ALBERT

Note: Classical theory of comparative advantageComparative advantage with two factors of production -- Comparative advantage and factor endowments : the Heckscher-Ohlin theorem -- Imperfect competition and economies of scale in trade -- The partial equilibrium analysis of international trade -- Trade restrictions : tariffs -- Non-tariff trade barriers -- Domestic support policies and trade -- Multilateral trade negotiations and U.S. trade policy -- Economic integration -- Foreign exchange markets and the exchange rate -- Agricultural trade and the exchange rate -- International capital movements and multinational corporations -- Agricultural trade and economic development -- Trade and the environment..

Note: Cover; Title Page; Copyright Page; Dedication Page; Table of Contents; Acknowledgments; Part One: Prehistory; 1. Introduction; 2. Sex and Salesmanship; 3. Seduction and the Emotions; 4. Social Primates; Part Two: Today; 5. Testing for Talent; 6. What Do Women Want?; 7. Coalitions of the Willing; 8. The Scarcity of Charm; 9. The Tender War; Notes; References; Index.

Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; Introduction: We Become What We Measure; Casting a Spell; Exploring a Path; 1. More, Better, Faster: The Beginnings ; Productivity, Growth, and Success; Goals and Measures; Values and Measures; 2. The Origins of Bling: The Spirit of Economic Growth ; The World of Growth: Refining the Measure; Business Accounting Goes National; 3. The Crucible of Crisis: The Great Depression and the Need for Economic Indicators ; 4. Born from Disaster: The Making of a Key Measure ; The Challenge; The Players; The Method; The Findings. , The Big Conundrum: Translating Findings into Action5. Forged in War; 6. Global Domination: The Age of GDP ; For Richer or Poorer; A Stunted Priesthood; Stopgap Consensus; Going Global; New Rules; GDP Junkies; Shackled in Fool's Gold; 7. Today's ABC of GDP ; It's an Emperor, but Does It Have Clothes?; Why It Matters; 8. More Is Not Enough ; The Little Big Number: Our Report Card for Success; Emerging Dissent; 9. "The People of Plenty Are a People of Waste"; Breaking the Spell; 10. From Alchemy to Reason: What If? A Thought Experiment; Mental Cobwebs; One More Time: Simon Kuznets. , Clearing a Path11. Looking Forward; A Daring Vision; A Moment of Possibility; Appendix A. The Measure as Guide; Notes; Bibliography; Index.

Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; PART I. THE COMPLEXITY FRAME FOR POLICY; Chapter 1. Twin Peaks; Chapter 2. Government With, Not Versus, the Market; Chapter 3. I Pencil Revisited: Beyond Market Fundamentalism; Chapter 4. The Complexity Policy Frame; PART II. EXPLORING THE FOUNDATIONS; Chapter 5. How Economics Lost the Complexity Vision; Chapter 6. How Macroeconomics Lost the Complexity Vision; Chapter 7. Complexity: A New Kind of Science?; Chapter 8: A New Kind of Complexity Economics?; Chapter 9. Nudging toward a Complexity Policy Frame. , PART III. LAISSEZ-FAIRE ACTIVISM IN PRACTICEChapter 10. The Economics of Influence; Chapter 11. Implementing Influence Policy; Chapter 12. Laissez-Faire Activism; Chapter 13. Getting the Ecostructure of Government Right; PART IV. THE LOST AGENDA; Chapter 14. Getting the Ecostructure of Social Science Education Right; Chapter 15. The Lost Agenda; Notes; Bibliography; Index.

Note: Master and use copy. Digital master created according to Benchmark for Faithful Digital Reproductions of Monographs and Serials, Version 1. Digital Library Federation, December 2002

Note: Cover; Half Title; Title Page; Copyright Page; Dedication; Table of Contents; List of illustrations; Acknowledgements; Acronyms and abbreviations; 1 Introduction and overview: The world food price spikes; 2 Global governance: A framework for analysis; 3 The evolution of global food security policy; 4 The reform of the Committee on World Food Security; 5 Participation in global governance: Coordinating "the voices of those most affected by food insecurity"; 6 Multilateral power dynamics: Comparing outcomes of policy roundtables. , 7 Best practice: The Voluntary Guidelines on the Responsible Governance of Tenure8 Policy coordination at the global level: The Global Strategic Framework; 9 Conclusion: Reflections on civil society engagement in global food security governance; Index.

Note: Problemanalyse und ÜberblickNeue Institutionen: Zukunftsräte -- Neue Institutionen: Ombudspersonen -- Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten -- Ombudspersonen in Unternehmen?..

Note: section A. Language, ideology and powersection B. Discourse and sociocultural change -- section C. Dialectics of discourse: theoretical developments -- section D. Methodology in CDA research -- section E. Political discourse -- F. Globalisation and 'transition' -- section G. Language and education..

Note: 1. Eine kurze Geschichte der Wissenschaftskommunikation 3 Schlüsselideen -- 2. Wissenschaft und Gesellschaft: Vom Elfenbeinturm auf den Marktplatz -- 3. Technik und Gesellschaft -- 4. Öffentlichkeit: Wen erreicht Wissenschaftskommunikation? -- 5. Dimensionen der Verständlichkeit -- 6. Erklärungen: Gute Bekannte oder falsche Freunde? -- 7. Bildung: Wer sollte was über Wissenschaft wissen? -- 8. Kontroversen: Ein Schlüssel zur Wissenschaftskommunikation -- 9. isiko: Zwischen Wahrnehmung und Konstrukt -- 10. Vertrauen: Eine Art der Komplexitätsreduktion -- 11 Einstellungen und Rezeption -- 12. Akzeptanz: Ziel oder Unwort? -- Akteure und Ansätze -- 13. Wissenschaftler als Kommunikatoren -- 14. Schule und andere Lernorte -- 15. Experimente: Jeder ist ein Forscher -- 16. Gläserne Wissenschaft -- 17. Journalisten und Medien -- 18. Wissenschaftskommunikation in sozialen Netzwerken -- 19. Wissenschaftskommunikation als Marketing -- 20. Wissenschaft berät Politik und Gesellschaft -- 21. Dialog: Austausch auf Augenhöhe und in beide Richtungen -- Fallbeispiele -- 22. Evolutionstheorie: Wissen, Glauben, Kontroverse -- 23. Chemie: Vom Umweltproblem zum Problemlöser? -- 24. Nanotechnologie: Visionen, Definitionen, Kontroversen -- 25. Kernenergie: Von der Hochglanzbroschüre zum Vertrauensverlust -- 26. Gentechnik: Verhärtete Fronten oder kommunikativer Neubeginn?- Epilog -- 27. Aktuelle Herausforderungen und Ziele..

Note: Front Cover; SEAWATER: ITS COMPOSITION, PROPERTIES AND BEHAVIOUR; Copyright Page; CONTENTS; ABOUT THIS VOLUME; ABOUT THIS SERIES; CHAPTER 1. WATER , AIR AND ICE; 1.1 THE SPECIAL PROPERTIES OF WATER; 1.2 THE HYDROLOGICAL CYCLE; 1.3 SUMMARY OF CHAPTER 1; CHAPTER 2. TEMPERATURE IN THE OCEANS; 2.1 SOLAR RADIATION; 2.2 DISTRIBUTION OF SURFACE TEMPERATURES; 2.3 DISTRIBUTION OF TEMPERATURE WITH DEPTH; 2.4 ENERGY FROM THE THERMOCLINE - A BRIEF DIGRESSION; 2.5 TEMPERATURE DISTRIBUTION AND WATER MOVEMENT; 2.6 SUMMARY OF CHAPTER 2; CHAPTER 3. SALINITY IN THE OCEANS; 3.1 CONSTANCY OF COMPOSITION. , 3.2 VARIATIONS IN SALINITY3.3 THE MEASUREMENT OF SALINITY; 3.4 SUMMARY OF CHAPTER 3; CHAPTER 4. DENSITY AND PRESSURE IN THE OCEAN; 4.1 WATER MASSES; 4.2 DEPTH (PRESSURE), DENSITY AND TEMPERATURE; 4.3 T-S DIAGRAMS; 4.4 MIXING PROCESSES IN THE OCEANS; 4.5 SUMMARY OF CHAPTER4; CHAPTER 5. LIGHT AND SOUND IN SEAWATER; 5.1 UNDERWATER LIGHT; 5.2 UNDERWATER SOUND; 5.3 SUMMARY OF CHAPTER 5; CHAPTER 6. THE SEAWATER SOLUTION; 6.1 THE GROSS CHEMICAL COMPOSITION OF SEAWATER; 6.2 SOURCES AND SINKS, OR WHY THE SEA IS SALT; 6.3 CHEMICAL AND BIOLOGICAL REACTIONS IN SEAWATER; 6.4 SUMMARY OF CHAPTER 6. , CHAPTER 7. SEAWATER AND THE GLOBAL CYCLE7.1 A SHORT HISTORY OF SEAWATER; 7.2 A LOOK AHEAD; 7.3 SUMMARY OF CHAPTER; APPENDIX: CONVERSIONS BETWEEN pH AND [H+]; SUGGESTED AND COMMENTS READING; ANSWERS AND COMMENTS TO QUESTIONS; ACKNOWLEDGEMENTS; INDEX.

Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..

Note: IntroductionScience in Society -- Knowing and Acting -- Trans-disciplinary Deliberation -- Conclusions/Recommandations..

Note: Nonlinear Mesoscopic Elasticity; Contents; Preface; Acknowledgements; 1 Introduction; 1.1 Systems; 1.2 Examples of Phenomena; 1.3 The Domain of Exploration; 1.4 Outline; References; 2 Microscopic/Macroscopic Formulation of the Traditional Theory of Linear and Nonlinear Elasticity; 2.1 Prefatory Remarks; 2.2 From Microscopic to Continuum; 2.2.1 A Microscopic Description; 2.2.2 Microscopic Description and Thermodynamics; 2.2.3 From Microscopic Model to Continuum Elasticity; 2.3 Continuum Elasticity and Macroscopic Phenomenology; 2.3.1 Displacement, Strain, and Stress. , 2.3.2 Dynamics of the Displacement Field2.3.3 Coupling Continuum Elasticity to Auxiliary Fields; 2.3.4 Inhomogeneous Elastic Systems; 2.4 Thermodynamics; 2.4.1 Thermodynamic Derivatives; 2.4.2 Series Expansion for ES; 2.4.3 Series Expansion for EZ; 2.4.4 Series Expansion for FT; 2.4.5 Assemble the Pieces; 2.5 Energy Scales; References; 3 Traditional Theory of Nonlinear Elasticity, Results; 3.1 Quasistatic Response; Linear and Nonlinear; 3.1.1 Quasistatic Response; Linear; 3.1.2 Quasistatic Response; Nonlinear; 3.2 Dynamic Response; Linear; 3.3 Quasistatic/Dynamic Response; Nonlinear. , 3.4 Dynamic Response Nonlinear; 3.4.1 Basic Equations; 3.4.2 Wave Propagation; 3.4.3 Resonant Bar; 3.5 Exotic Response; Nonlinear; 3.6 Green Functions; 3.6.1 Green Function, Free Space; 3.6.2 Green Function, Resonant Bar; References; 4 Mesoscopic Elastic Elements and Macroscopic Equations of State; 4.1 Background; 4.2 Elastic Elements; 4.2.1 Hertz-Mindlin Contacts; 4.2.2 Hysteretic Hertzian Contacts; 4.2.3 Hertzian Asperities; 4.2.4 Van der Waals Surfaces; 4.2.5 Other; 4.3 Effective Medium Theory; 4.4 Equations of State; Examples; 4.4.1 Hertzian Contacts; 4.4.2 Van der Waals Surfaces. , 4.4.3 Generalization and CaveatsReferences; 5 Auxiliary Fields; 5.1 Temperature; 5.2 Saturation; 5.2.1 Saturation/Strain Coupling; 5.2.2 Saturation/Strain Response; 5.3 The Conditioning Field, X; References; 6 Hysteretic Elastic Elements; 6.1 Finite Displacement Elastic Elements; Quasistatic Response; 6.1.1 Finite Displacement Elastic Elements: The Model; 6.1.2 Finite Displacement Elastic Element: Implementing the Model; 6.2 Finite Displacement Elastic Elements: Inversion; 6.3 Finite Displacement Elastic Elements: Dynamic Response; 6.3.1 Finite Displacement Elastic Element: Resonant Bar. , 6.3.2 Finite Displacement Elastic Element: Wave Mixing6.4 Models with Hysteresis; 6.5 Summary; 6.6 Models with Hysteresis, Detail; 6.6.1 Hertzian Contacts; 6.6.2 The Masing Rules; 6.6.3 The Endochronic Formalism; References; 7 The Dynamics of Elastic Systems; Fast and Slow; 7.1 Fast/Slow Linear Dynamics; 7.1.1 Quasistatic Response; 7.1.2 AC Response; 7.2 Fast Nonlinear Dynamics; 7.3 Auxiliary Fields and Slow Dynamics; 7.3.1 X = The Conditioning Field; 7.3.2 X = Temperature; 7.4 Summary; References; 8 Q and Issues of Data Modeling/Analysis; 8.1 Attenuation in Linear Elastic Systems. , 8.1.1 Wave Vector Dispersion.

Note: Front Cover; Dedication; Contents; Preface to the First Edition; Preface to the Second Edition; CHAPTER 1 - Introduction; CHAPTER 2 - Data Foundations; CHAPTER 3 - Human Perception and Information Processing; CHAPTER 4 - Visualization Foundations; CHAPTER 5 - Visualization Techniques for Spatial Data; CHAPTER 6 - Visualization Techniques for Geospatial Data; CHAPTER 7 - Visualization Techniques for Time-Oriented Data; CHAPTER 8 - Visualization Techniques for Multivariate Data; CHAPTER 9 - Visualization Techniques for Trees, Graphs, and Networks; CHAPTER 10 - Text and Document Visualization. , CHAPTER 11 - Interaction ConceptsCHAPTER 12 - Interaction Techniques; CHAPTER 13 - Designing Effective Visualizations; CHAPTER 14 - Comparing and Evaluating Visualization Techniques; CHAPTER 15 - Visualization Systems; CHAPTER 16 - Research Directions in Visualization; APPENDIX A - History of Computer Graphics and Visualization; APPENDIX B - Example Data Sets; APPENDIX C - Sample Programs; Bibliography; Back Cover.

Note: Inhalt; Über dieses Buch; Teil I Einführungen: Theorien der Erzählungen; Erzählen. Die ethisch-politische Funktion narrativer Diskurse; 1 Narrative Diskurse: Eigenschaften und Funktionen; 1.1 Die narrative Kunst der Begründung; 1.2 Ein semantisches Modell der Erzählung: Algirdas J. Greimas' Aktantentheorie; 1.3 Narrative Begründungen: Eine semantische Typologie; 1.4 Die Schuld und die Vergebung: Zum Verantwortungsmanagement narrativer Diskurse; 1.5 In medias res: Warum Erzählungen oft mit dem Ende beginnen; 1.6 Die doppelte Referenz: Das Allgemeine und das Einzigartige. , 2 Die Erzähler und ihr Publikum: Zur Öffentlichkeit narrativer Diskurse2.1 Öffentliche Urteile: Die Erzähler und ihr Publikum; 2.2 Die zwei Stimmen des Erzählers; 2.3 Die Präsenz des Erzählers in der Erzählung; 2.4 Die Öffentlichkeiten des Erzählers; 2.5 Autobiografisches Erzählen: Der innere Dialog und das Denken; 2.6 Ausblick: Die Öffentlichkeitsregime narrativer Diskurse; Literatur; »Menschen lesbarer machen«1: Narration, Diskurs,Referenz; 1 Narrationen als sozialwissenschaftliches Konzept; 1.1 Erzählungen zwischen Text und Handlung; 1.2 Typen der Erzählung. , 1.3 Zur lebensweltlichen Einbettung von Narrativen2 Zum Verhältnis von Narration und Diskurs; 2.1 Brauchen Diskurse Erzählungen?; 2.2 Narrationen als Sprech-Handlungen (über Satzniveau); 3 Erzählungen: Strukturen, Ereignisse und dieKomposition der Fabel; 3.1 Narration und Fabelkomposition; 3.2 Ebenen der Erzählung; 3.3 Kollektiv-Symbole und ihre Erzählungen; 3.4 Narrative und ihre Bedeutung für die kulturelle Reproduktion und Innovation; 4 Referenz und Erzählung: Jenseits der Innenwelt von Texten; 4.1 Öffentliche Erzählungen als Mimesis von Handlungen?. , 5 ConclusioLiteratur; Öffentliche Erzählungen und der globale Wandel des Klimas; 1 Einleitung; 2 Der Mensch als Klimageschichtenerzähler; 2.1 Was heißt Narrativisierung des Klimas?; 2.2 Narrationen als Geburtshelfer möglicher Welten; 2.3 Klimageschichten sind lebende Geschichten; 3 Globaler Klimawandel: Geburt eines Konzepts; 4 Sechs Varianten der Narrativisierung des globalenKlimawandels; 4.1 Das »globale Treibhaus« als anthropogene Katastrophe; 4.2 Anthropogene Eiszeiten: die Katastrophe des; 4.3 Die Geschichte vom »nuklearen Winter«; 4.4 »Paradiesische Warmzeiten«. , 4.5 Die ewige Wiederkehr der »Sonnenflecken«: Normalität statt Katastrophe. , 4.2 Die Konfiguration von Charakteren in öffentlichen Erzählungen4.3 Re-figuration und die Rolle des Lesers; Teil II Erzählungen in den Medien; Kollektivsymbolik und die deutsche Krise seit dem Jahr 2000; Heimat, Natur und die gute alte Zeit. Erzählungenüber Nachhaltige Entwicklung im Spannungsfeldöffentlicher und wissenschaftlicher Diskurse1; 1 Einleitung; 2 Wissenschaftliche Diskurse über Nachhaltige Entwicklung; 3 Nachhaltige Ernährung und Ernährungskommunikation; 4 Erzählungen über Ernährung in den Medien; 4.1 Polarisierende Rhetorik; 4.2 Affirmative Rhetorik; 4.3 Reflektierende Rhetorik.

Note: Front cover; Title page; Copyright page; Contents; Dedication; Friends of the Earth: rethinking travel; Foreword; Preface; Introduction; PART 1: THINKING BEYOND FLYING; Chapter 1: To fly or not to fly?; Chapter 2: Deciding never to fly again; Chapter 3: Young people and climate change; Chapter 4: Waking up to the downsides of flying; Chapter 5: Slow and low - the way to go: a systems view of travel emissions; PART 2: BUSINESS BEYOND FLYING; Chapter 6: A green travel experiment; Chapter 7: Trains versus planes: building a low-carbon travel agency. , Chapter 8: Going cold turkey: a law practice without any flightsChapter 9: The no-flying conference: Signs of Change; Chapter 10: Slowlier than thou: why flight-free travel is about better, not less; PART 3: SAVOURING THE JOURNEY; Chapter 11: The human engine: bicycling to Beijing; Chapter 12: Walking distance; Chapter 13: bike2oz: the world going through you instead of around you; Chapter 14: A small matter of distance: trying not to fly to climate talks; Chapter 15: Travel on a hot planet: exploring the global tourist industry overland; How to fly less; Index; Other Green Books titles. , About Green Books.

Note: Foreword; Acknowledgements; Table of contents; Reader's guide; Definition of OECD indicators of agricultural support; Nominal indicators used in this report; Ratio indicators and percentage indicators; Box 1. Definitions of categories in the PSE classification; Decomposition indicators; Definition of GSSE categories; Sources and definitions of contextual indicators; Table X.1. Contextual indicators; Box 2. Definitions of categories in the GSSE classification; Figure X.2. Main macroeconomic indicators; Figure X.3. Agro-food trade; OECD indicators of support; Currencies. , List of acronyms and abbreviationsExecutive summary; Recommendations; Chapter 1. Developments in agricultural policy and support; Key economic and market developments; Table 1.1. Key economic indicators; Figure 1.1. Commodity world price indices, 2007 to 2014; Main features of agricultural policies; Box 1.1. Agriculture and COP21; Box 1.2. Developments post the 2013 Bali WTO Ministerial; Developments in agricultural support; Countries' importance in global agriculture has changed since the mid-1990s - and so has their role in supporting agriculture. , Figure 1.2. Country shares in total agricultural GDP and in total TSE, 1995-97 and 2012-14Total monetary transfers to the agricultural sector were stable in some countries, but increased significantly in others; Figure 1.3. Evolution of Total Support Estimate, 1995-97 to 2012-14; However the relative cost of agricultural support for the economies has decreased significantly over time in most of the countries; Figure 1.4. Total Support Estimate by country, 1995-97 and 2012-14. , The total agricultural support is dominated by support to agricultural producers, while expenditures on key general services to the sector are relatively smallFigure 1.5. Composition of Total Support Estimate by country, 2012-14; Average support to agricultural producers in OECD countries and emerging economies is converging; Figure 1.6. Evolution of Producer Support Estimate, 1995 to 2014; However short- and long-term changes across individual countries remain very uneven; Figure 1.7. Producer Support Estimate by country, 2013 and 2014. , Box 1.3. What drove changes in the monetary value of producer support in 2014?Figure 1.8. Contribution of various factors to the change in the Producer Support Estimate in 2014; Box 1.3. What drove changes in the monetary value of producer support in 2014? (cont.); Figure 1.9. Evolution of producer support at different stages of economic development, 1986 to 2013; Figure 1.10. Producer Support Estimate by country, 1995-97 and 2012-14; Differences in policy approaches are also reflected in policy instruments; Figure 1.11. Composition of Producer Support Estimate by country, 2012-14. , Figure 1.12. Composition of payments based on area, animal numbers, receipts and income by country, 1995-97 and 2012-14.

Note: Stuttgart, Univ., Diss., 2015

Note: Foreword; Prologue; Acknowledgements; Contents; Chapter 1: Early Earth Systems; 1.1 Archaean and Proterozoic Atmospheres; 1.2 Early Biospheres; 1.3 Greenhouse States and Glaciations; Chapter 2: Phanerozoic Life and Mass Extinctions of Species; 2.1 Acraman Impact and Acritarchs Radiation; 2.2 Cambrian and Late Ordovician Mass Extinction; 2.3 Late and End-Devonian Mass Extinctions; 2.4 Late Permian and Permian-Triassic Mass Extinctions; 2.5 End-Triassic Mass Extinction; 2.6 Jurassic-Cretaceous Extinction; 2.7 K-T (Cretaceous-Tertiary Boundary) Mass Extinction; 2.8 Paleocene-Eocene Extinction. , 2.9 The End-Eocene FreezeChapter 3: Cenozoic Biological Evolution (by Colin Groves); 3.1 The Evolution of Mammals; 3.2 From Primates to Humans; 3.3 From Genetic Evolution to Cultural Evolution; Chapter 4: Fire and the Biosphere; 4.1 An Incendiary Biosphere; 4.2 The Deep-Time History of Fire; 4.3 Fire and Pre-historic Human Evolution; 4.4 Neolithic Burning and Early Civilizations; Chapter 5: The Anthropocene; 5.1 The Modern Atmosphere; 5.2 Neolithic Burning and Early Global Warming; 5.3 The Great Carbon Oxidation Event; 5.4 The Sixth Mass Extinction of Species; 5.5 The Faustian Bargain. , 5.6 The Post-anthropocene WorldChapter 6: Rare Earth; Chapter 7: Prometheus: An Epilogue; References; About the Book and the Authors; Index.

Note: Cover; Title; Copyright; Contents; The Main Themes in Three Simple Tables; Preface; Who Should Read the Book?; Acknowledgments; About the Author; Introduction; i. Efficiently Inefficient Markets; ii. Global Trading Strategies: Overview of the Book; iii. Investment Styles and Factor Investing; Part I Active Investment; Chapter 1 Understanding Hedge Funds and Other Smart Money; Chapter 2 Evaluating Trading Strategies: Performance Measures; Chapter 3 Finding and Backtesting Strategies: Profiting in Efficiently Inefficient Markets; Chapter 4 Portfolio Construction and Risk Management. , Chapter 5 Trading and Financing a Strategy: Market andPart II Equity Strategies; Chapter 6 Introduction to Equity Valuation and Investing; Chapter 7 Discretionary Equity Investing; Interview with Lee S. Ainslie III of Maverick Capital; Chapter 8 Dedicated Short Bias; Interview with James Chanos of Kynikos Associates; Chapter 9 Quantitative Equity Investing; Interview with Cliff Asness of AQR Capital Management; Part III Asset Allocation and Macro Strategies; Chapter 10 Introduction to Asset Allocation: The Returns to the Major Asset Classes; Chapter 11 Global Macro Investing. , Interview with George Soros of Soros Fund ManagementChapter 12 Managed Futures: Trend-Following Investing; Interview with David Harding of Winton Capital Management; Part IV Arbitrage Strategies; Chapter 13 Introduction to Arbitrage Pricing and Trading; Chapter 14 Fixed-Income Arbitrage; Interview with Nobel Laureate Myron Scholes; Chapter 15 Convertible Bond Arbitrage; Interview with Ken Griffin of Citadel; Chapter 16 Event-Driven Investments; Interview with John A. Paulson of Paulson & Co.; References; Index.

Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.

Note: Methodology of Lithium Analytical Chemistry and Isotopic MeasurementsCosmochemistry of Lithium -- Li Partitioning, Diffusion and Associated Isotopic Fractionation: Theoretical and Experimental Insights -- Lithium in the Deep Earth: Mantle and Crustal Systems -- The Surficial Realm: Low Temperature Geochemistry of Lithium..

Note: ""Cover""; ""Copyright""; ""Contents""; ""Preface""; ""Conventions""; ""Abbreviations""; ""1. Introduction""; ""PART I The Early Years""; ""2. Early attempts at monetary union and the Hague Summit""; ""3. The Werner Report and the collapse of Bretton Woods""; ""4. The 'snake in the tunnel' reappears""; ""5. Monetarism arrives amidst currency turmoil""; ""6. The Delors Report""; ""7. Onward to Maastricht""; ""8. The Maastricht Treaty""; ""9. Converging to crisis and austerity""; ""10. The ideological straitjacket""; ""11. The Stability and Growth Pact (SGP)"". , ""12. The convergence farce: smokescreens and denial""""PART II The Path to Crisis""; ""13. The first few years: smug self-congratulation and mass delusion""; ""14. The 2003 fiscal crisis""; ""15. The German 'jobwunder'""; ""16. European Groupthink: denial on a grand scale""; ""PART III The Options for Europe""; ""17. A monetary framework for fiscal policy activism""; ""18. Framing the debate: two alternative visions of the economy""; ""19. The basic principles of functional finance""; ""20. The federal solution""; ""21. Overt Monetary Financing""; ""22. Abandoning the euro"". , ""23. Employment guarantees""""References""; ""Index"".

Note: CONTENTS; List of Figures; List of Tables; List of Contributors; Introduction; PART I: ECONOMISTS ON TRIAL; 1. Who predicted the crisis and what can we learn from them? ; 2 A brief note on economic recessions, banking reform and the future of capitalism; 3 Understanding crisis: on the meaning of uncertainty and probability; 4 Financial crisis and risk measurement: the historical perspective and a new methodology; 5 Did economic analysis fail in the current financial crisis?; PART II: WHAT DOES HISTORY TELL US? ; 6 Does the current global crisis remind us of the Great Depression?. , 7 Innovation, growth, cycles and finance: three (or four or more) stories from the 1930s and their lessons8 Epic Recession and economic theory; 9 Did asset prices cause the current crisis?; 10 The role of the history of economic thought in the development of economic theory and policy; PART III: COUNTRY CASES IN A GLOBAL CRISIS; 11. Testimony to the Financial Crisis Inquiry Commission by Alan Greenspan; 12 Long-term depression and new markets: economists and the 2008 recession; 13 Manifestations of the global crisis in a small open economy. , 14 The aftermath of a long decade of real nil interest rates (Spain 1996-2008)Index.

Note: List of Figures; Acknowledgements; Prologue; Chapter One Introduction; Chapter Two The Future Told; Chapter Three The Future Tamed; Chapter Four Futures Traded; Chapter Five Futures Transformed; Chapter Six Futures Traversed; Chapter Seven Futures Thought; Chapter Eight Futures Tended; Chapter Nine Futures Transcended; Epilogue; Glossary of Key Terms; Bibliography; Name Index; Subject Index.

Note: Ecotones Between Forest and Grassland; Preface; Contents; Contributors; Chapter 1: Introduction; 1.1 Rationale; 1.2 Case Study: The Cross Timbers; 1.3 About This Book; References; Part I: Temperate Forest-Grassland Ecotones: Prairies, Steppes, and Pampas; Chapter 2: Woodland-Grassland Ecotonal Shifts in Environmental Mosaics: Lessons Learnt from the Environmental History of the Carpathian Basin (Central Europe) During the Holocene and the Last Ice Age Based on Investigation of Paleobotanical and Mollusk Remains; 2.1 Introduction. , 2.2 Modern Woodland-Grassland Ecotone in the Carpathian Basin and Controversies Around Definitions2.3 Profiles Selected and Methods Applied in Modeling Woodland-Grassland Ecotone Shifts in the Carpathian Basin; 2.3.1 The Climate-Zonal Hypothesis Put to the Test; 2.3.2 Testing the Model of Edaphic Ecological Factors; 2.3.3 Testing the Idea of Human-Induced Ecotone Development; 2.4 The Vegetation History of the Great Hungarian Plains as Inferred from the Evaluation of Quaternary Paleoecological and Environmental Historical Data; 2.4.1 Vegetation Development During Last Ice Age. , 2.4.2 Vegetation Development During the Terminal Part of the Last Ice Age2.4.3 Vegetation Development During the Pleistocene/Holocene Transition; 2.4.4 Vegetation History of the Carpathian Basin from the Settlement of the First Farmers; 2.5 Summary; References; Chapter 3: Ecotones as Complex Arenas of Disturbance, Climate, and Human Impacts: The Trans-Andean Forest-Steppe Ecotone of Northern Patagonia; 3.1 Introduction; 3.2 Physical and Biological Setting of Forest-Steppe Ecotone of Northern Patagonia; 3.2.1 Abiotic Transition; 3.2.2 Ecosystem Properties Across the Transition. , 3.2.3 Plant Communities and Plant Diversity Across the Transition3.3 Disturbance Variation and Forest Dynamics Across the Transition; 3.3.1 Fine-Scale Disturbances; 3.3.2 Coarse-Scale Disturbances; 3.4 Direct and Disturbances-Mediated In fl uences of Climate Variability Across the Transition; 3.5 Climate, Fire, Land Use, and Long-Term Vegetation Changes Across the Transition; 3.5.1 Xeric Steppe-Woodland Belt; 3.5.2 The Nothofagus Forest-Shrubland Belt; 3.5.3 The Wet Rainforest Belt; 3.6 Conclusions; References; Chapter 4: Woody-Herbaceous-Livestock Species Interaction; 4.1 Introduction. , 4.2 Woody-Herbaceous Species Interactions and Associated Models4.3 Woodland and Grassland Stable States and Conceptual Models; 4.4 Woody-Herbaceous Ecotones; 4.5 Rates and Patterns of Woody-Herbaceous Ecotone Shift; 4.6 Woody-Herbaceous-Livestock Species Dynamics; 4.7 Other Potential Factors In fl uencing Woody-Herbaceous Species Dynamics; 4.8 Current and Future Research on Woody-Herbaceous-Livestock Species Interaction; References; Chapter 5: Woody Plant Invasions in Pampa Grasslands: A Biogeographical and Community Assembly Perspective; 5.1 Introduction. , 5.2 Woody Invasions as Hierarchical Assembly Processes.

Note: Vorwort zur zweiten Auflage; Vorwort; Inhalt; Abkürzungen; Einführung; Teil I; Eine kurze Geschichte der Energiewende; Fukushima und Ausstieg (2011); Fundamente der Energiewende (1980 - 1998); EnWG und EEG (1998 - 2003); Emissionshandel und Energiepreise (2003 - 2008); Netzregulierung und EEG (2004 - 2008); Krise in Europa (2009 - 2012); Teil II; Die Zukunft der Energiewende; Standortbestimmung (2013); 2050: Energiewende; Fossile Primärenergien; Die Regenerativen; Energiesystem der Zukunft; Politik für die Energiewende; 1 Braunkohle und Erdgas; 2 Auslaufbetrieb der Kernenergie ; 3 Energieeffizienz ; 4 Emissionshandel ; 5 EEG Reform ; 6 Regulierung der Stromnetze ; 7 Strommarktgestaltung ; 8 Koordinierung der Energiewende ; Zusammenfassung.

Note: Berlin, Humboldt-Univ., Diss., 2011

Note: Vorwort1 Einleitung -- 2 Grundlegende Definitionen -- 3 Das offene System Kohlendioxid in Wasser mit Alkalinität -- 4 Das offene System von Kohlendioxid in reinem Wasser als Spezialfall des allgemeinen Falles mit Alkalinität -- Anhang 1-5..

Note: Cover; Contents; Preface and Overview; Acknowledgments; Introduction to the 2014 Edition; 1. The Distinctiveness of Comparative Social Science; 2. Heterogeneity and Causal Complexity; 3. Case-Oriented Comparative Methods; 4. The Variable-Oriented Approach; 5. Combined Versus Synthetic Comparative Strategies; 6. A Boolean Approach to Qualitative Comparison: Basic Concepts; 7. Extensions of Boolean Methods of Qualitative Comparison; 8. Applications of Boolean Methods of Qualitative Comparison; 9. The Dialogue of Ideas and Evidence in Social Research; Bibliography; Index.

Note: Pages 1-6, Introduction, Etsuro Shimokawa --- Pages 7-26, Prediction of debris flow for warning and evacuation, Muneo Hirano --- Pages 27-45, Large and small debris flows—Occurrence and behaviour, Tim R. Davies --- Pages 46-63, Field survey for debris flow in volcanic area, Etsuro Shimokawa, Takashi Jitousono --- Pages 65-69, Introduction, Pierre Julien --- Pages 70-92, A comparison between gravity flows of dry sand and sand-water mixtures, Haruyuki Hashimoto --- Pages 93-116, Review dynamic modeling of debris flows, Chyan-Deng Jan, Hsieh Wen Shen --- Pages 117-143, Dynamics of the inertial and viscous debris flows, Tamotsu Takahashi --- Pages 144-162, Selected notes on debris flow dynamics, P. Y. Julien, J. S. O'Brien --- Pages 163-165, Introduction, Aronne Armanini --- Pages 166-185, Development of new methods for countermeasures against debris flows, Shun Okubo, Hiroshi Ikeya, Yoshiharu Ishikawa, Takashi Yamada --- Pages 186-207, Torrent check dams as a control measure for debris flows, Martin N. R. Jaeggi, Stefano Pellandini --- Pages 208-226, On the dynamic impact of debris flows, Aronne Armanini

Note: IntroductionMain Assumptions of the Assignment Process -- Definition of Collapse -- Proposing a Range for Fatality Rates in a Collapsed Building -- Assignments of judgment-based fatality rates -- Conclusions. ..

Note: Pages 3-6, Introduction, Helmut Wilhelm, Walter Zürn, Hans-Georg Wenzel --- Pages 9-26, Tide-generating potential for the earth, Hans-Georg Wenzel --- Pages 27-57, Tidal response of the solid Earth, Rongjiang Wang --- Pages 59-75, Analysis of earth tide observations, Hans-Georg Wenzel --- Pages 77-94, Earth tide observations and interpretation, Walter Zürn --- Pages 95-109, The nearly-diurnal free wobble-resonance, Walter Zürn --- Pages 113-143, Ocean tides, Wilfried Zahel --- Pages 145-171, Earth tides and ocean tidal loading, Gerhard Jentzsch --- Pages 173-181, Ocean tides and earth rotation, Johannes Wünsch --- Pages 183-218, Chandler wobble and pole tide in relation to interannual atmosphere-ocean dynamics, Hans-Peter Plag --- Pages 221-246, Atmospheric tides, Hans Volland --- Pages 247-260, Long-period variations of solar irradiance, Helmut Wilhelm --- Pages 261-274, Geomagnetic tides and related phenomena, Nils Olsen --- Pages 277-291, Tides in water saturated rock, Hans-Joachim Kümpel --- Pages 293-309, Tidal triggering of earthquakes and volcanic events, Dieter Emter --- Pages 311-339, Tidal tilt modification along an active fault, Malte Westerhaus --- Pages 343-344, Satellite orbit perturbations induced by tidal forces, Peter Schwintzer --- Pages 345-377, Tides of io, Tilman Spohn --- Pages 379-380, Tidal effects in binary star systems, Gerhard Schäfer --- Pages 381-386, Tidal interactions between galaxies, Claus Möllenhoff

Note: Pages 3-34, Physical grounds for acoustic remote sensing of the atmospheric boundary layer, M. A. Kallistratova --- Pages 35-84, An overview of the technological development of atmospheric echosounders (SODARS), John A. Kleppe --- Pages 85-104, Design of a tri-monostatic doppler sodar system, Yoshiki Ito --- Pages 105-116, A modular PC-based multiband sodar system, G. Mastrantonio, S. Argentini --- Pages 117-132, Mini acoustic sounding, a powerful tool for ABL applications: Recent advances, D. N. Asimakopoulos, C. G. Helmis, M. Petrakis --- Pages 133-141, Radio-acoustic temperature profiling in the troposphere, G. Bonino --- Pages 142-176, Radio acoustic sounding system (RASS) for studying the lower atmosphere, S. P. Singal, Malti Goel --- Pages 179-190, Determination of the turbulent structure parameters, Pan Naixian --- Pages 191-201, Turbulence variables derived from sodar data, R. L. Coulter --- Pages 202-235, Development of sodar detection and its application for studies of atmospheric boundary layer in Beijing, China, Mingyu Zhou --- Pages 236-246, Influence of the nocturnal low-level-jet on the vertical and mesoscale structure of the stable boundary layer as revealed from doppler-sodar-observations, Frank Beyrich, Dieter Kalass, Ulrich Weisensee --- Pages 247-274, Dynamics of the continental boundary layer: The CRPE sodar results (1984–1993), Christine Amory-Mazaudier --- Pages 275-292, Sodar investigations of gravity waves by cross spectral analysis, Günther Bull --- Pages 293-306, Sodar monitoring of nocturnal boundary layer during the harmattan in Ile-Ife, Nigeria, J. A. Adedokun --- Pages 307-324, An overview of similarity methods to estimate turbulence quantities from sodar measurements in the convective boundary layer, Dimitrios Melas --- Pages 325-384, Sodar: A tool to characterize hazardous situations in air pollution and communication, S. P. Singal, B. S. Gera, Neeraj Saxena --- Pages 385-394, Application of sodar in urban air-quality monitoring systems, Jacek Walczewski --- Pages 395-405, Operational use of sodar information in nowcasting, Th. Foken, H.-J. Albrecht, K. Sasz, F. Vogt --- Pages 409-448, Acoustic remote sensing of ocean flows, Antony Joseph K, Ehrlich Desa --- Pages 449-475, Acoustic remote sensing of ocean-atmosphere interactions, A. Weill, H. Dupuis

Note: Univ. of Western Australia, Diss. von D. Müller--Nedlands , Pages 1-2, Introduction --- Pages 3-10, Definitions and Nomenclature --- Pages 11-39, Tectonic settings of potassic igneous rocks --- Pages 41-64, Selected type-localities of potassic igneous rocks from the five tectonic settings --- Pages 65-84, Primary enrichment of precious metals in potassic igneous rocks --- Pages 85-134, Direct associations between potassic igneous rocks and gold-copper deposits --- Pages 135-158, Indirect associations between lamprophyres and gold-copper deposits --- Pages 159-171, Halogen contents of mineralized versus unmineralized potassic igneous rocks --- Pages 173-176, Implications for mineral exploration --- Pages 177-200, Characteristics of some gold-copper deposits associated with potassic igneous rocks

Note: Cover; Half title; Title; Copyright; Contents; Contributors; Preface; 1 Introduction; 2 Intraplate earthquakes in Australia; 2.1 Introduction; 2.2 Two centuries of earthquake observations in Australia; 2.2.1 Mechanism, geographic distribution, and strain rate; 2.2.2 Seismogenic depth; 2.2.3 Attenuation and scaling relations; 2.3 A long-term landscape record of large (morphogenic) earthquakes; 2.3.1 Variation in fault scarp length and vertical displacement; 2.3.2 The influence of crustal type and character on seismic activity rates; 2.4 Patterns in earthquake occurrence. , 2.5 Maximum magnitude earthquake2.5.1 Scarp length as a proxy for paleo-earthquake magnitude; 2.6 Implications for SCR analogue studies: factors important in earthquake localisation; 2.6.1 Mechanical and thermal influences; 2.6.2 Structural architectural influences; 2.7 Conclusions; Acknowledgements; 3 Intraplate seismicity in Brazil; 3.1 Introduction; 3.2 Earthquake catalogue; 3.3 Seismicity map; 3.4 Seismotectonic correlations; 3.4.1 Lower seismicity in Precambrian cratonic provinces; 3.4.2 Intraplate seismicity and cratonic roots; 3.4.3 Passive margin seismicity. , 3.4.4 Influence of neotectonic faults3.4.5 Flexural stresses; 3.5 Discussion and conclusions; Acknowledgments; 4 Earthquakes and geological structures of the St. Lawrence Rift System; 4.1 Introduction; 4.2 Historical earthquakes and their impact; 4.3 Seismic zones of the SLRS; 4.3.1 Charlevoix; 4.3.2 Lower St. Lawrence; 4.3.3 Western Quebec; 4.3.4 Background seismicity; 4.4 The St. Lawrence Rift System; 4.5 The rift hypothesis and the SLRS: discussion and conclusions; Acknowledgments; 5 Intraplate earthquakes in North China; 5.1 Introduction; 5.2 Tectonic background; 5.2.1 Geological history. , 5.2.2 Lithospheric structure5.2.3 Major seismogenic faults; 5.3 Active tectonics and crustal kinematics; 5.4 Strain rates and seismicity; 5.5 Seismicity; 5.5.1 Paleoseismicity; 5.5.2 Large historic events; 1303 Hongdong earthquake (M 8.0); 1556 Huaxian earthquake (M 8.3); 1668 Tancheng earthquake (M 8.5); 1679 Sanhe earthquake (M 8.0); 1695 Linfen earthquake (M 7.5-8.0); 5.5.3 Large instrumentally recorded earthquake; The 1966 Xingtai earthquake (Ms 7.2); The 1975 Haicheng earthquake (Ms 7.3); The 1976 Tangshan earthquake (Ms 7.8); 5.6 Spatiotemporal patterns of large earthquakes. , 5.6.1 Long-distance roaming of large earthquakes5.6.2 Fault coupling and interaction; 5.6.3 A conceptual model for mid-continental earthquakes; 5.7 Implications for earthquake hazards; Acknowledgements; 6 Seismogenesis of earthquakes occurring in the ancient rift basin of Kachchh, Western India; 6.1 Introduction; 6.2 Tectonic framework, structure, and tectonic evolution of Kachchh Rift basin; 6.2.1 Structure and tectonics; 6.2.2 Tectono-volcanic events; 6.2.3 Tectonic evolution and existing earthquake generation models of the Kachchh Rift zone. , 6.2.4 Identification of magmatic intrusive bodies.

Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System

Note: Introduction, Pages 1-2 --- Relaxation, Pages 3-16 --- Shear Relaxation, Pages 17-32 --- Volume Relaxation, Pages 33-43 --- Enthalpy Relaxation, Pages 45-62 --- Summary, Pages 63-72

Note: Contents; Preface; 1 Introduction; 2 Fundamentals of rock failure physics; 2.1 Mechanical properties and constitutive relations; 2.1.1 Elastic deformation; 2.1.2 Ductile deformation; 2.1.3 Fracture; 2.1.4 Friction; 2.2 Basics of rock fracture mechanics; 2.2.1 Energy release rate and resistance to rupture growth; 2.2.2 Stress concentration and cohesive zone model; 2.2.3 Breakdown zone model for shear failure; 2.2.4 j-integral and energy criterion for shear failure; 2.2.5 Relation between resistance to rupture growth and constitutive relation parameters. , 3 Laboratory-derived constitutive relations for shear failure3.1 Shear failure of intact rock; 3.1.1 Method and apparatus used; 3.1.2 Constitutive relations derived from data on the shear failure of intact rock; 3.1.3 Geometric irregularity of shear-fractured surfaces and characteristic length; 3.2 Frictional slip failure on precut rock interface; 3.2.1 Method and apparatus used; 3.2.2 Geometric irregularity of precut fault surfaces and characteristic length; 3.2.3 Constitutive relations derived from data on frictional stick-slip failure. , 3.2.4 Laboratory-derived relationships between physical quantities observed during dynamic slip rupture propagation3.3 Unifying constitutive formulation and a constitutive scaling law; 3.3.1 Unification of constitutive relations for shear fracture and for frictional slip failure; 3.3.2 A constitutive scaling law; 3.3.3 Critical energy required for shear fracture and for frictional stick-slip failure; 3.3.4 Stabilityinstability of the breakdown process; 3.3.5 Breakdown zone size; 3.4 Dependence of constitutive law parameters on environmental factors; 3.4.1 Introduction. , 3.4.2 Dependence of shear failure strength on environmental factors3.4.3 Dependence of breakdown stress drop on environmental factors; 3.4.4 Dependence of breakdown displacement on environmental factors; 4 Constitutive laws for earthquake ruptures; 4.1 Basic foundations for constitutive formulations; 4.2 Rate-dependent constitutive formulations; 4.3 Slip-dependent constitutive formulations; 4.4 Depth dependence of constitutive law parameters; 5 Earthquake generation processes; 5.1 Shear failure nucleation processes observed in the laboratory; 5.1.1 Introduction; 5.1.2 Experimental method. , 5.1.3 Nucleation phases observed on faults with different surface roughnessesRough fault; Smooth fault; Extremely smooth fault; 5.1.4 Scaling of the nucleation zone size; 5.2 Earthquake rupture nucleation; 5.2.1 Seismogenic background; 5.2.2 Physical modeling and theoretical derivation of the nucleation zone size; 5.2.3 Comparison of theoretical relations with seismological data; 5.2.4 Foreshock activity associated with the nucleation process; 5.3 Dynamic propagation and generation of strong motion seismic waves; 5.3.1 Slip velocity and slip acceleration in the breakdown zone. , 5.3.2 The cutoff frequency fs max of the power spectral density of slip acceleration at the source.

Note: Konstruktionsgrundlagen Toleranzen und Passungen -- Festigkeitsberechnung -- Tribologie -- Kleb- und Lötverbindungen -- Schweiß-, Niet- u. Schraubverbindungen -- Bolzen- und Stiftverbindungen -- Elastische Federn -- Achsen, Wellen, Zapfen -- Wellen/Nabenverbindungen -- Kupplungen -- Bremsen -- Wälz- und Gleitlager -- Riemen- und Kettengetriebe -- Rohrleitungen -- Dichtungen -- Zahnräder und Zahnradgetriebe -- Außenverzahnte Stirnräder, Kegelräder, Schraubrad- und Schneckengetriebe..

Note: Machine generated contents note: Introduction Jan Aart Scholte; 1. Global governance, accountability and civil society Jan Aart Scholte; 2. Civil society and accountability of the United Nations Kerstin Martens; 3. The World Bank and democratic accountability: the role of civil society Alnoor Ebrahim and Steven Herz; 4. Civil society and IMF accountability Jan Aart Scholte; 5. Civil society and the WTO: contesting accountability Marc Williams; 6. Civil society and accountability in the Commonwealth Timothy M. Shaw and Pamela K. Mbabazi; 7. The organisation of the Islamic conference, accountability and civil society Saied Reza Ameli; 8. Civil society and patterns of accountability in the OECD Morten Ougaard; 9. Civil society and G8 accountability Peter I. Hajnal; 10. Structuring accountability: the Asia-Europe meeting Julie Gilson; 11. Civil society and accountability in global governance of climate change Peter Newell; 12. Civil society and accountability promotion in the global fund Carolyn Long and Nata Duvvury; 13. Accountability in private global governance: ICANN and civil society Mawaki Chango; 14. Civil society and the World Fair Trade Organisation: developing responsive accountability Heidi Ullrich; Conclusion Jan Aart Scholte..

Note: ""Cover""; ""Contents""; ""Acknowledgments""; ""Chapter 1 Introduction""; ""1.1 Types of Disease""; ""1.2 Characterization of Diseases""; ""1.3 Control of Infectious Diseases""; ""1.4 What Are Mathematical Models?""; ""1.5 What Models Can Do""; ""1.6 What Models Cannot Do""; ""1.7 What Is a Good Model?""; ""1.8 Layout of This Book""; ""1.9 What Else Should You Know?""; ""Chapter 2 Introduction to Simple Epidemic Models""; ""2.1 Formulating the Deterministic SIR Model""; ""2.1.1 The SIR Model Without Demography""; ""2.1.1.1 The Threshold Phenomenon""; ""2.1.1.2 Epidemic Burnout"". , ""2.1.1.3 Worked Example: Influenza in a Boarding School""""2.1.2 The SIR Model With Demography""; ""2.1.2.1 The Equilibrium State""; ""2.1.2.2 Stability Properties""; ""2.1.2.3 Oscillatory Dynamics""; ""2.1.2.4 Mean Age at Infection""; ""2.2 Infection-Induced Mortality and SI Models""; ""2.2.1 Mortality Throughout Infection""; ""2.2.1.1 Density-Dependent Transmission""; ""2.2.1.2 Frequency Dependent Transmission""; ""2.2.2 Mortality Late in Infection""; ""2.2.3 Fatal Infections""; ""2.3 Without Immunity: The SIS Model""; ""2.4 Waning Immunity: The SIRS Model"". , ""2.5 Adding a Latent Period: The SEIR Model""""2.6 Infections with a Carrier State""; ""2.7 Discrete-Time Models""; ""2.8 Parameterization""; ""2.8.1 Estimating R[sub(0)] from Reported Cases""; ""2.8.2 Estimating R[sub(0)] from Seroprevalence Data""; ""2.8.3 Estimating Parameters in General""; ""2.9 Summary""; ""Chapter 3 Host Heterogeneities""; ""3.1 Risk-Structure: Sexually Transmitted Infections""; ""3.1.1 Modeling Risk Structure""; ""3.1.1.1 High-Risk and Low-Risk Groups""; ""3.1.1.2 Initial Dynamics""; ""3.1.1.3 Equilibrium Prevalence""; ""3.1.1.4 Targeted Control"". , ""3.1.1.5 Generalizing the Model""""3.1.1.6 Parameterization""; ""3.1.2 Two Applications of Risk Structure""; ""3.1.2.1 Early Dynamics of HIV""; ""3.1.2.2 Chlamydia Infections in Koalas""; ""3.1.3 Other Types of Risk Structure""; ""3.2 Age-Structure: Childhood Infections""; ""3.2.1 Basic Methodology""; ""3.2.1.1 Initial Dynamics""; ""3.2.1.2 Equilibrium Prevalence""; ""3.2.1.3 Control by Vaccination""; ""3.2.1.3 Parameterization""; ""3.2.2 Applications of Age Structure""; ""3.2.2.1 Dynamics of Measles""; ""3.2.2.2 Spread and Control of BSE""; ""3.3 Dependence on Time Since Infection"". , ""3.3.1 SEIR and Multi-Compartment Models""""3.3.2 Models with Memory""; ""3.3.3 Application: SARS""; ""3.4 Future Directions""; ""3.5 Summary""; ""Chapter 4 Multi-Pathogen/Multi-Host Models""; ""4.1 Multiple Pathogens""; ""4.1.1 Complete Cross-Immunity""; ""4.1.1.1 Evolutionary Implications""; ""4.1.2 No Cross-Immunity""; ""4.1.2.1 Application: The Interaction of Measles and Whooping Cough""; ""4.1.2.2 Application: Multiple Malaria Strains""; ""4.1.3 Enhanced Susceptibility""; ""4.1.4 Partial Cross-Immunity""; ""4.1.4.1 Evolutionary Implications"". , ""4.1.4.2 Oscillations Driven by Cross-Immunity"".

Note: Enth. u.a.: Zur Bestimmung der Ausdehnung von Materialien am Abbe-Fizeauschen Dilatometer / von W. Bein

Note: Introduction; Benno WerlenPreface: Speech at TIERS Conference in Jena on 8 June 2012; Matthias Machnig -- PART I: INTEGRATED TRANSDISCIPLINARY RESEARCH -- Chapter 1: Sustainability and Territory: An Approach from the Perspective of the Imaginary in Shaping Development; Enrique Aliste -- Chapter 2: Challenges for Transdisciplinary Research; Joske Bunders -- Chapter 3: Narratives for a Sustainable Future. Vision and Motivation for Collective Action; Ilan Chabay -- PART II: KNOWLEDGE -- Chapter 4: Carving a Niche for the Social Sciences in Trans-disciplinary Research on Climate Change Adaptation and Agriculture in Southern Africa; Chipo Plaxedes Mubaya -- Chapter 5: From Co-Production of Knowledge to Transdisciplinary Research. Lessons from the Quest for Producing Socially Robust Knowledge; Juergen Weichselgartner and Bernhard Truffer -- PART III: INTERFACES SOCIETY NATURE -- Chapter 6: Terrestrial Ecosystems Dynamic in the Senegalese Agro-silvopastoral Center-east in the Second Half of the XXe Century; Aliou Dijouf and Matthew G. Hatvany -- Chapter 7: Integrated Global Change Research in West Africa: Flood Vulnerability Studies; Ibidun Adelekan -- Chapter 8: Integrated Approach in Environment Management: Context Bangladesh; Raquib Ahmed -- Chapter 9: Awareness of and Responses to the 2011 Flood Warnings among Vulnerable Communities in Lagos, Nigeria; Olokesusi, F., Olorunfemi, F.B., Onwuemele A. and Oke, M.O -- PART IV: INTERFACES SCIENCE POLICY -- Chapter 10: Solution-Based Spatial Planning for Disaster Risk Reduction and Adaptation to Climate Change in Taiwan; Yu-Fang Lin -- Chapter 11: Institutions and Planning: A Reflection from the Disaster Management Planning in Indonesia; Hendricus A Simarmata and Raka W Suryandaru -- Chapter 12: Could the Search for Sustainability Reinforce the Socio-ecological Conflict? The Mining Industry in Chile and its Impact at the Local and Regional Level; Fernando Campos-Medina -- Chapter 13: Institutions and Planning: A Reflection from Disaster Management Planning in Indonesia; Hendricus A. Simarmata and Raka W. Suryandaru -- Chapter 14: Could the Search for Sustainability Reinforce the Socio-ecological Conflict? The Mining Industry in Chile and its Impact at the Local and Regional Level; Fernando Campos-Medina -- Chapter 15: Political decision-making and Scientific Insights. A comment form the Political Arena; Matthias Machnig..

Note: I Einleitung und MotivationII CO2 Eigenschaften, Herkunft, Verwendung und Mengen -- III CO2-Abtrennung und -Speicherung -- IV CO2-Nutzung (CCR) -- V Multikriterielle Bewertung von CCS und CCR -- VI Szenarien -- VII CCS aktuell..

Note: Cover; Copyright; Praise; Introduction; Contents; Section 1: THINK IT; The First Thing to Do When You Find Yourself in a Hole: Stop Digging; Stay Positive; Never Lose Faith; Seven Career Lessons I Learned from Selling Ginsu Knives; A Turning Point; Stop. Breathe. Think. Then Act.; Overcoming Inertia; Overcoming Fear; Keep Swimming; Section 2: DO IT; What Is a Resume?; What Are Managers Looking For?; Dirty Little Resume Secrets; The T-Bomb; Current Experience; What You Do Is More Important than What You're Called; The Top Ten Mistakes Professionals Make When Looking for Work. , Resumes: A SummaryCover Your Letter; Following Up; Getting Interviews; Be Proactive; Be Visible; Social Networking; Four Critical Steps to Getting a Job Offer; Send Out Ships; Gold Calling; Section 3: HAVE IT; Creating the Path; Recession-Proof Your Career; Creating a PR Campaign; Taking the Initiative; Increase Your Ability to Find Work; Advancing Your Career through Personal Branding; Advancing Your Career through Progressive Information Disclosure; Honing Your Workplace Negotiation Skills; The Sky's the Limit; What Are You Waiting For?; About Making Money; Creating the Life You Want. , Recommended ReadingAbout the Author.

Note: Geotechnical damage in the downstream reaches of the Tone river in the 2011 East Japan EarthquakeAmplification Effects of Thin Soft Surface Layers: A Study for NBCC 2015 -- New design spectra in Eurocode 8 and preliminary application to the seismic risk of Thessaloniki, Greece -- Incorporating Site Response into Seismic Hazard Assessments for Critical Facilities: A Probabilistic Approach -- Stress Scaling Factors For Seismic Soil Liquefaction Engineering Problems: A Performance-Based Approach -- Site amplification formula using Average Vs in equivalent surface layer based on vertical array strong motion records -- Observations from Istanbul vertical arrays and site specific response analysis -- Combined failure mechanism of a breakwater subject to Tsunami during 2011 East Japan Earthquake -- Lessons Learned From Dams Behavior Under Recent Earthquakes -- Nonlinear dynamic analyses of liquefaction effects on dams -- The Effects of Liquefaction on Earthquake Ground Motions -- Shaking model tests on liquefaction mitigation of embedded lifeline -- Effect of Long Duration of the Main Shock and a Big Aftershock on the Liquefaction-Induced Damage During the 2011 Great East Japan Earthquake -- Liquefaction Observed During the 2010 Chile Earthquake -- A Case Study of Silty Sand Liquefaction- 2010 Hsin Hwa Liquefaction in Taiwan -- Post-earthquake analysis for a seismic retrofitting: the case history of a piled foundation in Augusta (Italy) -- Pile design in laterally spreading soil: Feedback from numerical predictions and model test results -- Integrating use of Swedish weight sounding tests for earthquake reconnaissance investigations..

Note: Preface; Contributors; Content; Introduction; Cosmology - The Largest Possible Model?; The Standard Model of Cosmology as a Tool for Interpretation and Discovery; Patterns in Physical and Biological Systems; Symmetry and the Explanation of Organismal Form; Pluralistic Modeling of Complex Systems; The Methodological Challenges of Complex Systems; Contested Modeling: The Case of Economics; A Unifying Approach to High- and Low-Level Cognition; High-vs Low-Level Cognition and the Neuro- Emulative Theory of Mental Representation. , Evaluating a Computational Model of Eye-Movement Control in ReadingConsidering Criteria for Model Modification and Theory Change in Psychology; Identification of Kinetic Models by Incremental Refinement; Kinetics, Models, and Mechanism; Modeling Complexity: The Case of Climate Science; Chaos, Plurality, and Model Metrics in Climate Science; Subject Index; Author Index.

Note: Pages 1-9, Geodynamic evolution of the Atlas system, Morocco: An introduction, Volker Jacobshagen --- Pages 11-17, The Anti-Atlas system: An overview, Eckard Wallbrecher --- Pages 19-42, A ductile shear zone in the Panafrican basement on the northwestern margin of the West African Craton (Sirwa Dome, Central Anti-Atlas, Eckard Wallbrecher --- Pages 43-60, Tectonothermal evolution of the late Panafrican Orogeny in the central Anti-Atlas (Southern Morocco), Yannis Bassias, Eckard Wallbrecher, Alexander Willgallis --- Pages 61-80, A plate tectonic model for the Panafrican Orogeny in the Anti-Atlas, Morocco, Peteralv M. Brabers --- Pages 81-90, The Precambrian/Cambrian boundary in the Anti-Atlas (Morocco) discussion and new results, Werner Buggisch, Erik Flügel --- Pages 91-106, The base of the Cambrian in Morocco, K. Sdzuy, G. Geyer --- Pages 107-121, Paleogeography and facies of the ‘gres terminaux’ (uppermost Lower Cambrian, Anti-Atlas/Morocco), Werner Buggisch, Rainer Siegert --- Pages 123-128, Diagenesis and very low-grade metamorphism of the Lower Cambrian rocks in the Anti-Atlas (Morocco), Werner Buggisch --- Pages 129-138, Deformation of igneous dikes in and around the Tichka granite, high Atlas — Morocco, Jean-Paul Schaer --- Pages 139-168, Synthesis of late paleozoic and triassic redbed sedimentation in Morocco, John C. Lorenz --- Pages 169-199, Jurassic carbonate facies of the Central and Eastern High Atlas rift, Morocco, John E. Warme --- Pages 201-217, Jurassic sediments of the Central High Atlas of Morocco: Deposition, burial and erosian history, Y.A. Brechbühler, R. Bernasconi, J. -P. Schaer --- Pages 219-244, Aspects of Western High Atlas tectonics, Nikolaus Froitzheim, Johannes Stets, Paul Wurster --- Pages 245-271, Structure and post-Palaeozoic evolution of the central High Atlas, Volker Jacobshagen, Rainald Brede, Manfred Hauptmann, Werner Heinitz, Renate Zylka --- Pages 273-291, Structural evolution of the southern and northern Central High Atlas in paleogene and Mio-Pliocene times, Cyril Fraissinet, Mustapha El Zouine, Jean-Luc Morel, André Poisson, Jean Andrieux… --- Pages 293-320, Recent data on the geology of the Middle-Atlas (Morocco), Renaud du Dresnay --- Pages 321-337, Synsedimentary tectonics in the Northern Middle Atlas (Morocco) during the late Cretaceous and Tertiary, Hans-Georg Herbig --- Pages 339-357, Geophysical studies of the earth's crust and upper mantle in the Atlas system of Morocco, Gerhard Schwarz, Peter J. Wigger --- Pages 359-404, The uplift of the central High Atlas as deduced from neogene continental sediments of the Ouarzazate province, Morocco, Konrad Görler, Friedrich-Franz Helmdach, Pieter Gaemers, Kurt Heißig, Winfried Hinsch… --- Pages 405-432, The ostracode fauna of the Ait Kandoula region, systematic description, Friedrich-Franz Helmdach --- Pages 433-444, Geomorphological aspects of the quaternary evolution of the Ouarzazate Basin, Southern Morocco, Gerhard Stäblein --- Pages 445-462, Rates of scarp retreat: A means of dating Neotectonic activity, Karl-Heinz Schmidt --- Pages 463-480, Evolution of the Alboran block margin from early Mesozoic to early Miocene time, M. Durand-Delga, Ph. Olivier --- Pages 481-499, Geodynamic evolution of the Atlas system (Morocco) in post-palaeozoic times, Volker Jacobshagen, Konrad Görler, Peter Giese

Note: Cover; Title Page; Copyright Page; Table of Contents; List of illustrations; Notes on contributors; Acknowledgements; 1 Socio-ecological transformations and the social sciences; PART I Challenges, contradictions and consequences of global socio-ecological change; 2 Ecological modernization theory: taking stock, moving forward; 3 The emergence of new world-systems perspectives on global environmental change; 4 China's economic growth and environmental protection: approaching a 'win-win' situation? A discussion of ecological modernization theory; 5 Eco-imperialism and environmental justice. , 6 Neoliberalism by design: changing modalities of market-based environmental governance7 Dilemmas for standardizers of sustainable consumption; PART II Climate change, energy and adaptation; 8 Climate, scenario-building and governance: comprehending the temporalities of social-ecological change; 9 From Rio to Copenhagen: multilateral agreements, disagreements and situated actions; 10 Marriage on the rocks: sociology's counsel for our struggling energy-society relationships; 11 Sustainability as social practice: new perspectives on the theory and policies of reducing energy consumption. , 12 Environmental migration: nature, society and population movementPART III Urban environmental change, governance and adaptation; 13 Climate change and urban governance: a new politics?; 14 Recovering the city level in the global environmental struggle: going beyond carbon trading; 15 Hybrid arrangements within the environmental state; 16 The new mobilities paradigm and sustainable transport: finding synergies and creating new methods; PART IV Risk, uncertainty and social learning; 17 Towards a socio-ecological foundation for environmental risk research. , 18 Uncertainty and claims of uncertainty as impediments to risk management19 Transboundary risk governance: co-constructing environmental issues and political solutions; 20 The role of professionals in managing technological hazards: the Montara blowout; 21 Social learning to cope with global environmental change and unsustainability; PART V (Re)assembling social-ecological systems; 22 The social-ecological co-constitution of nature through ecological restoration: experimentally coping with inevitable ignorance and surprise. , 23 Biological invasions as cause and consequence of 'our' changing world: social and environmental paradoxes24 Biological resources, knowledge and property; 25 Disassembling and reassembling socionatural networks: integrated natural resource management in the Great Bear Rainforest; 26 Land use tensions for the development of renewable sources of energy; Index.

Note: Land and Water Resources of Siberia, their Functioning and Ecological StateStatus Report about Understanding, Monitoring and Controlling Landscape Processes in Siberia -- Methods for Monitoring the Chemical Composition of Lake Baikal Water -- Microbiological Monitoring of Lake Baikal -- Developing the Regional Indicator Indexes of Zooplankton for Water Quality Class Determination of Water Bodies in Siberia -- Measuring and Estimating Fluxes of Carbon, Major and Trace Elements to the Arctic Ocean -- Measuring Snowmelt in Siberia: Causes, Process and Consequences -- Estimation of Biomass and Net Primary Production (NPP) in West Siberian Boreal Ecosystems: In-Situ and Remote Sensing Methods -- GIS and Remote Sensing Data Based Methods for Monitoring Water and Soil Objects in the Steppe Biome of Western Siberia -- Significant Siberian Vegetation Change is Inevitably Brought on by the Changing Climate..

Note: Cover; Copyright; Contents; Figures; Tables; Contributors; Abbreviations; PART I Introduction; 1. Changing regulatory arrangements in food governance; 2. Conceptualizing regulatory arrangements: Complex networks and regulatory roles; PART II Public policy responses to food safety challenges; 3. Regulation of food safety in the EU: Explaining organizational diversity among Member States; 4. Buying biosecurity: UK compensation for animal diseases; 5. Being well fed: Food safety regimes in China. , 6. The political economy of Chinese food safety regulation: Distributing adulterated milk powder in mainland China and TaiwanPART III New forms of private food governance; 7. Authority and legitimacy in governing global food chains; 8. The effectiveness of private food governance in fostering sustainable development; 9. Food quality through networks in the European wine industry; 10. Markets regulating markets: Competitive private regulation by halal certificates; PART IV How public and private regulation meet. , 11. Are we being served? The relationship between public and private food safety regulation12. Between public and private requirements: Challenges and opportunities for the export of tropical fruits from developing countries to the EU; 13. The meta-governance of co-regulation: Safeguarding the quality of Dutch eggs; Index.

Note: I Physics of the Upper AtmosphereI.1 Introduction to the Earth’s Atmosphere -- I.2 Dynamics of the Atmosphere -- I.3 Atmospheric Tides -- I.4 Chemistry in the Atmosphere -- I.5 H2O in the Atmosphere -- I.6 Pollution of the Upper Atmosphere -- I.7 Transatmospheric Propagation of Radio Waves: The Role of the Atmosphere in Communication, Navigation, Geodesy etc. -- I.8 Atmosphere as a Part of the Biosphere -- I.9 Legal Aspects -- II Investigation Methods of the Upper Atmosphere -- II.1 Acoustic Methods for Probing the Upper Atmosphere -- II.2 Hydrodynamic and Electrodynamic Measurements -- II.3 Electromagnetic Waves in the Upper Atmosphere -- II.4 Chemistry and Physico-Chemistry -- II.5 Modification Methods -- III International Reference and Model Atmosphere -- III.1 Selected Features of the Middle Atmosphere -- III.2 The Thermosphere: Selected Features -- III.3 The Ionosphere -- III.4 Magnetosphere -- IV Special Phenomena of the Upper Atmosphere -- IV.1 Stratospheric Midwinter Warmings -- IV.2 The Antarctic Ozone Hole -- IV.3 Polar Mesospheric Clouds -- IV.4 Night Glow -- IV.5 Aurorae -- V Solar-Terrestrial Relations -- V.1 Solar Activity, Solar Cycle, Coordinates -- V.2 The Solar Wind and Its Effects on Geospace -- V.3 Geomagnetic Activity Indices -- VI Data Centres, Computer Network Communications, Observing Systems and Data Growth Rate Problems, Problems with Long-Term Data, Relevant for the Upper Atmosphere -- VI.1 General Overview of Online Services and Data Centres -- VI.2 The World Data Centre System, International Data Exchange, and New ICSU Programs -- VI.3 Computer Network Communications -- VI.4 SELDADS and SELSIS -- VI.5 Data Growth Rate Problems and Problems with Long-Term Data..

Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.

Note: Frontcover; Contents; Acknowledgments; Introduction; 1: The Problem(s); 2: A Plethora of Germanies; 3: Culture, Language, and Blood; 4: The Gemeinschaft; 5: Marx, the Proletariat, and the State; 6: Hegel and the State; 7: German Historians and the State; 8: Meinecke and the State; 9: The Lingering Ambiguities of the State; 10: Materialism; 11: Militarism and Death; 12: Providence and Narration; 13: Guilt and Innocence; 14: The Indispensable Jews; 16: The State Today; Notes; Index.

Note: Contents: Einleitung: Kulturräumliche Unterschiede im Umgang mit Klimawandel? ; Klimakulturen und Raum: Theoretische Grundlagen ; Klimawandel-Konstruktionen in den Naturwissenschaften: Grundbegriffe und Wissensgenese ; Resilienzkonstruktionen als Klimaschutz- und Klimaanpassungspraktiken: Eine Einführung in diskutierte Kernstrategien der Raumentwicklung ; Erklärungen für klimakulturelle Differenzen: Sozialwissenschaftliche Diskurse und Ableitung von Hypothesen ; Zur (Re-) Konstruktion klimapolitisch-administrativer Rahmungen im Untersuchungsraum ; Empirisches Vorgehen ; Kommunikation zu Klimawandel an europäischen Küsten ; Vulnerabilitätskonstruktionen an europäischen Küsten ; Resilienzkonstruktionen an europäischen Küsten ; Fazit

Note: Contents: Front Matter -- Copyright -- Contents -- Acknowledgements -- 1. Introduction -- 2. Good health -- 3. The invisible mind -- 4. Inputs and outcomes -- 5. The individual -- 6. The practitioner -- 7. The public -- 8. The logic of insurance -- 9. Insurance: private and public -- 10. Equity and equality -- 11. The right to health -- 12. Inequality and health -- 13. Narrowing the gap -- 14. Equalising medical care -- 15. The cost of care -- 16. Cost containment -- 17. State, market and cost -- 18. Conclusion -- References -- Index

Note: Contents: I Grundlegungen und Orientierungen ; 1. Grundlegungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; 2. Orientierungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; II Forschungs- und Handlungsfelder der Nachhaltigkeitswissenschaften und -politik ; 1. Einführung ; 2. Wissenschaft und Forschung ; 3. Wirtschaften und Arbeiten ; 4. Raumentwicklung ; 5. Mobilität ; 6. Klimawandel und -politik ; 7. Ressourcenpolitik und Infrastruktur ; 8. Natur und Landschaft ; 9. Konsum- und Lebensstile ; 10. Zeit(en) ; 11. Governance, Partizipation, Empowerment ; III Fazit - Die Kategorie Geschlecht: Neue Perspektiven für die Nachhaltigkeitswissenschaften

Note: ""Preface""; ""Acknowledgments""; ""Contents""; ""Chapter 1 Structure and Composition of the Lower and Middle Atmosphere""; ""Chapter 2 Radiative Processes in the Lower and Middle Atmosphere""; ""Chapter 3 Dynamics of the Troposphere and Stratosphere""; ""Chapter 4 Waves in the Troposphere and Stratosphere""; ""Chapter 5 Chemical Processes in the Stratosphere and Troposphere""; ""Chapter 6 Stratospheric Ozone Depletion and Antarctic Ozone Hole""; ""Chapter 7 Transport Processes in the Stratosphere and Troposphere""; ""Chapter 8 Stratosphere�Troposphere Exchange"". , ""Chapter 9 Stratospheric Influence on Tropospheric Weather and Climate""""Acronyms""; ""List of Symbols""; ""Table of Physical Constants""; ""Answers to Selected Problems""; ""Index"".

Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.

Note: Front Cover --- Introduction to Satellite Remote Sensing --- Introduction to Satellite Remote Sensing: Atmosphere, Ocean, Land and Cryosphere Applications --- Copyright --- Dedication --- Contents --- 1 - THE HISTORY OF SATELLITE REMOTE SENSING --- 1.1 THE DEFINITION OF REMOTE SENSING --- 1.2 THE HISTORY OF SATELLITE REMOTE SENSING --- 1.2.1 THE NATURE OF LIGHT AND THE DEVELOPMENT OF AERIAL PHOTOGRAPHY --- 1.2.2 THE BIRTH OF EARTH-ORBITING SATELLITES --- 1.2.3 THE FUTURE OF POLAR-ORBITING SATELLITES --- 1.2.3.1 The Cross-Track Infrared Sounder --- 1.2.4 OTHER HISTORICAL SATELLITE PROGRAMS --- 1.2.4.1 The NIMBUS Program --- 1.2.4.2 The Landsat Program --- 1.2.4.3 The Defense Meteorological Satellite Program --- 1.2.4.4 Geostationary Weather Satellites --- 1.2.4.4.1 GOES-R --- 1.3 STUDY QUESTIONS --- 2 - BASIC ELECTROMAGNETIC CONCEPTS AND APPLICATIONS TO OPTICAL SENSORS --- 2.1 MAXWELL'S EQUATIONS --- 2.2 THE BASICS OF ELECTROMAGNETIC RADIATION --- 2.3 THE REMOTE SENSING PROCESS --- 2.4 THE CHARACTER OF ELECTROMAGNETIC WAVES --- 2.4.1 DEFINITION OF RADIOMETRIC TERMS --- 2.4.2 POLARIZATION AND THE STOKES VECTOR --- 2.4.3 REFLECTION AND REFRACTION AT THE INTERFACE OF TWO FLAT MEDIA --- 2.4.4 BREWSTER'S ANGLE --- 2.4.5 CRITICAL ANGLE --- 2.4.6 ALBEDO VERSUS REFLECTANCE --- 2.5 ELECTROMAGNETIC SPECTRUM: DISTRIBUTION OF RADIANT ENERGIES --- 2.5.1 GAMMA, X-RAY, AND ULTRAVIOLET PORTIONS OF THE ELECTROMAGNETIC SPECTRUM --- 2.5.2 VISIBLE SPECTRUM --- 2.5.3 THERMAL INFRARED SPECTRUM --- 2.5.4 MICROWAVE SPECTRUM --- 2.6 ATMOSPHERIC TRANSMISSION --- 2.6.1 SPECTRAL WINDOWS --- 2.6.2 ATMOSPHERIC EFFECTS --- 2.6.2.1 Beer-Lambert Absorption Law --- 2.6.2.2 Beer-Lambert Absorption Law: Opacity --- 2.6.2.3 Atmospheric Scattering --- 2.7 SENSORS TO MEASURE PARAMETERS OF THE EARTH'S SURFACE --- 2.8 INCOMING SOLAR RADIATION --- 2.9 INFRARED EMISSIONS --- 2.10 SURFACE REFLECTANCE: LAND TARGETS --- 2.10.1 LAND SURFACE MIXTURES --- 2.11 STUDY QUESTIONS --- 3 - OPTICAL IMAGING SYSTEMS --- 3.1 PHYSICAL MEASUREMENT PRINCIPLES --- 3.2 BASIC OPTICAL SYSTEMS --- 3.2.1 PRISMS --- 3.2.2 FILTER-WHEEL RADIOMETERS --- 3.2.2.1 An Example: The Cloud Absorption Radiometer --- 3.2.2.2 Filters --- 3.2.3 GRATING SPECTROMETER --- 3.2.4 INTERFEROMETER --- 3.3 SPECTRAL RESOLVING POWER --- THE RAYLEIGH CRITERION --- 3.4 DETECTING THE SIGNAL --- 3.5 VIGNETTING --- 3.6 SCAN GEOMETRIES --- 3.7 FIELD OF VIEW --- 3.8 OPTICAL SENSOR CALIBRATION --- 3.8.1 VISIBLE WAVELENGTHS CALIBRATION --- 3.8.2 POLARIZATION FILTERS --- 3.9 LIGHT DETECTION AND RANGING --- 3.9.1 PHYSICS OF THE MEASUREMENT --- 3.9.2 OPTICAL AND TECHNOLOGICAL CONSIDERATIONS --- 3.9.3 APPLICATIONS OF LIDAR SYSTEMS --- 3.9.4 WIND LIDAR --- 3.9.4.1 Vector Wind Velocity Determination --- 3.9.4.1.1 Velocity Azimuth Display LIDAR Vector Wind Method --- 3.9.4.1.2 Doppler Beam Swinging LIDAR Vector Wind Method --- 3.9.4.2 Direct Detection Doppler Wind LIDAR --- 3.9.4.3 LIDAR Wind Summary --- 3.10 STUDY QUESTIONS --- 4 - Microwave Radiometry --- 4.1 Basic Concepts on Microwave Radiometry --- 4.1.1 Blackbody Radiation --- 4.1.2 Gray-body Radiation: Brightness Temperature and Emissivity --- 4.1.3 General Expressions for the Emissivity --- 4.1.3.1 Simple Emissivity Models: Emission From a Perfect Specular Surface --- 4.1.3.2 Simple Emissivity Models: Emission From a Lambertian Surface --- 4.1.3.1 Simple Emissivity Models: Emission From a Perfect Specular Surface --- 4.1.3.2 Simple Emissivity Models: Emission From a Lambertian Surface --- 4.1.4 Power Collected by an Antenna Surrounded by a Blackbody --- 4.1.5 Power Collected by an Antenna Surrounded by a Gray body: Apparent Temperature and Antenna Temperature --- 4.2 The Radiative Transfer Equation --- 4.2.1 The Complete Polarimetric Radiative Transfer Equation --- 4.2.2 Usual Approximations to the Radiative Transfer Equation --- 4.3 Emission Behavior of Natural Surfaces --- 4.3.1 The Atmosphere --- 4.3.1.1 Attenuation by Atmospheric Gases --- 4.3.1.2 Attenuation by Rain --- 4.3.1.3 Attenuation by Clouds and Fog --- 4.3.2 The Ionosphere --- 4.3.2.1 Faraday Rotation --- 4.3.2.2 Ionospheric Losses: Absorption and Emission --- 4.3.3 Land Emission --- 4.3.3.1 Soil Dielectric Constant Models --- 4.3.3.2 Bare Soil Emission --- 4.3.3.3 Vegetated Soil Emission --- 4.3.3.4 Snow-Covered Soil Emission --- 4.3.3.5 Topography Effects --- 4.3.4 Ocean Emission --- 4.3.4.1 Water Dielectric Constant Behavior --- 4.3.4.2 Calm Ocean Emission --- 4.3.4.2.1 Influence of the Salinity --- 4.3.4.2.2 Influence of Frequency --- 4.3.4.2.3 Influence of the Water Temperature --- 4.3.4.3 Influence of the Sea State --- 4.3.4.3.1 Influence of the Look Angle --- 4.3.4.4 Emissivity of the Sea Surface Covered With Oil --- 4.3.4.5 Emissivity of the Sea Ice Surface --- 4.4 Understanding Microwave Radiometry Imagery --- 4.5 Applications of Microwave Radiometry --- 4.6 Sensors --- 4.6.1 Historical Review of Microwave Radiometers and Frequency Bands Used --- 4.6.2 Microwave Radiometers: Basic Performance --- 4.6.2.1 Spatial Resolution --- 4.6.2.1.1 Real Aperture Radiometers --- 4.6.2.1.2 Synthetic Aperture Radiometers --- 4.6.2.2 Radiometric Resolution --- 4.6.2.2.1 Real Aperture Radiometers --- 4.6.2.2.2 Synthetic Aperture Radiometers --- 4.6.2.3 Trade-off Between Spatial Resolution and Radiometric Precision --- 4.6.3 Real Aperture Radiometers --- 4.6.3.1 Instrument Considerations --- 4.6.3.1.1 Antenna Considerations --- 4.6.3.1.2 Receiver Considerations --- 4.6.3.1.3 Sampling Considerations --- 4.6.3.2 Types of Real Aperture Radiometers --- 4.6.3.3 Radiometer Calibration --- 4.6.3.3.1 External Calibration --- 4.6.3.3.1.1 Using Hot and Cold Targets --- 4.6.3.3.1.2 Fully Polarimetric Radiometer Calibration Using External Targets --- 4.6.3.3.1.3 Tip Curves --- 4.6.3.3.1.4 Earth Targets: Vicarious Calibration --- 4.6.3.3.2 Internal Calibration --- 4.6.3.3.3 Radiometer Linearity --- 4.6.3.4 Radio Frequency Interference Detection and Mitigation --- 4.6.3.5 Example: Special Sensor Microwave Imager Radiometric and Geometric Corrections --- 4.6.4 Synthetic Aperture Radiometers --- 4.6.4.1 Types of Synthetic Aperture Radiometers --- 4.6.4.1.1 Mills Cross --- 4.6.4.1.2 Synthetic Aperture Radiometers using Matched Filtering --- 4.6.4.1.3 Synthetic Aperture Radiometers using Fourier Synthesis --- 4.6.4.1.3.1 1D Synthetic Aperture Radiometers: Array Thinning --- 4.6.4.1.3.2 2D Synthetic Aperture Radiometers: Array Topologies --- 4.6.4.1.3.3 Other Synthetic Aperture Radiometer Concepts --- 4.6.4.2 Radiometer Calibration --- 4.6.4.2.1 Internal Calibration --- 4.6.4.2.2 External Calibration --- 4.6.4.3 Image Reconstruction --- 4.6.4.4 ESA's SMOS Mission and the MIRAS Instrument --- 4.6.5 Future Trends in Microwave Radiometers --- 4.7 Study Questions --- 5 - RADAR --- 5.1 A COMPACT INTRODUCTION TO RADAR THEORY --- 5.1.1 REMOTE RANGING --- 5.1.2 DOPPLER ANALYSIS --- 5.2 RADAR SCATTERING --- 5.2.1 RADAR FREQUENCY BANDS --- 5.2.2 NORMALIZATIONS OF THE RADAR REFLECTIVITY --- 5.2.3 POINT VERSUS DISTRIBUTED SCATTERERS --- 5.2.4 SPECKLE, MULTILOOK, AND RADIOMETRIC RESOLUTION --- 5.2.5 RADAR EQUATION --- 5.2.6 RADAR WAVES AT AN INTERFACE --- 5.2.7 MULTIPLE REFLECTIONS: DOUBLE BOUNCE, TRIPLE BOUNCE, AND URBAN AREAS --- 5.2.8 BACKSCATTERING OF SURFACES --- 5.2.9 PERIODIC SCATTERING: THE BRAGG MODEL --- 5.2.10 BACKSCATTERING OF VOLUMES --- 5.2.11 OVERALL SUMMARY OF RADAR BACKSCATTER --- 5.2.12 DEPOLARIZATION OF RADAR WAVES --- 5.3 RADAR SYSTEMS --- 5.3.1 RANGE-DOPPLER RADARS --- 5.3.2 OPTIMAL RECEIVER FOR A SINGLE ECHO: THE MATCHED FILTER --- 5.3.3 MATCHED FILTER VERSUS INVERSE FILTER --- 5.3.4 OPTIMAL RECEIVER FOR RANGE-DOPPLER RADAR ECHOES: THE BACKPROJECTION OPERATOR --- 5.3.5 RADAR WAVEFORMS --- 5.3.6 A PARADIGMATIC EXAMPLE: LINEAR FREQUENCY MODULATED PULSES (CHIRPS) --- 5.3.7 GEOMET

Note: 1.1. The Early History of Glass; 1.2. Glass and Science; 1.3. The Discovery of Natural Melts; 1.4. The Physical Chemistry of Melts; 1.5. Summary Remarks; References; Chapter 2. Glass Versus Melt; 2.1. Relaxation; 2.2. Glass Transition; 2.3. Configurational Properties; 2.4. Summary Remarks; References; Chapter 3. Glasses and Melts vs. Crystals; 3.1. Basics of Silicate Structure 3.2. Thermodynamic Properties3.3. Liquid-Like Character of Crystals; 3.4. Summary Remarks; References; Chapter 4. Melt and Glass Structure -- Basic Concepts; 4.1. Bond Length, Bond Angle, and Bond Strength in Silicates; 4.2. Network-Formers; 4.3. Network-Modifying Cations and Linkage between Structural Units; 4.4. Bonding, Composition and Effects on Melt Properties; 4.5 Mixing, Order, and Disorder; 4.6. Summary Remarks; References; Chapter 5. Silica -- A Deceitful Simplicity; 5.1. An Outstanding Oxide; 5.2. Physical Properties; 5.3. Structure of SiO2 Glass and Melt 5.4. Effects of Pressure and Temperature5.5. Summary Remarks; References; Chapter 6. Binary Metal Oxide-Silica Systems -- I. Physical Properties; 6.1. Phase Relationships; 6.2. Thermodynamics of Mixing; 6.3. Volume and Transport Properties; 6.4. Summary Remarks; References; Chapter 7. Binary Metal Oxide-Silica Systems -- II. Structure; 7.1. Pseudocrystalline Models of Melt Structure; 7.2. Thermodynamic Modeling and Melt Structure; 7.3. Numerical Simulation of Melt Structure; 7.4. Structure from Direct Measurements; 7.5. Structure and Melt Properties; 7.6. Summary Remarks; References Chapter 8. Aluminosilicate Systems -- I. Physical Properties8.1. Phase Relationships; 8.2. Thermodynamics of Mixing; 8.3. Volume and Viscosity; 8.4. Summary Remarks; References; Chapter 9. Aluminosilicate Systems -- II. Structure; 9.1. Binary Al2O3-Bearing Glasses and Melts; 9.2. Meta-Aluminosilicate Glasses and Melts (SiO2-M1/xAlO2); 9.3. Peralkaline Aluminosilicate Glasses and Melts; 9.4. Pressure and the Structure of Aluminosilicate Melts; 9.5. Structure and Properties of Aluminosilicate Melts; 9.6. Summary Remarks; References; Chapter 10. Iron-bearing Melts -- I. Physical Properties 10.1 Ferrous and Ferric Iron10.2. Phase Equilibria; 10.3. Iron Redox Reactions; 10.4. Physical Properties; 10.5. Summary Remarks; References; Chapter 11. Iron-bearing Melts -- II. Structure; 11.1. Ferric Iron; 11.2. Ferrous Iron; 11.3. Ferric and Ferrous Iron in Silicate Melts at High Temperature; 11.4. Iron in Silicate Melts and Glasses at High Pressure; 11.5. Summary Remarks; References; Chapter 12. The Titanium Anomalies; 12.1. Phase Relations and Glass Formation; 12.2. Physical Properties; 12.3. Structure of Titanosilicate Glasses and Melts; 12.4. High-Temperature Studies

Note: Table of contents Part 1: Introduction and Key Concepts 1: Introduction to Planetary Health 2: Key Concepts in Planetary Health Part 2: Conceptual Frameworks for Planetary Health 3: The Evolutionary Biology Approach: a Natural Baseline for Human Health 4: The Natural Capital Approach: Opportunities and Challenges 5: The One Earth Approach: Planetary Health in an Era of Limits 6: The Transhuman Approach: Technoscience and Nature Part 3: Human Health in an Era of Global Environmental Change 7: Trends in Human Health 8: The Demographic Transition 9: The Epidemiological Transition 10: The Ecological Transition 11: Agriculture: Land Use, Food Systems and Biodiversity 12: Urbanization, Living Standards and Sustainability 13: Energy Use, Greenhouse Gas Emissions and Global Warming 14: Environmental Protection: a Key Tool for Planetary Health 15: Conclusions: Equity, Distribution and Planetary Health Part 4: Case Studies of Planetary Health 16: Climate Change, Land Use and Waterborne Infectious Disease 17: Sanitation, Clean Energy and Fertilizer 18: Trees, Well-being and Urban Greening 19: Livestock, Antibiotics and Greenhouse Gas Emissions

Note: Contents Preface Acknowledgement Gold Supporters Silver Supporters I Introduction Why OpenDroneMap? What You Can Do with OpenDroneMap The Key To Becoming a Successful User II Getting Started Installing The Software Hardware Requirements Installing on Windows Installing on macOS Installing on Linux Basic Commands and Troubleshooting Hello, WebODM! Processing Datasets Dataset Size File Requirements Process Tasks Output Results Share With Others Export To Another WebODM Manage Plugins Change The Look & Feel Create New Users Manage Permissions How Does WebODM Process Images? The Processing Pipeline Load Dataset Structure From Motion Multi View Stereo Meshing Texturing Georeferencing Digital Elevation Model Processing Orthophoto Processing Task Options in Depth build-overviews cameras crop debug dem-decimation dem-euclidean-map dem-gapfill-steps dem-resolution depthmap-resolution dsm dtm end-with fast-orthophoto gcp help ignore-gsd matcher-distance matcher-neighbors max-concurrency merge mesh-octree-depth mesh-point-weight mesh-samples mesh-size min-num-features mve-confidence opensfm-depthmap-method opensfm-depthmap-min-patch-sd orthophoto-bigtiff orthophoto-compression orthophoto-cutline orthophoto-no-tiled orthophoto-resolution pc-classify pc-csv pc-ept pc-filter pc-las rerun rerun-all rerun-from resize-to skip-3dmodel sm-cluster smrf-scalar smrf-slope smrf-threshold smrf-window split split-overlap texturing-data-term texturing-keep-unseen-faces texturing-nadir-weight texturing-outlier-removal-type texturing-skip-global-seam-leveling texturing-skip-hole-filling texturing-skip-local-seam-leveling texturing-skip-visibility-test texturing-tone-mapping time use-3dmesh use-exif use-fixed-camera-params use-hybrid-bundle-adjustment use-opensfm-dense verbose version Ground Control Points Creating a GCP file using POSM GCPi Using GCP files How GCP files work Flying Tips Fly Higher Fly on Overcast Days Fly Between 10am and 2pm Fly at Different Elevations and Capture Multiple Angles Fly on Calm Days Increase Overlap Set Drone to Hover While Taking Images Check Camera Settings III Advanced Usages The Command Line Command Line Basics Using ODM Processed Files Owned By Root Add New Processing Nodes to WebODM Batch Geotagging of Images Using Exiftool Further Readings Docker Essentials Docker Basics Managing Containers Managing Images Managing Volumes Docker-Compose Basics Managing Disk Space Changing Entrypoint Assigning Names To Containers Jumping Into Existing Containers Making Changes Without Rebuilding Images Camera Calibration Option 1: Use an Existing Camera Model Option 2: Generate a Camera Model From a Calibration Target Taking Pictures of a Calibration Target Extracting a Camera Profile Manually Writing a cameras.json File Bonus: Checking Your LCP File by Manually Removing Geometric Distortion Processing Large Datasets Split-Merge Options Local Split-Merge Distributed Split-Merge Using Image Groups and GCPs Limitations The NodeODM API Launching a NodeODM Instance NodeODM Configuration Using the API with cURL Remove a Task API Specification Automated Processing With Python Getting Started Example 1: Hello NodeODM Example 2: Process Datasets Concluding Remarks API Reference Glossary About the Author

Note: Contents 1 The Conifers Conifer Taxonomy Geographic Distribution and Biogeography Life History Ecological Tolerance Conifer Mating System, Life Cycle, and Reproduction The Largest, Tallest, and Oldest Organisms on the Planet Genetic Diversity Summary Part I Genomes 2 Genomes: Classical Era The Beginnings of Genome Research in Conifers Chromosome Number and Polyploidy Genome Size Karyotype Analysis Genome Content Organelle Genomes: Chloroplast and Mitochondria Size and Structure Gene Content Inheritance Variation Summary 3 Gene and Genome Sequencing in Conifers: Modern Era A Short History of DNA Sequencing in Conifers Expressed Sequence Tag Sequencing Gene Discovery Using Next-Generation Sequencing Conifer Reference Genome Sequences Sequencing, Assembly, and Annotation Strategies Summary Statistics of Published Conifer Genome Sequences Discovery of the Noncoding DNA Content of Conifer Genomes Discovery of the Number and Types of Coding Genes in Conifers Chloroplast and Mitochondrial Genome Sequencing Summary 4 Noncoding and Repetitive DNA Introduction Ribosomal DNA Tandem Repeats: Satellite, Minisatellite, and Microsatellite DNA Transposons and Retrotransposons Pseudogenes Summary 5 Gene Structure and Gene Families A Short History of Early Conifer Gene Sequencing Wood-Forming Genes Vegetative Growth Genes Floral Genes Light-Regulated Genes Defense-Related Genes Disease-Resistant Genes Summary 6 Gene Expression and the Transcriptome A Short History of Gene Expression Studies in Conifers Wood Formation Biotic Factors Abiotic Factors Seasonal Patterns Epigenetic Control of Gene Expression Summary 7 Proteomics and Metabolomics A Short History of Proteomic and Metabolomic Research in Conifers Wood Formation Biotic Factors Abiotic Factors Seed Development and Somatic Embryogenesis Summary Part II Variation 8 Phenotypic Variation in Natural Populations Introduction Definitions Terms for Describing the Identity of Experimental Plant Materials: Provenance, Population, Seed Source, and Accession Terms for Describing Patterns of Genetic Variation on the Natural Landscape: Cline, Race, and Ecotype Historical Perspectives Application of Common Garden Experiments Experimental Approaches and Analytical Methods Experimental Approaches Analytical Methods Dependent and Independent Variables Common Garden Testing Literature Amount, Distribution, and Pattern of Genetic Variation in Phenotypic Traits of Conifers Amount and Distribution of Genetic Variation Patterns of Variation Are Local Sources Best? Case Studies Pseudotsuga menziesii (Douglas-fir) Pinus Summary 9 Neutral Genetic Variation Introduction and Background Molecular Markers Used in the Study of Neutral Variation Three Conifer Genomes Purpose and Applications of Neutral Genetic Variation Studies General Diversity Results: Allozymes Variation Within Species Variation Within Populations Distribution of Variation Among Populations (Based on Polymorphic Loci only) Differences in Measures of Diversity Among Conifer Genera and Families Allozyme Summary General Diversity Results: Molecular Markers Organelle Markers Nuclear Markers Population Differentiation Factors Affecting Amount and Distribution of Genetic Variation Mating Systems Gene Flow Genetic Drift Case Studies Diversity, Population Structure, and Biogeography Conservation and Mating Systems Effects of Forest Management and Tree Improvement on Genetic Diversity Summary 10 Adaptive Genetic Variation A Short History of Adaptive Genetic Variation in Conifers General Trends in Patterns of Adaptive Genetic Diversity in Conifers Observed from Neutrality and FST Outlier Tests Detection of Nonneutral Genes in a Few Conifer Species Pinus taeda Pinus sylvestris Pinus mugo, P. uncinata, and P. uliginosa Pinus pinaster and P. halepensis Pinus radiata Pinus contorta Pinus massoniana and P. hwangshanensis Pinus lambertiana and Other Subgenus Strobus Species Pseudotsuga menziesii Larix Species Abies Species Picea Species Cryptomeria japonica and Taxodium distichum Summary 11 Quantitative Trait Dissection A Short History of Complex Trait Dissection in Conifers Pinus taeda Pinus elliottii Pinus radiata Pinus sylvestris Pinus pinaster Pinus contorta Pseudotsuga menziesii Picea ssp. Larix ssp. Cryptomeria japonica Summary 12 Landscape Genomics A Short History of Landscape Genomics Studies in Conifers Pinus Subgenus Pinus Pinus Subgenus Strobus Picea Abies and Larix Summary 13 Conservation Genetics A Brief Introduction to Conservation Genetics in Forestry Fragmentation Habitat Loss Forest Practice Disease Insects Climate Change Summary 14 Forest Health Introduction The Growing Relevance of Forest Health Genetic Variation in Forest Health Traits Insects and Disease Abiotic Stress Mechanisms of Resistance and Tolerance Case Studies Resistance to Pissodes strobi (White Pine Weevil) Found in Picea sitchensis (Sitka spruce) Resistance to an Introduced Pathogen (Phytophthora lateralis) in Chamaecyparis lawsoniana (Port-Orford-cedar) Resistance to Stem Rusts in North American White Pines and Southern Yellow Pines Summary Part III Evolution 15 Hybridization and Introgression Introduction Definitions and Background Definitions Background Approaches to Identifying Hybrids and Quantifying Levels of Introgression Evolving Insights Case Studies of Introgressive Hybridization in Conifers Pinus contorta (Lodgepole Pine) x P. banksiana (Jack Pine) Picea sitchensis (Sitka Spruce) x P. glauca (White Spruce) and P. engelmannii (Engelmann Spruce) x P. glauca Pinus taeda (Loblolly Pine) x P. echinata (Shortleaf Pine) Hybrid Speciation Artificial Hybrids Summary 16 Paleobotany, Taxonomic Classification, and Phylogenetics Introduction Paleobotany Taxonomic Classification Cupressus Pinus Phylogenetics Character Selection The Conifers and Related Gymnosperms Araucariaceae Cupressaceae Pinaceae Podocarpaceae Sciadopityaceae Taxaceae Summary 17 Comparative Genomics Introduction to Comparative Genomics Comparative Mapping Comparative Gene Content and Transcriptomics Comparative Genome Sequences Summary 18 Historical Perspective and Future Directions in Forest Genetics and Genomics Historical Perspective Current Situation Future Directions Primary Commercial Species (Group A) Appendix 1 Appendix 2 References Index

Note: Vorwort 1. Rationalität in Politik und Wirtschaft 2. Worum geht es in der Rational–Choice–Theorie? 3. Methodologische Defekte 4. Das Paradox der Wahlbeteiligung 5. Soziale Dilemmata und das Trittbrettfahrerproblem 6. Gesetzgebung und Abstimmungsparadox 7. Räumliche Theorien des politischen Wettbewerbs 8. Erwiderungen auf mögliche Gegenargumente Literatur Index