraer 24 The European Marine Strategy: Noise Monitoring in European Marine Waters from 2014 / René Dekeling, Mark Tasker, Michael Ainslie, Mathias Andersson, Michel André, Fabrizio Borsani, Karsten Brensing, Manuel Castellote, John Dalen, Thomas Folegot, Sandra van der Graaf, Russell Leaper, Alexander Liebschner, Jukka Pajala, Stephen Robinson, Peter Sigray, Gerry Sutton, Frank Thomsen, Stefanie Werner, Dietrich Wittekind, and John V. Young 25 Potential Population Consequences of Active Sonar Disturbance in Atlantic Herring: Estimating the Maximum Risk / Lise Doksæter Sivle, Petter Helgevold Kvadsheim, and Michael Ainslie 26 Fulfilling EU Laws to Ensure Marine Mammal Protection During Marine Renewable Construction Operations in Scotland / Sarah J. Dolman, Mick Green, Sarah Gregerson, and Caroline R. Weir 27 Expert Elicitation Methods in Quantifying the Consequences of Acoustic Disturbance from Offshore Renewable Energy Developments / Carl Donovan, John Harwood, Stephanie King, Cormac Booth, Bruno Caneco, and Cameron Walker 28 Masking Experiments in Humans and Birds Using Anthropogenic Noises / Robert J. Dooling and Sandra H. Blumenrath 29 Documenting and Assessing Dolphin Calls and Ambient and Anthropogenic Noise Levels via PAM and a SPL Meter / Kathleen M. Dudzinski, Kelly Melillo-Sweeting, and Justin D. Gregg 30 Soundscapes and Larval Settlement: Larval Bivalve Responses to Habitat-Associated Underwater Sounds / David B. Eggleston, Ashlee Lillis, and DelWayne R. Bohnenstiehl 31 Characterizing Marine Soundscapes / Christine Erbe, Robert McCauley, and Alexander Gavrilov 32 Pile-Driving Noise Impairs Antipredator Behavior of the European Sea Bass Dicentrarchus labrax / Kirsty A. Everley, Andrew N. Radford, and Stephen D. Simpson 33 Using Reaction Time and Equal Latency Contours to Derive Auditory Weighting Functions in Sea Lions and Dolphins / James J. Finneran, Jason Mulsow, and Carolyn E. Schlundt 34 Does Primary Productivity Turn Up the Volume? Exploring the Relationship Between Chlorophyll a and the Soundscape of Coral Reefs in the Pacific / Pollyanna I. Fisher-Pool, Marc O. Lammers, Jamison Gove, and Kevin B. Wong 35 Expert Elicitation of Population-Level Effects of Disturbance / Erica Fleishman, Mark Burgman, Michael C. Runge, Robert S. Schick, and Scott Kraus 36 Current Status of Development of Methods to Assess Effects of Cumulative or Aggregated Underwater Sounds on Marine Mammals / Erica Fleishman, Bill Streever, Robyn Angliss, Christopher W. Clark, William T. Ellison, Adam Frankel, Jason Gedamke, Matthias Leu, Megan McKenna, Roberto Racca, Samantha Simmons, and Robert Suydam 37 Seismic Survey Footprints in Irish Waters: A Starting Point for Effective Mitigation / Thomas Folegot, Dominique Clorennec, Gerald Sutton, and Mark Jessopp 38 Stochastic Modeling of Behavioral Response to Anthropogenic Sounds / Adam S. Frankel, William T. Ellison, Kathleen J. Vigness-Raposa, Jennifer L. Giard, and Brandon L. Southall 39 Underwater Sound Levels at a Wave Energy Device Testing Facility in Falmouth Bay, UK / Joanne K. Garrett, Matthew J. Witt, and Lars Johanning 40 Predicting Anthropogenic Noise Contributions to US Waters / Jason Gedamke, Megan Ferguson, Jolie Harrison, Leila Hatch, Laurel Henderson, Michael B. Porter, Brandon L. Southall, and Sofie Van Parijs 41 Auditory Sensitivity and Masking Profiles for the Sea Otter (Enhydra lutris) / Asila Ghoul and Colleen Reichmuth 42 Are Masking-Based Models of Risk Useful? / Robert C. Gisiner 43 “Large” Tank Acoustics: How Big Is Big Enough? / Michael D. Gray, Peter H. Rogers, Arthur N. Popper, Anthony D. Hawkins, and Richard R. Fay 44 High-Resolution Analysis of Seismic Air Gun Impulses and Their Reverberant Field as Contributors to an Acoustic Environment / Melania Guerra, Peter J. Dugan, Dimitri W. Ponirakis, Marian Popescu, Yu Shiu, Aaron N. Rice, and Christopher W. Clark 45 Underwater Sound Propagation Modeling Methods for Predicting Marine Animal Exposure / Craig A. Hamm, Diana F. McCammon, and Martin L. Taillefer 46 Investigating the Effect of Tones and Frequency Sweeps on the Collective Behavior of Penned Herring (Clupea harengus) / Nils Olav Handegard, Kevin Boswell, Alex de Robertis, Gavin John

Note: Contents Part I Rainfall Analysis Rainfall Probability Distribution Analysis in Selected Lateral Command Area of Upper Krishna Project (Karnataka), India / N. K. Rajeshkumar, P. Balakrishnan, G. V. Srinivas Reddy, B. S. Polise Gowdar and U. Satishkumar Analyzing Rainfall and Reservoir Release Pattern for Ajwa Reservoir: A Case Study / Pushkar Sharma and Sanskriti Mujumdar Preliminary Investigations on Localized Rainfall Interception Losses Under Real Field Observations / M. L. Gaur and Saket Kumar Probabilistic Estimation of Design Daily Runoff from Bamhani Watershed, India / Sarita Gajbhiye Meshram and Vijay P. Singh Part II Evapotranspiration Development of Generalized Higher-Order Neural Network-Based Models for Estimating Pan Evaporation / Sirisha Adamala, N. S. Raghuwanshi and Ashok Mishra Sensitivity Analysis of FAO-56 Penman–Monteith Reference Evapotranspiration Estimates Using Monte Carlo Simulations / Gicy M. Kovoor and Lakshman Nandagiri Quantification of Error in Estimation of Reference Crop Evapotranspiration by Class A Pan Evaporimeter and Its Correction / S. Praharaj, P. K. Mohanty and B. C. Sahoo Part III Urban Runoff Spatial and Temporal Analyses of Impervious Surface Area on Hydrological Regime of Urban Watersheds / Tauseef A. Ansari and Y. B. Katpatal An Assessment of Hydrological Impacts Due to Changes in the Urban Sprawl in Bhopal City and its Peripheral Urban-Rural Fringe / L. Patel, S. Goyal and T. Thomas Simulation of Urban Drainage System Using Disaggregated Rainfall Data / Vinay Ashok Rangari, K. Veerendra Gopi, N. V. Umamahesh and Ajey Kumar Patel Investigation of Drainage for Structures, Lithology and Priority (Flood and Landslide) Assessment Using Geospatial Technology, J&K, NW Himalaya / Umair Ali and Syed Ahmad Ali Hydrologic Design Parameters Database for Water Harvesting Structures in Madhya Pradesh / Ramadhar Singh, Karan Singh and D. M. Bhandarkar Application of Storm Water Management Model to an Urban Catchment / V. Swathi, K. Srinivasa Raju and Ajit Pratap Singh Part IV Soil Erosion and Sediment A Study of Erosional Depositional Activity and Land Use Mapping of Majuli River Island Using Landsat Data / Dipsikha Devi, Nilutpal Phukan and Bibhash Sarma Study of Soil Erosion and Deposition Around an Island in a Natural Stream / Snigdhadip Ghosh, Saptarshi Das and Vijay Kumar Dwivedi Impact Assessment of Alternate Land Cover and Management Practices on Soil Erosion: A Case Study / T. R. Nayak, R. K. Jaiswal, R. V. Galkate and T. Thomas Geostatistical Analysis of River Sedimentation Behavior in Kerala State / Mathew K. Jose, T. Chandramohan, B. K. Purandara and B. Venkatesh Study of Mineralogical Composition of Sediment in Brahmaputra River in Urban Stretch of Guwahati City, Assam, India / Mamata Das and Triptimoni Borah Part V Remote Sensing and GIS Applications Hypsometric Analysis for Assessing Erosion Status of Watershed Using Geographical Information System / S. K. Sharma, S. Gajbhiye, S. Tignath and R. J. Patil Assessment of Different Bathymetry Statistical Models Using Landsat-8 Multispectral Images / Omar Makboul, Abdelazim Negm, Saleh Mesbah and Mohamed Mohasseb Estimation of Minimum and Maximum Air Temperature Using MODIS Remote Sensing Imagery and Geographical Information System (GIS) / P. Sardhara Bharatkumar, P. Dholariya Jay, M. K. Tiwari and M. L. Gaur A RS and GIS Approaches for the Estimation of Runoff and Soil Erosion in SA-13 Watershed / H. N. Bhange and V. V. Deshmukh Rainwater Harvesting Structure Site Suitability Using Remote Sensing and GIS / B. K. Gavit, R. C. Purohit, P. K. Singh, Mahesh Kothari and H. K. Jain Land Surface Temperature Estimation Using Remote Sensing Data / Vijay Solanky, Sangeeta Singh and S. K. Katiyar Watershed Prioritization of Wardha River Basin, Maharashtra, India Using Morphometric Parameters: A Remote Sensing and GIS-Based Approach / B. S. Manjare, S. Khan, S. A. Jawadand and M. A. Padhye Flood Assessment of Lolab Valley from Watershed Characterization Using Remote Sensing and GIS Techniques / Mannan Bashir Wani, Syed Ahmad Ali and Umair Ali Delineation of Paleochannels in Periyar River Basin of Kerala Using Remote Sensing and Electrical Resistivity Methods / C. P. Priju, Jiby Francis, P. R. Arun and N. B. Narasimha Prasad Application of EO-1 Hyperion Data for Mapping and Discrimination of Agricultural Crops / H. Ramesh and P. P. Soorya Geomatica-Based Approach for Automatic Extraction of Lineaments from ASTER-GDEM Data, in Part of Al-Rawdah, Shabwah, Southeast Yemen / Mohammed Sultan Alshayef and Akram Javed Part VI Watershed Runoff and Floods Morpho-Mathematical Analysis of Bharar River Basin District Chhatarpur-Central India / Pradeep Kumar Jain Application of Principal Component Analysis for Grouping of Morphometric Parameters and Prioritization of Watershed / Sarita Gajbhiye Meshram and S. K. Sharma Velocity Distribution in Vortex Chamber at High Water Abstraction Ratio / Mohammad Athar and Shivani Srotriya Performance Appraisal of Friction Factor Estimators / Abhishek Mishra, Aditya Deshpande and Bimlesh Kumar Experimental Investigations of Wave Height Attenuation by Submerged Artificial Vegetation / Beena Mary John, I. Mohit Babu, Kiran G. Shirlal and Subba Rao Developing Rating Curves for Nubia Lake, Sudan, Using RS/GIS / Mohamed Elsahabi, Abdelazim Negm and Kamal Ali A Spreadsheet Approach for Prediction of Rating Curve Parameters / Mohammad Muzzammil, Javed Alam and Mohammad Zakwan Experimental Study on Role of Emergent Artificial Coastal Vegetation in Controlling Wave Run Up / Beena Mary John, R. T. Arun Vignesh, Kiran G. Shirlal and Subba Rao Development of Regional Soil Water Retention (SWR) Characteristics / R. K. Jaiswal, T. Thomas, R. V. Galkate, S. Singh and J. V. Tyagi Revision of Empirical Coefficients of Commonly Used Flood Formulae Using Flow Data from Karnataka Rivers / T. Chandramohan, Mathew K. Jose, B. K. Purandara and B. Venkatesh Reservoir Inflow Forecasting Using Extreme Learning Machines / Mukesh Kumar Tiwari and Sanjeet Kumar Quantifying Discontinuity, Connectivity, Variability, and Hierarchy in Overland Flow Generation: Comparison of Different Modeling Methods / Xuefeng Chu Nondimensional UH-Based Smoothing of S-Curve-Derived UH Oscillations / P. R. Patil, S. K. Mishra, Nayan Sharma and Vijay P. Singh Fuzzy-Based Comprehensive Evaluation of Environmental Flow Alteration / Kairong Lin, Fan Zhang, Qiang Zhang, Xinjun Tu and Yang Hu Part VII Watershed Modeling Spatial Characters of a Tropical River Basin, South-West Coast of India / Girish Gopinath, N. Ramisha, Ajith G. Nair and N. P. Jesiya Streamflow Estimation Using SWAT Model Over Seonath River Basin, Chhattisgarh, India / Sabyasachi Swain, Mani Kant Verma and M. K. Verma Revisiting the Soil Conservation Service Curve Number Method / S. K. Mishra, Vijay P. Singh and P. K. Singh Hydrological Impacts of Rejuvenating Degraded Hilly Watershed in Shivalik Region / A. K. Tiwari and V. K. Bhatt Modeling of a River Basin Using SWAT Model / B. Venkatesh, T. Chandramohan, B. K. Purandara, Mathew K. Jose and P. C. Nayak Performance of the Xinanjiang Model / A. Ahirwar, M. K. Jain and M. Perumal

Note: Contents Part I Climatology, General Circulation, Climate Variability and Stratosphere-Troposphere Coupling 1 Climatology and General Circulation 1.1 Climatology: SLP and SST 1.2 General Circulation 1.2.1 Meridional Circulation 1.2.2 Jet Formation: Thermal Wind Balance Relationship 1.2.3 Walker Circulation 2 Major Modes of Variability 2.1 Variability in the Troposphere 2.1.1 El Niño and Southern Oscillation (ENSO) 2.1.2 North Atlantic Oscillation (NAO) 2.1.3 Arctic Oscillation (AO) and Antarctic Oscillation (AAO) 2.1.4 Pacific Decadal Oscillation (PDO) 2.1.5 Atlantic Multidecadal Oscillation (AMO) 2.1.6 Indian Summer Monsoon (ISM) 2.1.7 Indian Ocean Dipole (IOD) 2.2 Variability in the Stratosphere 2.2.1 Quasi-Biennial Oscillation (QBO) 2.2.2 Stratospheric Sudden Warming (SSW) Referenes 3 Stratosphere-Troposphere Coupling 3.1 Background 3.2 Discussion with Schematic 3.3 Strength of Westerly: Solar Influence 3.4 Role of Zero Wind Line: QBO Influence 3.5 Sun, QBO and Polar Temperature in North Pole 3.6 Composites of Time Height Development of NAM 3.7 Annular Modes Pattern Similar 3.8 Solar Influence: Polar Vortex and Tropical Lower Stratosphere 3.9 Solar Influence: Tropical Lower Stratosphere to Troposphere References 4 Teleconnection Among Various Modes 4.1 Polar Vortex, QBO and ENSO 4.2 Polar Vortex and ENSO 4.3 ENSO and Polar Troposphere 4.4 ENSO, Polar Annular Modes and JET 4.5 ENSO Teleconnections 4.5.1 El Niño (Warm) and La Niña (Cold) Definition 4.5.2 El Niño or La Niña? 4.5.3 ENSO Seasonal Locking 4.5.4 Potential Problems with SST Data 4.5.5 Indian Summer Monsoon and Walker Circulation 4.5.6 Different Types of ENSO 4.5.7 Homogeneous Monsoon Region 4.5.8 ENSO ISM Correlation 4.5.9 SST Composites: EN vs. LN 4.5.10 ISM ENSO Teleconnection Compositing: EN vs. LN 4.5.11 Rainfall in South America ENSO (Different Types) Teleconnection 4.5.12 Summary: ENSO and Teleconnections References 5 Solar Influence Around Various Places: Robust Solar Signal on Climate 5.1 Signal on Sea Level Pressure (DJF) Using Multiple Linear Regression 5.1.1 Method of Multiple Regression Analysis 5.2 Solar Signal Around Aleutian Low (AL) and Pacific High (PH) 5.3 Solar Influence: Tropical Pacific SST 5.4 ENSO and Sun Phase Locking 5.5 Solar Signal in Tropical Pacific SST Using Compositing 5.5.1 Method of Solar Peak Year Compositing 5.6 Observation: Annual Mean Temperature References 6 Total Solar Irradiance (TSI): Measurements and Reconstructions References Part II Atmosphere-Ocean Coupling and Solar Variability 7 Ocean Coupling 7.1 Shallow Overturning Circulation 7.2 ENSO 7.2.1 ENSO, Thermocline and Upper Ocean Heat Content 7.2.2 ENSO and Delayed Oscillator Theory 7.2.3 ENSO and Shallow MOC in Tropical Pacific 7.2.4 Pycnocline Convergence vs. SST 7.2.5 Abrupt Rise in Temperature During 1977–1998 References 8 The Sun and ENSO Connection–Contradictions and Reconciliations 8.1 Solar Signal and ENSO 8.2 Contradiction (I): Solar Signal on Tropical Pacific SST-Active Solar Years and ENSO 8.3 Contradiction (II): Solar Signal on Tropical Pacific SST-El Niño or La Niña 8.4 Proposed Mechanism: Earlier Period 8.5 Proposed Mechanism: Later Period 8.6 Contradictions and Reconciliations References 9 A Debate: The Sun and the QBO 9.1 Data Analysis: Solar and QBO Separately 9.2 Polar Temperature During JF with Respect to QBO (40 hPa) and F10.7 9.3 Polar Temperature During JF for QBO (30 hPa) and F10.7 9.4 Time Series of QBO at Different Height and EOF Analysis 9.5 Combined Effects: Solar with QBO 9.6 Summary References 10 Solar Influence: ‘Top Down’ vs. ‘Bottom Up’ 10.1 Solar Influence: ‘Top Down’ 10.1.1 Solar Influence: ‘Top-Down’ – via Polar Vortex and Lower Stratosphere 10.1.2 Solar Influence: ‘Top-Down’ – via Lower Stratosphere to Troposphere 10.1.3 Solar Influence: ‘Top-Down’ – via Stratospheric Polar Vortex to Polar Troposphere 10.2 Solar Influence: ‘Bottom-Up’ References 11 An Overview of Solar Influence on Climate 11.1 Introduction 11.1.1 Methodology 11.2 Representative Results: Figure and Tables 11.3 Results Text 11.3.1 Atmosphere Only: Sun and QBO 11.3.2 Ocean (Only Pacific) and Atmosphere Coupling: Sun, QBO and ENSO 11.3.3 Atmosphere and Ocean (Only Pacific) Coupling: Sun, QBO, ENSO and Climate Change 11.4 Discussion References Part III Other Major Influences on Climate 12 Sun: Atmosphere-Ocean Coupling – Possible Limitations 12.1 Sun: Atmosphere-Ocean Coupling ‘Top-Down’ vs. ‘Bottom-Up’ Mechanism: a Case Study 12.2 Sun: Atmosphere-Ocean Coupling – Limitations of Peak Year Compositing 12.2.1 Solar Cycle Signals in Peak Year Compositing for SLP: a Case Study 12.2.2 Solar Cycle Signals in Peak Year Compositing for Indian Summer Monsoon: a Case Study 12.3 Difference in Winter Surface Climate Between Solar Minimum and Maximum 12.4 Sun (Using SSN) and NAO in Observation Using MLR Technique 12.4.1 Sun (Using SSN) and NAO in Two Different Time Periods (1856–1977) and (1878–1997) 12.4.2 Sun (SSN) and NAO Longer Period (1870–2010) 12.4.3 Sun (SSN) and NAO Lag Relationship 12.5 AMO and PDO Relationship References 13 The Arctic and Antarctic Sea Ice 13.1 Arctic Sea Ice: Last Few Years 13.2 Arctic Sea Ice: Change in 2014 13.3 Arctic Sea Ice and Solar Influence 13.4 Antarctic Sea Ice Reference 14 CMIP5 Project and Some Results 14.1 Global Climate Models (GCMs): Basic Equations 14.2 CMIP5 Project 14.3 Experiments: Historical and RCP (Representative Concentration Pathway) Scenarios 14.4 Some CMIP5 Models 14.5 Temperature in CMIP5 and Observation 14.6 Indian Summer Monsoon (ISM) and ENSO in CMIP5 Models 14.6.1 CMIP5 Models for ISM Are Performing Well 14.6.2 CMIP5 Models for ISM Not Performing Well 14.6.3 Models: CMIP5, AMIP5 and High Top, Low Top 14.6.4 Precipitation Composites- El Niño: (CMIP5 vs. AMIP5) 14.6.5 Changes in ENSO Variability 2050–2100 in CMIP3 Experiments 14.6.6 Stratospheric Features in CMIP5: Low and High Top Models 14.6.7 Simulated and Observed Stratospheric Temperature References 15 Green House Gas Warming 15.1 Laws of Radiation 15.2 Solar Radiation vs. Terrestrial Radiation 15.3 Radiation Transmitted by the Atmosphere and Atmospheric Windows 15.4 Absorption: Water Vapour and CO2 15.5 CO 2 as a Greenhouse Gas 15.6 Temperature and CO 2: 400,000 Years 15.7 Earth’s Temperature Change in the Last 2000 Years 15.8 Radiative Forcing 15.9 Global Energy Balance References 16 Volcanic Influences 16.1 Volcano Cooling Effect 16.2 Influences of Volcanic Eruption 16.3 Effect of Large Eruptions on Weather and Climate 16.4 Polar Warming Associated with Large Eruptions 16.5 Sun, Volcano and ENSO References 17 Ozone Depletion in the Stratosphere 17.1 Ozone Hole and Montreal Protocol 17.2 Ozone Hole Animation 17.3 Greenhouse Gases and Ozone in Model Reference 18 Influence of Various Other Solar Outputs 18.1 Mechanisms 18.2 Other Influences, e.g. Galactic Cosmic Rays 18.3 Sunspot vs. Galactic Cosmic Ray (GCR) References Few questions and Exercises for Students Further Reading Index

Note: Table of Contents Preface Part I. Foundations of Data Systems 1. Reliable, Scalable, and Maintainable Applications Thinking About Data Systems Reliability Hardware Faults Software Errors Human Errors How Important Is Reliability? Scalability Describing Load Describing Performance Approaches for Coping with Load Maintainability Operability: Making Life Easy for Operations Simplicity: Managing Complexity Evolvability: Making Change Easy Summary 2. Data Models and Query Languages Relational Model Versus Document Model The Birth of NoSQL The Object-Relational Mismatch Many-to-One and Many-to-Many Relationships Are Document Databases Repeating History? Relational Versus Document Databases Today Query Languages for Data Declarative Queries on the Web MapReduce Querying Graph-Like Data Models Property Graphs The Cypher Query Language Graph Queries in SQL Triple-Stores and SPARQL The Foundation: Datalog Summary 3. Storage and Retrieval Data Structures That Power Your Database Hash Indexes SSTables and LSM-Trees B-Trees Comparing B-Trees and LSM-Trees Other Indexing Structures Transaction Processing or Analytics? Data Warehousing Stars and Snowflakes: Schemas for Analytics Column-Oriented Storage Column Compression Sort Order in Column Storage Writing to Column-Oriented Storage Aggregation: Data Cubes and Materialized Views Summary 4. Encoding and Evolution Formats for Encoding Data Language-Specific Formats JSON, XML, and Binary Variants Thrift and Protocol Buffers Avro The Merits of Schemas Modes of Dataflow Dataflow Through Databases Dataflow Through Services: REST and RPC Message-Passing Dataflow Summary Part II. Distributed Data 5. Replication Leaders and Followers Synchronous Versus Asynchronous Replication Setting Up New Followers Handling Node Outages Implementation of Replication Logs Problems with Replication Lag Reading Your Own Writes Monotonic Reads Consistent Prefix Reads Solutions for Replication Lag Multi-Leader Replication Use Cases for Multi-Leader Replication Handling Write Conflicts Multi-Leader Replication Topologies Leaderless Replication Writing to the Database When a Node Is Down Limitations of Quorum Consistency Sloppy Quorums and Hinted Handoff Detecting Concurrent Writes Summary 6. Partitioning Partitioning and Replication Partitioning of Key-Value Data Partitioning by Key Range Partitioning by Hash of Key Skewed Workloads and Relieving Hot Spots Partitioning and Secondary Indexes Partitioning Secondary Indexes by Document Partitioning Secondary Indexes by Term Rebalancing Partitions Strategies for Rebalancing Operations: Automatic or Manual Rebalancing Request Routing Parallel Query Execution Summary 7. Transactions The Slippery Concept of a Transaction The Meaning of ACID Single-Object and Multi-Object Operations Weak Isolation Levels Read Committed Snapshot Isolation and Repeatable Read Preventing Lost Updates Write Skew and Phantoms Serializability Actual Serial Execution Two-Phase Locking (2PL) Serializable Snapshot Isolation (SSI) Summary 8. The Trouble with Distributed Systems Faults and Partial Failures Cloud Computing and Supercomputing Unreliable Networks Network Faults in Practice Detecting Faults Timeouts and Unbounded Delays Synchronous Versus Asynchronous Networks Unreliable Clocks Monotonic Versus Time-of-Day Clocks Clock Synchronization and Accuracy Relying on Synchronized Clocks Process Pauses Knowledge, Truth, and Lies The Truth Is Defined by the Majority Byzantine Faults System Model and Reality Summary 9. Consistency and Consensus Consistency Guarantees Linearizability What Makes a System Linearizable? Relying on Linearizability Implementing Linearizable Systems The Cost of Linearizability Ordering Guarantees Ordering and Causality Sequence Number Ordering Total Order Broadcast Distributed Transactions and Consensus Atomic Commit and Two-Phase Commit (2PC) Distributed Transactions in Practice Fault-Tolerant Consensus Membership and Coordination Services Summary Part III. Derived Data 10. Batch Processing Batch Processing with Unix Tools Simple Log Analysis The Unix Philosophy MapReduce and Distributed Filesystems MapReduce Job Execution Reduce-Side Joins and Grouping Map-Side Joins The Output of Batch Workflows Comparing Hadoop to Distributed Databases Beyond MapReduce Materialization of Intermediate State Graphs and Iterative Processing High-Level APIs and Languages Summary 11. Stream Processing Transmitting Event Streams Messaging Systems Partitioned Logs Databases and Streams Keeping Systems in Sync Change Data Capture Event Sourcing State, Streams, and Immutability Processing Streams Uses of Stream Processing Reasoning About Time Stream Joins Fault Tolerance Summary 12. The Future of Data Systems Data Integration Combining Specialized Tools by Deriving Data Batch and Stream Processing Unbundling Databases Composing Data Storage Technologies Designing Applications Around Dataflow Observing Derived State Aiming for Correctness The End-to-End Argument for Databases Enforcing Constraints Timeliness and Integrity Trust, but Verify Doing the Right Thing Predictive Analytics Privacy and Tracking Summary Glossary Index

Note: Contents Pullback Attractor Crisis in a Delay Differential ENSO Model / Mickaël D. Chekroun, Michael Ghil, and J. David Neelin Shear-Wave Splitting Indicates Non-Linear Dynamic Deformation in the Crust and Upper Mantle / Stuart Crampin, Gulten Polat, Yuan Gao, David B. Taylor, and Nurcan Meral Ozel Stochastic Parameterization of Subgrid-Scale Processes: A Review of Recent Physically Based Approaches / Jonathan Demaeyer and Stéphane Vannitsem Large-Scale Atmospheric Phenomena Under the Lens of Ordinal Time-Series Analysis and Information Theory Measures / J.I. Deza, G. Tirabassi, M. Barreiro, and C. Masoller Supermodeling: Synchronization of Alternative Dynamical Models of a Single Objective Process / Gregory S. Duane, Wim Wiegerinck, Frank Selten, Mao-Lin Shen, and Noel Keenlyside Are We Measuring the Right Things for Climate? / Christopher Essex and Bjarne Andresen What Have Complex Network Approaches Learned Us About El Niño? / Qing Yi Feng and Henk A. Dijkstra Late Quaternary Climate Response at 100 kyr: A Noise-Induced Cycle Suppression Mechanism / Ivan L’Heureux Role of Nonlinear Eddy Forcing in the Dynamics of Multiple Zonal Jets / Igor Kamenkovich and Pavel Berloff Data-Adaptive Harmonic Decomposition and Stochastic Modeling of Arctic Sea Ice / Dmitri Kondrashov, Mickaël D. Chekroun, Xiaojun Yuan, and Michael Ghil Cautionary Remarks on the Auto-Correlation Analysis of Self-Similar Time Series / Sung Yong Kim Emergence of Coherent Clusters in the Ocean / A.D. Kirwan Jr., H.S. Huntley, and H. Chang The Rise and Fall of Thermodynamic Complexity and the Arrow of Time / A. D. Kirwan Jr. and William Seitz From Fractals to Stochastics: Seeking Theoretical Consistency in Analysis of Geophysical Data / Demetris Koutsoyiannis, Panayiotis Dimitriadis, Federico Lombardo, and Spencer Stevens Role of Nonlinear Dynamics in Accelerated Warming of Great Lakes / Sergey Kravtsov, Noriyuki Sugiyama, and Paul Roebber The Prediction of Nonlinear Polar Motion Based on Artificial Neural Network (ANN) and Fuzzy Inference System (FIS) / Ramazan Alper Kuçak, Ra¸sit Ulu˘g, and Orhan Akyılmaz Harnessing Butterflies: Theory and Practice of the Stochastic Seasonal to Interannual Prediction System (StocSIPS) / S. Lovejoy, L. Del Rio Amador, and R. Hébert Regime Change Detection in Irregularly Sampled Time Series / Norbert Marwan, Deniz Eroglu, Ibrahim Ozken, Thomas Stemler, Karl-Heinz Wyrwoll, and Jürgen Kurths Topological Data Analysis: Developments and Applications / Francis C. Motta Nonlinear Dynamical Approach to Atmospheric Predictability / C. Nicolis Linked by Dynamics: Wavelet-Based Mutual Information Rate as a Connectivity Measure and Scale-Specific Networks / Milan Paluš Non-Extensive Statistical Mechanics: Overview of Theory and Applications in Seismogenesis, Climate, and Space Plasma / G.P. Pavlos, L.P. Karakatsanis, A.C. Iliopoulos, E.G. Pavlos, and A.A. Tsonis Spatial Patterns of Peak Flow Quantiles Based on Power-Law Scaling in the Mississippi River Basin / Gabriel Perez, Ricardo Mantilla, and Witold F. Krajewski Studying the Complexity of Rainfall Within California Via a Fractal Geometric Method / Carlos E. Puente, Mahesh L. Maskey, and Bellie Sivakumar Pandora Box of Multifractals: Barely Open? / Daniel Schertzer and Ioulia Tchiguirinskaia Complex Networks and Hydrologic Applications / Bellie Sivakumar, Carlos E. Puente, and Mahesh L. Maskey Convergent Cross Mapping: Theory and an Example / Anastasios A. Tsonis, Ethan R. Deyle, Hao Ye, and George Sugihara Randomnicity: Randomness as a Property of the Universe / Anastasios A. Tsonis Insights in Climate Dynamics from Climate Networks / Anastasios A. Tsonis On the Range of Frequencies of Intrinsic Climate Oscillations / Anastasios A. Tsonis and Michael D. Madsen The Prediction of Nonstationary Climate Series by Incorporating External Forces / Geli Wang, Peicai Yang, and Anastasios A. Tsonis The Impact of Nonlinearity on the Targeted Observations for Tropical Cyclone Prediction / Feifan Zhou and He Zhang Index

Note: Contents ISOLA Code for Multiple-Point Source Modeling—Review / Jiří Zahradník and Efthimios Sokos Seismic Moment Tensors in Anisotropic Media: A Review / Václav Vavryčuk The Frequency-Domain Moment-Tensor Inversion: Retrieving the Complete Source Moment-Tensor Spectra and Time Histories / Xiaoning Yang, Brian W. Stump and Mason D. Macphail Berkeley Seismic Moment Tensor Method, Uncertainty Analysis, and Study of Non-double-couple Seismic Events / Douglas S. Dreger Estimating Stability and Resolution of Waveform Inversion Focal Mechanisms / S. Scolaro, C. Totaro, D. Presti, Sebastiano D’Amico, G. Neri and B. Orecchio The Method of Cataclastic Analysis of Discontinuous Displacements / Yu. L. Rebetsky and A. Yu. Polets Challenges in Regional Moment Tensor Resolution and Interpretation / Simone Cesca and Sebastian Heimann The Role of Moment Tensors in the Characterization of Hydraulic Stimulations / Ismael Vera Rodriguez, James Rutledge and Sergey Stanchits Constrained Moment Tensors: Source Models and Case Studies / Jan Šílený Seismic Deformation Derived from Moment Tensor Summation: Application Along the Hellenic Trench / Anastasia Kiratzi, Christoforos Benetatos and Filippos Vallianatos Estimation of Empirical Green’s Tensor Spatial Derivative Elements: A Preliminary Study Using Strong Motion Records in Southern Fukui Prefecture, Japan / Michihiro Ohori Retrieval of the Seismic Moment Tensor from Joint Measurements of Translational and Rotational Ground Motions: Sparse Networks and Single Stations / Stefanie Donner, Heiner Igel, Céline Hadziioannou and the Romy group Overview of Moment Tensor Analysis in New Zealand / John Ristau Applications of Moment Tensor Solutions to the Assessment of Earthquake Hazard in Canada / J. F. Cassidy, H. Kao, John Ristau and A. Bent Intraplate Earthquakes in Europe—Source Parameters from Regional Moment Tensor Analysis / Jochen Braunmiller Source Characteristics of the January 8, 2013 (M W = 5.7) and May 24, 2014 (M W = 6.8) North Aegean Earthquakes Sequence / Doğan Kalafat, Kıvanç Kekovalı and Ali Pınar Investigating the Focal Mechanisms of the August 4th, 2003, Mw 7.6, South Orkney Islands Earthquake and its Aftershocks Sequence / M. P. Plasencia Linares, M. Guidarelli, M. Russi and G. F. Panza Waveform Modelling of 2009 Bhutan Earthquake of Magnitude 6.1 (Mw) Using Local Network Data of North East India / Santanu Baruah and Midusmita Boruah Resolving the Tectonic Stress by the Inversion of Earthquake Focal Mechanisms. Application in the Region of Greece. A Tutorial / Ioannis G. Kassaras and Vasilis Kapetanidis Relative Locations of Clustered Earthquakes in the Sea of Marmara and States of Local Stresses in the East of the Central Marmara Basin / Yasemin Korkusuz Öztürk and Nurcan Meral Özel Focal Mechanisms of Earthquakes and Stress Field of the Earth Crust in Azerbaijan / G. J. Yetirmishli and S. E. Kazimova Seismotectonic Crustal Strains of the Mongol-Baikal Seismic Belt from Seismological Data / Alena Seredkina and Valentina Melnikova The Stress State of Seismic Areas of the Central and East Asia / Yu. L. Rebetsky, A. Yu. Polets, O. A. Kuchay and N. A. Sycheva The Significance of Crustal Velocity Model in Moment Tensor Solutions: A Case Study of Yedisu Earthquakes / Fatih Turhan, Musavver Didem Cambaz and Jiří Zahradník An Overview of the Seismicity and Tectonics of the Black Sea / Doğan Kalafat Coulomb Stress Changes in the Area of December 2013–January 2014 Sannio-Matese Seismic Sequence (Southern Italy) / Santanu Baruah and Sebastiano D’Amico Active Faulting in the Earth’s Crust of the Baikal Rift System Based on the Earthquake Focal Mechanisms / Vladimir A. Sankov and Anna A. Dobrynina Quaternary Stress Field and Faulting in the Western Part of the Catanzaro Trough (Calabria, Southern Italy) / F. Brutto, F. Muto, M. F. Loreto, Sebastiano D’Amico, N. De Paola, V. Tripodi and S. Critelli A Seismogenic Zone Model for Seismic Hazard Studies in Northwestern Africa / J. A. Peláez, J. Henares, M. Hamdache and C. Sanz de Galdeano A Trial Modeling of Perturbed Repeating Earthquakes Combined by Mathematical Statics, Numerical Modeling and Seismological Observations / Keisuke Ariyoshi, Shunichi Nomura, Naoki Uchida and Toshihiro Igarashi Getting Started with GMT: An Introduction for Seismologists / Matthew R. Agius Devices for a Rotational Ground Motion Measurement / Leszek R. Jaroszewicz and Anna Kurzych

Note: Contents 1 Curves, Maps and Hotspots: The Diversity and Distribution of Araneomorph Spiders in the Neotropics / Adalberto J. Santos, Antonio D. Brescovit, Márcia de Oliveira-Tomasi, Philip Russo, and Ubirajara Oliveira 2 Behavior and Biology of Mygalomorphae / Fernando Pérez-Miles and Carlos Perafán 3 Neotropical Arachnological Collections: Basic Tools for the Development of Spider Research / Antonio D. Brescovit, Oscar Francke, Álvaro Laborda, Griselda Montiel Parra, Cristina Scioscia, Miguel Simó, and Carlos Víquez Núñez 4 Habitat Selection and Dispersal / Dinesh Rao 5 Dispersal Strategies, Genetic Diversity, and Distribution of Two Wolf Spiders (Araneae, Lycosidae): Potential Bio-Indicators of Ecosystem Health of Coastal Dune Habitats of South America / Leticia Bidegaray-Batista, Miquel Arnedo, Ana Carlozzi, Carolina Jorge, Patricio Pliscoff, Rodrigo Postiglioni, Miguel Simó, and Anita Aisenberg 6 Webs: Diversity, Structure and Function / Sean J. Blamires, Shichang Zhang, and I-Min Tso 7 Spider–Plant Interactions: An Ecological Approach / João Vasconcellos-Neto, Yuri Fanchini Messas, Hebert da Silva Souza, German Antonio Villanueva-Bonila, and Gustavo Quevedo Romero 8 Spiders as Plant Partners: Complementing Ant Services to Plants with Extrafloral Nectaries / Kleber Del-Claro, Vanessa Stefani, Larissa Nahas, and Helena Maura Torezan-Silingardi 9 Foraging Strategies of Cursorial and Ambush Spiders / Rodrigo H. Willemart and Mariángeles Lacava 10 Trophic Niches and Trophic Adaptations of Prey-Specialized Spiders from the Neotropics: A Guide / Stano Pekár, Luis Fernando García, and Carmen Viera 11 Spiders Associated with Agroecosystems: Roles and Perspectives / Marco Antonio Benamú, Mariángeles Lacava, Luis Fernando García, Martín Santana, and Carmen Viera 12 Sexual Selection in Neotropical Spiders: Examples from Selected Groups / Luiz Ernesto Costa-Schmidt, María José Albo, Fedra Bollatti, Franco Cargnelutti, Lucía Calbacho-Rosa, Sofía Copperi, Nelson Ferretti, Matías Izquierdo, and Alfredo V. Peretti 13 Parental Care and Sociality / Carmen Viera and Ingi Agnarsson 14 Plasticity and Cognition in Spiders / Hilton F. Japyassú 15 Anti-Predator Strategies / Felipe M. Gawryszewski 16 Host Behavioural Manipulation of Spiders by Ichneumonid Wasps / Marcelo O. Gonzaga, Thiago G. Kloss, and Jober F. Sobczak

Note: Contents Part I Introduction to the Central Nervous System 1 Introduction to the Central Nervous System 1.1 The Neuron 1.2 The Nervous System 1.2.1 Peripheral Nervous System (Fig. 1.3) 1.2.2 Central Nervous System Bibliography 2 Neurocytology: Cells of the CNS 2.1 The Neuron 2.1.1 Dendrites 2.1.2 Soma 2.1.3 Golgi Type I and II Neurons 2.1.4 Dendritic Spines (Fig. 2.2) 2.1.5 Nucleus 2.1.6 Neuronal Cytoskeleton 2.1.7 Microtubules and Axoplasmic Flow 2.1.8 Neurofibrillary Tangles 2.2 Synapse 2.2.1 Synaptic Structure 2.2.2 Synaptic Types 2.2.3 Synaptic Transmission 2.2.4 Neurotransmitters (Table 2.3) 2.2.5 Modulators of Neurotransmission 2.2.6 Synaptic Vesicles (Fig. 2.16) (Table 2.4) 2.2.7 Effectors and Receptors 2.3 Supporting Cells of the Central Nervous System 2.3.1 Astrocytes (Figs. 2.6 and 2.14; Table 2.7) 2.3.2 Oligodendrocytes (Fig. 2.9) 2.3.3 Endothelial Cells 2.3.4 Mononuclear Cells: Monocytes and Microglia 2.3.5 Ependymal Cells (Fig. 2.20) 2.3.6 Supporting Cells in the Peripheral Nervous System 2.4 Response of the Nervous System to Injury 2.4.1 Degeneration 2.5 Regeneration 2.5.1 Peripheral Nerve Regeneration 2.5.2 Regeneration in the Central Nervous System 2.5.3 Neurogenesis in the Adult Brain Stem 2.5.4 Nerve Growth Factors (NGF) 2.5.5 Glial Response to Injury 2.6 Blood–Brain Barrier 2.6.1 Blood–Brain Barrier (Fig. 2.24) 2.6.2 Extracellular Space Specific References 3 Neuroembryology and Congenital Malformations 3.1 Formation of the Central Nervous System 3.2 Histogenesis 3.2.1 Repair of Damaged Nervous System 3.2.2 Growth Cone Guidance 3.2.3 Programmed Cell Death (PCD): Apoptosis 3.2.4 Neuronal Death 3.2.5 Development of Blood Vessels in the Brain 3.2.6 Ventricular System 3.2.7 Formation of Peripheral Nervous System 3.2.8 Spinal Cord Differentiation 3.3 Brain Differentiation 3.3.1 Rhombencephalon (Hindbrain) 〉 Pons, Medulla, and Cerebellum 3.3.2 Mesencephalon 〉 Adult Midbrain 3.3.3 Prosencephalon 〉 Cerebral Hemispheres and Diencephalon 3.3.4 Diencephalon 3.3.5 Cranial Nerves 3.3.6 Telencephalon 3.3.7 Primary Sulci 3.3.8 Development of the Cerebral Cortex 3.4 Prenatal Development of the Cerebral Cortex 3.5 Changes in the Cortical Architecture as a Function of Postnatal Age 3.6 Abnormal Development 3.6.1 Malformations Resulting from Abnormalities in Growth and Migration with Incomplete Development of the Brain 3.6.2 Genetically Linked Migration Disorders 3.6.3 Environmentally Induced Migration Disorder: Fetal Alcohol Syndrome 3.6.4 Malformations Resulting from Chromosomal Trisomy and Translocation 3.6.5 Malformations Resulting from Defective Fusion of Dorsal Structures 3.6.6 Malformations Characterized by Excessive Growth of Ectodermal and Mesodermal Tissue Affecting the Skin, Nervous System, and Other Tissues 3.6.7 Cutaneous Angiomatosis with Associated Malformations of the Central Nervous System 3.6.8 Malformations Resulting from Abnormalities in the Ventricular System Bibliography 4 Spinal Cord 4.1 Gross Anatomy 4.1.1 Spinal Cord: Structure and Function 4.1.2 Nerve Roots 4.1.3 Gray Matter 4.2 Interneurons 4.3 Central Pattern Generators 4.4 Segmental Function 4.4.1 Motor/Ventral Horn Cells 4.4.2 Sensory Receptors 4.4.3 Stretch Receptors 4.5 Nociception and Pain 4.5.1 Modulation of Pain Transmission 4.6 White Matter Tracts 4.6.1 Descending Tracts in the Spinal Cord 4.6.2 Ascending Tracts in the Spinal Cord 4.6.3 The Anterolateral Pathway 4.7 Upper and Lower Motor Neurons Lesions 4.7.1 Upper Motor Neuron Lesion (UMN) 4.7.2 Lower Motor Neuron Lesion 4.8 Illustrative Spinal Cord Case Histories 4.9 Illustrative Non-spinal Cord Cases with Involvement of Specific Peripheral Nerves: Case Histories 4.8–4.10 4.10 Carpal Tunnel Syndrome Bibliography 5 Brain Stem: Gross Anatomy 5.1 Gross Anatomical Divisions 5.1.1 Sites of Transition 5.2 Relationship of Regions in the Brain to the Ventricular System: Fig. 5.2 5.3 Gross Anatomy of Brain Stem and Diencephalon 5.3.1 Anterior Surface of Gross Brain Stem: Fig. 5.3 5.3.2 Posterior Surface of Brain Stem and Diencephalon: Fig. 5.4 5.4 Arterial Blood Supply to the Brain Stem and Diencephalon (Fig. 5.5) 5.4.1 Medulla 5.4.2 Pons 5.4.3 Midbrain 5.4.4 Diencephalon Bibliography 6 Brain Stem Functional Localization 6.1 Introduction to the Brain Stem 6.2 Differences Between the Spinal Cord and Brain Stem 6.3 Functional Localization in Brain Stem Coronal Sections and an Atlas of the Brain Stem 6.3.1 Medulla 6.3.2 Pons-Blood Supply: Basilar Artery and Its Branches 6.3.3 Midbrain Blood Supply: Basila Arrteraynd Posterio Crerebral Arteries 6.4 Midbrain Tectum 6.5 Midbrain Tegmentum 6.6 Superior Colliculus 6.6.1 Midbrain Tegmentum 6.6.2 Blood Supply: Posterior Cerebral Arteries 6.7 Superior Colliculus Tectum 6.8 Superior Colliculus Tegmentum 6.8.1 Superior ColliculusVentricular Zone 6.9 Functional Centers in the Brain Stem 6.9.1 Reticular Formation 6.9.2 Respiration Centers 6.9.3 Cardiovascular Centers 6.9.4 Deglutition 6.9.5 Vomiting 6.9.6 Emetic Center 6.9.7 Coughing 6.9.8 Taste 6.10 Localiozation of Dysfunction in the Cranial Nerves Associated with the Eye (Table 6.8) 6.11 Localization of Disease Processes in the Brain Stem 6.11.1 Exercise to Identify the Tracts and Nuclei in the Brain Stem (Figs. 6.10–6.14) Bibliography 7 The Cranial Nerves 7.1 How the Cranial Nerves Got Their Numbers 7.2 Functional Organization of Cranial Nerves 7.3 The Individual Cranial Nerves 7.3.1 Cranial Nerve I, Olfactory (Fig. 7.4), Special Sensory/Special Visceral Afferent 7.3.2 Cranial Nerve II, Optic (Fig. 7.5), Special Somatic Sensory 7.3.3 Cranial Nerve III, Oculomotor (Fig. 7.6), Pure Motor (Somatic and Parasympathetic, Only III) 7.3.4 Cranial Nerve IV, Trochlear (Fig. 7.6), Pure Motor 7.3.5 Cranial Nerve VI, Abducens (Fig. 7.6), Pure Motor 7.3.6 Cranial Nerve V, Trigeminal (Fig. 7.7), Mixed Nerve (Sensory and Motor but No Parasympathetic) 7.3.7 Cranial Nerve VII, Facial (Fig. 7.8), Mixed Nerve (Sensory, Motor, Parasympathetic) 7.3.8 Cranial Nerve VIII, Vestibulocochlear (Fig. 7.9), Pure Special Somatic Sensory 7.4 Auditory Pathway 7.4.1 Cranial Nerve IX, Glossopharyngeal (Fig. 7.13), Mixed (Sensory, Motor, Parasympathetic): Nerve to Third Pharyngeal Arch 7.4.2 Cranial Nerve X, Vagus (Fig. 7.14), Mixed (Sensory, Motor, Parasympathetic), and Longest Cranial Nerve 7.4.3 Cranial Nerve XI, Spinal Accessory (Fig. 7.15), Pure Motor: Somatic and Visceral 7.4.4 Cranial Nerve XII, Hypoglossal (Fig. 7.16): Pure Motor Nerve 7.5 Cranial Nerve Dysfunction 7.6 Cranial Nerve Case Histories Bibliography 8 Diencephalon 8.1 Overview 8.2 Functional Organization of Thalamic Nuclei (Table 8.1) 8.2.1 Sensory and Motor Relay Nuclei: The Ventrobasal Complex and Lateral Nucleus 8.2.2 Limbic Nuclei: The Anterior, Medial, Lateral Dorsal, Midline, and Intralaminar Nuclei (Fig. 8.4) 8.2.3 Specific Associational: Polymodal/Somatic Nuclei, the Pulvinar Nuclei (Fig. 8.5) 8.2.4 Special Somatic Sensory Nuclei: Vision and Audition, the Lateral Geniculate and Medial Geniculate Nuclei of the Metathalamus (Fig. 8.5): The Special Somatic Sensory Cranial Nerves Are Cranial Nerves II and VIII 8.2.5 Nonspecific Associational 8.3 White Matter of the Diencephalon 8.4 Relationship Between the Thalamus and the Cerebral Cortex (Figs. 8.7 and 8.8) 8.5 Subthalamus (Fig. 8.3) 8.6 Thalamic Atlas Figs. 8.10, 8.11, and 8.12 8.7 Level: Midbrain, Diencephalic Junction (Fig. 8.10) 8.8 Level: Midthalamus (Fig. 8.11) 8.9 Level: Anterior Tubercle of Thalamus (Fig. 8.12) Bibliography 9 Hypothalamus, Neuroendocrine System, and Autonomic Nervous System 9.1 Hypothalamus 9.1.1 Hypothalamic Nuclei 9.1.2 Afferent Pathways 9.1.3 Efferent Pathways (Fig. 9.6) 9.1.4 Functional Stability 9.2 Neuroendocrine System, the Hypothalamus, and Its Relation to the Hypophysis 9.2.1 Hypophysis Cerebri 9.2.2 Hypothalamic–Hypophyseal Portal System 9.2.3 Hypophysiotrophic Area 9.2.4 Hormones Produced by Hypothalamus 9.2.5 Hormones Produced in Adenohypophysis (Fig. 9.12) 9.2.6 Case 9.1 9.2.7 Hypothalamus and the Autono