ALBERT

Note: Contents: I Grundlegungen und Orientierungen ; 1. Grundlegungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; 2. Orientierungen im Themenfeld Geschlechterverhältnisse und Nachhaltigkeit ; II Forschungs- und Handlungsfelder der Nachhaltigkeitswissenschaften und -politik ; 1. Einführung ; 2. Wissenschaft und Forschung ; 3. Wirtschaften und Arbeiten ; 4. Raumentwicklung ; 5. Mobilität ; 6. Klimawandel und -politik ; 7. Ressourcenpolitik und Infrastruktur ; 8. Natur und Landschaft ; 9. Konsum- und Lebensstile ; 10. Zeit(en) ; 11. Governance, Partizipation, Empowerment ; III Fazit - Die Kategorie Geschlecht: Neue Perspektiven für die Nachhaltigkeitswissenschaften

Note: The Application of IR Spectroscopy to the Investigation of MineralsThe Discrete Approach -- The Full-Profile Analysis -- Polymerization of coordination polyhedra and structure topology -- Hydrogen-bearing groups and hydrogen bonding -- Solid-solution series -- Force parameters of cations in silicates -- IR spectra of minerals and reference samples data -- Borates, including sulfato-borates and arsenato-borates -- Carbides and carbonates -- Organic compounds and salts of organic acids -- Ammino-complexes, nitrates and sulfato-nitrates -- Oxides and hydroxides -- Fluorides -- Silicates -- Phosphates -- Sulfates, carbonato-sulfates, phosphato-sulfates and sulfides -- Chlorides -- Vanadates and vanadium oxides -- Chromates -- Arsenates, arsenites and sulfato-arsenates -- Selenites, molybdates, tellurites, tellurates, iodites, wolframates and wolfram oxides..

Note: 1 Introduction Acknowledgments 2 Why we use Jupyter notebooks 2.1 Why do we use Jupyter? 2.2 But first, what is Jupyter Notebook? 2.3 Course benefits & anecdotes 2.4 Student benefits 2.5 Instructor benefits 2.6 Conclusions 3 Notebooks in teaching and learning 3.1 Oh the places your notebooks will go! 3.2 Before You Begin… 4 A catalogue of pedagogical patterns 4.1 Introduction 4.2 Shift-Enter for the win 4.3 Fill in the blanks 4.4 Target Practice 4.5 Twiddle, tweak, and frob 4.6 Notebook as an app 4.7 Win-day-one 4.8 Top-down sequence 4.9 Two bites at every apple 4.10 Coding as translation 4.11 Symbolic math over pencil + paper 4.12 Replace analysis with numerical methods 4.13 The API is the lesson 4.14 Proof by example, disproof by counterexample 4.15 The world is your dataset 4.16 Now you try (with different data or process) 4.17 Connect to external audiences 4.18 There can be only one 4.19 Hello, world! 4.20 Test driven development 4.21 Code reviews 4.22 Bug hunt 4.23 Adversarial programming 5 Jupyter Notebook ecosystem 5.1 Language support: kernels 5.2 Using Jupyter notebooks 5.3 Authoring Jupyter notebooks 5.4 Tips and tricks 5.5 Gotchas 6 Getting your class going with Jupyter 6.1 Local installation on students’ or lab computers 6.2 Jupyter on remote servers 6.3 Distribution and collection of materials 6.4 Assessing student learning with Jupyter notebooks 6.5 How do you create Jupyter notebooks for reuse and sharing? 6.6 Jupyter: a 21st Century genre of Open Educational Resources and practices 7 Usage case studies 7.1 Jupyter notebooks in support of scaling for large enrollments 7.2 The “CFD Python” story: guiding learners at their own pace 7.3 Analyzing music with music21 7.4 Interactivity in computer science (high school and middle school) 7.5 Interactive geophysics with Jupyter 7.6 Investigating hurricanes 8 About the authors 8.1 Project lead 8.2 Authors at the sprint 9 Glossary References

Note: Table of Contents Introduction: Thermokarst Lakes of Western Siberia as Dominant Forms of Landscape and Regulators of Greenhouse Gas Exchange with the Atmosphere Chapter 1. Thermokarst Lakes: Distribution, Cycle of Development, Surface Coverage and Evolution Chapter 2. Sources of Dissolved Components in Thermokarst Lakes Chapter 3. Temperature and Gas Regime Chapter 4. Dissolved Organic Carbon Chapter 5. Microbiology of Thermokarst Lake Systems Chapter 6. Trace Elements in Thermokarst Lakes Chapter 7. Colloids in Thermokarst Lakes Chapter 8. Latitude Profile Gradients of Lakes: Substituting Space for Time Chapter 9. Possible Impact of Climate Warming on Stocks and Fluxes of Carbon and Related Elements in Western Siberian Lakes Conclusions: Thaw Lakes as Indicators of Climate Change References Index

Note: Ecotones Between Forest and Grassland; Preface; Contents; Contributors; Chapter 1: Introduction; 1.1 Rationale; 1.2 Case Study: The Cross Timbers; 1.3 About This Book; References; Part I: Temperate Forest-Grassland Ecotones: Prairies, Steppes, and Pampas; Chapter 2: Woodland-Grassland Ecotonal Shifts in Environmental Mosaics: Lessons Learnt from the Environmental History of the Carpathian Basin (Central Europe) During the Holocene and the Last Ice Age Based on Investigation of Paleobotanical and Mollusk Remains; 2.1 Introduction. , 2.2 Modern Woodland-Grassland Ecotone in the Carpathian Basin and Controversies Around Definitions2.3 Profiles Selected and Methods Applied in Modeling Woodland-Grassland Ecotone Shifts in the Carpathian Basin; 2.3.1 The Climate-Zonal Hypothesis Put to the Test; 2.3.2 Testing the Model of Edaphic Ecological Factors; 2.3.3 Testing the Idea of Human-Induced Ecotone Development; 2.4 The Vegetation History of the Great Hungarian Plains as Inferred from the Evaluation of Quaternary Paleoecological and Environmental Historical Data; 2.4.1 Vegetation Development During Last Ice Age. , 2.4.2 Vegetation Development During the Terminal Part of the Last Ice Age2.4.3 Vegetation Development During the Pleistocene/Holocene Transition; 2.4.4 Vegetation History of the Carpathian Basin from the Settlement of the First Farmers; 2.5 Summary; References; Chapter 3: Ecotones as Complex Arenas of Disturbance, Climate, and Human Impacts: The Trans-Andean Forest-Steppe Ecotone of Northern Patagonia; 3.1 Introduction; 3.2 Physical and Biological Setting of Forest-Steppe Ecotone of Northern Patagonia; 3.2.1 Abiotic Transition; 3.2.2 Ecosystem Properties Across the Transition. , 3.2.3 Plant Communities and Plant Diversity Across the Transition3.3 Disturbance Variation and Forest Dynamics Across the Transition; 3.3.1 Fine-Scale Disturbances; 3.3.2 Coarse-Scale Disturbances; 3.4 Direct and Disturbances-Mediated In fl uences of Climate Variability Across the Transition; 3.5 Climate, Fire, Land Use, and Long-Term Vegetation Changes Across the Transition; 3.5.1 Xeric Steppe-Woodland Belt; 3.5.2 The Nothofagus Forest-Shrubland Belt; 3.5.3 The Wet Rainforest Belt; 3.6 Conclusions; References; Chapter 4: Woody-Herbaceous-Livestock Species Interaction; 4.1 Introduction. , 4.2 Woody-Herbaceous Species Interactions and Associated Models4.3 Woodland and Grassland Stable States and Conceptual Models; 4.4 Woody-Herbaceous Ecotones; 4.5 Rates and Patterns of Woody-Herbaceous Ecotone Shift; 4.6 Woody-Herbaceous-Livestock Species Dynamics; 4.7 Other Potential Factors In fl uencing Woody-Herbaceous Species Dynamics; 4.8 Current and Future Research on Woody-Herbaceous-Livestock Species Interaction; References; Chapter 5: Woody Plant Invasions in Pampa Grasslands: A Biogeographical and Community Assembly Perspective; 5.1 Introduction. , 5.2 Woody Invasions as Hierarchical Assembly Processes.

Note: 1. Legends of unusual phenomena before earthquakeswisdom or superstition? -- 2. Precursors before recent earthquakes -- Kobe, Izmit, Taiwan and India -- 3. Earth sciences and electromagnetism -- 4. Unusual animal behavior : I -- what do they detect? -- electric field effects -- 5. Unusual animal behavior : II -- rock compression and increased animal activity -- 6. Unusual plant responses before earthquakes -- 7. Atmospheric precursors -- earthquake light, clouds, sun, moon, stars and rainbows -- 8. Precursor phenomena -- on land, sea and elsewhere -- 9. Mysteries before earthquakes : the behavior of electric appliances -- 10. Forecasting using animal monitoring -- 11. Monitoring seismo-electromagnetic signals (SEMS) -- a general survey -- 12. Summary..

Note: CONTENTS; List of Figures; List of Tables; List of Contributors; Introduction; PART I: ECONOMISTS ON TRIAL; 1. Who predicted the crisis and what can we learn from them? ; 2 A brief note on economic recessions, banking reform and the future of capitalism; 3 Understanding crisis: on the meaning of uncertainty and probability; 4 Financial crisis and risk measurement: the historical perspective and a new methodology; 5 Did economic analysis fail in the current financial crisis?; PART II: WHAT DOES HISTORY TELL US? ; 6 Does the current global crisis remind us of the Great Depression?. , 7 Innovation, growth, cycles and finance: three (or four or more) stories from the 1930s and their lessons8 Epic Recession and economic theory; 9 Did asset prices cause the current crisis?; 10 The role of the history of economic thought in the development of economic theory and policy; PART III: COUNTRY CASES IN A GLOBAL CRISIS; 11. Testimony to the Financial Crisis Inquiry Commission by Alan Greenspan; 12 Long-term depression and new markets: economists and the 2008 recession; 13 Manifestations of the global crisis in a small open economy. , 14 The aftermath of a long decade of real nil interest rates (Spain 1996-2008)Index.

Note: Front Cover; Contents; Preface; 1. What's Vis, and Why Do It?; 2. What: Data Abstraction; 3. Why: Task Abstraction; 4. Analysis: Four Levels for Validation; 5. Marks and Channels; 6. Rules of Thumb; 7. Arrange Tables; 8. Arrange Spatial Data; 9. Arrange Networks and Trees; 10. Map Color and Other Channels; 11. Manipulate View; 12. Facet into Multiple Views; 13. Reduce Items and Attributes; 14. Embed: Focus+Context; 15. Analysis Case Studies; Figure Credits; Bibliography.

Note: German

Note: Inhalt Zu diesem Buch Begriffsklärungen 1. Kompetenzfelder 2. Information und Kommunikation 3. Techniken, Methoden, Werkzeuge etc A Umfassende Kommunikationsmodelle 1. Das Modell von Paul Watzlawick 1.1 Die systemtheoretische Grundlage 1.2 Die fünf Kommunikationsregeln Literatur 2. Die Transaktionsanalyse 2.1 Analyse der Persönlichkeitsstruktur 2.2 Analyse von Transaktionen 2.3 Die vier menschlichen Grundeinstellungen 2.4 Die Spielanalyse Literatur 3. Das Modell von Friedemann Schulz von Thun 3.1 Die vier Seiten einer Nachricht 3.2 Die vier Ohren des Empfängers Literatur 4. Das Modell von Thomas Gordon 4.1 Die Führungskraft als Problemlöser 4.2 Senden von Ich-Botschaften 4.3 Das Lösen von Führungsproblemen Literatur 5. Systemische Gesprächsführung 5.1 Ziel der systemischen Gesprächsführung 5.2 Regeln systemischer Gesprächsführung 5.3 Typische Schritte im Prozess einer systemischen Beratung Literatur 6. Neuro-Linguistisches Programmieren (NLP) 6.1 Zum Hintergrund des Namens 6.2 Zweck und Anwendungsbereiche des NLP 6.3 Schlüsselbegriffe und Kerntechniken 6.4 Regeln zur Kommunikationsverbesserung Literatur 7. Themenzentrierte Interaktion (TZI) 7.1 Die drei Faktoren der TZI 7.2 Die drei Axiome der TZI 7.3 Die Postulate der TZI 7.4 Die Hilfsregeln der TZI Literatur B Teilaspekte der Kommunikation 1. Fragetechniken 1.1 Funktionen von Fragen 1.2 Frageformen 1.3 Regeln für ein richtiges Frageverhalten Literatur 2. Zuhörtechniken 2.1 Zuhören als persönliche Arbeitstechnik 2.2 Passives Zuhören 2.3 Aktives Zuhören 2.4 Kommunikationsfördernde Zuhörtechniken 2.5 Analytisches Zuhören Literatur 3. Feedback 3.1 Sinn und Zweck des Feedbacks 3.2 Die Ausgangssituation 3.3 Feedback richtig geben Literatur 4. Körpersprache 4.1 Hintergrund und Wirkungsweise der Körpersprache 4.2 Interpretation der Körpersprache 4.3 Körpersprache im Gespräch und bei Verhandlungen Literatur 5 Gesprächsführung 5.1 Grund und Ziel von Gesprächen 5.2 Organisatorische Vorbereitungen 5.3 Gesprächsdurchführung Literatur C Besondere Kommunikationszwecke 1. Rhetorik 1.1 Tipps zur Sprache 1.2 Tipps zur inhaltlichen Gestaltung Literatur 2. Präsentation und Mediennutzung 2.1 Die Vorbereitung 2.2 Die Durchführung 2.3 Die Medien Literatur 3. Lehrmethoden 3.1 Dozentenorientierte Methoden 3.2 Teilnehmerorientierte Methoden Literatur 4. Die Moderationsmethode 4.1 Der Moderator 4.2 Visualisierung 4.3 Frage- und Antworttechniken 4.4 Die Moderation Literatur 5. Diskussions- und Konferenztechniken 5.1 Vorbereitung der Diskussion bzw. Konferenz 5.2 Gestaltung der Diskussion bzw. Konferenz 5.3 Diskussions- und Konferenzmethoden Literatur 6. Die Fünfsatztechnik 6.1 Grundstruktur des Fünfsatzes 6.2 Fünfsatzformen Literatur 7. Verhandlungstechniken 7.1 Grundaspekt Nr. 1: Menschen und Probleme trennen 7.2 Grundaspekt Nr. 2: Auf Interessen statt auf Positionen konzentrieren 7.3 Grundaspekt Nr. 3: Entscheidungsmöglichkeiten mit Vorteilen für beide Seiten entwickeln 7.4 Grundaspekt Nr. 4: Neutrale Kriterien zur Ergebnisbewertung entwickeln 7.5 Mit Widerstand umgehen Literatur 8. Argumentationstechniken 8.1 Signalwörter für Prämissen und Konklusionen 8.2 Regeln für gekonntes Argumentieren 8.3 Typische Argumentationsmuster Literatur 9. Open Space 9.1 Die Prinzipien des Open Space 9.2 Empfehlungen für Open Space Literatur 10. Mediation 10.1 Grundlagen 10.2 Die acht Phasen des Mediationsprozesses 10.3 Das Harvard-Konzept als Mediationsvariante Literatur 11. Wirkungsvoll schreiben 11.1 Die Vorbereitungen 11.2 Methoden zum Strukturieren eines Textes 11.3 Auf die Feinheiten achten Literatur 12. Empfängerorientiert korrespondieren 12.1 Regel Nr. 1: Schreiben Sie in kurzen Sätzen 12.2 Regel Nr. 2: Setzen Sie Tätigkeitswörter (Verben) ein 12.3 Regel Nr. 3: Meiden Sie „Hauptwortzusammen-setzungen" 12.4 Regel Nr. 4: Gehen Sie im ersten Satz positiv auf den Adressaten ein 12.5 Regel Nr. 5: Setzen Sie den Sie-Stil ein 12.6 Regel Nr. 6: Gliedern und ordnen Sie Zahlen und Daten übersichtlich 12.7 Regel Nr. 7: Steigern Sie die Anschaulichkeit Ihrer Aussagen 12.8 Regel Nr. 8: Formulieren Sie mit Aktiv-Konstruktionen 12.9 Regel Nr. 9: Drücken Sie sich knapp und präzise aus 12.10 Regel Nr. 10: Aktivieren Sie im Schlusssatz den Empfänger Literatur 13. Das Verkaufsgespräch 13.1 Phase Nr. 1: Kontakt schaffen 13.2 Phase Nr. 2: Bedarf ermitteln 13.3 Phase Nr. 3: Produkt präsentieren 13.4 Phase Nr. 4: Argumentieren 13.5 Phase Nr. 5: Gelungen abschließen Literatur 14. Das Mitarbeitergespräch 14.1 Das richtige Kommunikationsverhalten im Mitarbeitergespräch 14.2 Kooperation statt Konfrontation: Das richtige Verhalten im Kritikgespräch Literatur 15. Das Bewerbergespräch 15.1 Phasen eines Bewerbergespräches 15.2 Interviewformen 15.3 Fragen im Bewerbergespräch Literatur Stichwortverzeichnis

Note: Contents Contents Preface Acknowledgements Part 1: Making Sediment Introduction Clastic sediment as a chemical and physical breakdown product 1.1 Introduction: clastic sediments—'accidents' of weathering 1.2 Silicate minerals and chemical weathering 1.3 Solute flux: rates and mechanisms of silicate chemical weathering 1.4 Physical weathering 1.5 Soils as valves and filters for the natural landscape 1.6 Links between soil age, chemical weathering and weathered-rock removal 1.7 Provenance: siliciclastic sediment-sourcing Further reading 2 Carbonate, siliceous, iron-rich and evaporite sediments 2.1 Marine vs. freshwater chemical composition and fluxes 2.2 The calcium carbonate system in the oceans 2.3 Ooid carbonate grains 2.4 Carbonate grains from marine plants and animals 2.5 Carbonate muds, oozes and chalks 2.6 Other carbonate grains of biological origins 2.7 Organic productivity, sea-level and atmospheric controls of biogenic CaCO3 deposition rates 2.8 CaCO3 dissolution in the deep ocean and the oceanic CaCO3 compensation mechanism 2.9 The carbonate system on land 2.10 Evaporite salts and their inorganic precipitation as sediment 2.11 Silica and pelagic plankton 2.12 Iron minerals and biomineralizers 2.13 Desert varnish 2.14 Phosphates 2.15 Primary microbial-induced sediments: algal mats and stromatolites Further reading 3 Sediment grain properties 3.1 General 3.2 Grain size 3.3 Grain-size distributions 3.4 Grain shape and form 3.5 Bulk properties of grain aggregates Further reading Part 2: Moving Fluid Introduction 4 Fluid basics 4.1 Material properties of fluids 4.2 Fluid kinematics 4.3 Fluid continuity with constant density 4.4 Fluid dynamics 4.5 Energy, mechanical work and power Further reading 5 Types of fluid motion 5.1 Osborne Reynolds and flow types 5.2 The distribution of velocity in viscous flows: the boundary layer 5.3 Turbulent flows 5.4 The structure of turbulent shear flows 5.5 Shear flow instabilities, flow separation and secondary currents 5.6 Subcritical and supercritical flows: the Froude number and hydraulic jumps 5.7 Stratified flow generally 5.8 Water waves 5.9 Tidal flow—long-period waves Further reading Part 3: Transporting Sediment Introduction 6 Sediment in fluid and fluid flow—general 6.1 Fall of grains through stationary fluids 6.2 Natural flows carrying particulate material are complex 6.3 Fluids as transporting machines 6.4 Initiation of grain motion 6.5 Paths of grain motion 6.6 Categories of transported sediment 6.7 Some contrasts between wind and water flows 6.8 Cohesive sediment transport and erosion 6.9 A warning: nonequilibrium effects dominate natural sediment transport systems 6.10 Steady state, deposition or erosion: the sediment continuity equation and competence vs. capacity Further reading 7 Bedforms and sedimentary structures in flows and under waves 7.1 Trinity of interaction: turbulent flow, sediment transport and bedform development 7.2 Water-flow bedforms 7.3 Bedform phase diagrams for water flows 7.4 Water flow erosional bedforms on cohesive beds 7.5 Water wave bedforms 7.6 Combined flows: wave-current ripples and hummocky cross-stratification 7.7 Bedforms and structures formed by atmospheric flows Further reading 8 Sediment gravity flows and their deposits 8.1 Introduction 8.2 Granular flows 8.3 Debris flows 8.4 Turbidity flows 8.5 Turbidite evidence for downslope transformation from turbidity to debris flows Further reading 9 Liquefaction, fluidization and sliding sediment deformation 9.1 Liquefaction 9.2 Sedimentary structures formed by and during liquefaction 9.3 Submarine landslides, growth faults and slumps 9.4 Desiccation and synaeresis shrinkage structures Further reading Part 4: Major External Controls on Sedimentation and Sedimentary Environments Introduction 10 Major external controls on sedimentation 10.1 Climate 10.2 Global climates: a summary 10.3 Sea-level changes 10.4 Tectonics 10.5 Sediment yield, denudation rate and the sedimentary record Further reading Part 5: Continental Sedimentary Environments Introduction 11 Rivers 11.1 Introduction 11.2 River networks, hydrographs,patterns and long profiles 11.3 Channel form 11.4 Channel sediment transport processes, bedforms and internal structures 11.5 The floodplain 11.6 Channel belts, alluvial ridges and avulsion 11.7 River channel changes, adjustable variables and equilibrium 11.8 Alluvial architecture: product of complex responses 11.9 Alluvial architecture: scale, controls and time Further reading 12 Subaerial Fans: Alluvial and Colluvial 12.1 Introduction 12.2 Controls on the size (area) and gradient of fans 12.3 Physical processes on alluvial fans 12.4 Debris-flow-dominated alluvial fans 12.5 Stream-flow-dominated alluvial fans 12.6 Recognition of ancient alluvial fans and talus cones Further reading 13 Aeolian Sediments in Low-Latitude Deserts 13.1 Introduction 13.2 Aeolian system state 13.3 Physical processes and erg formation 13.4 Erg margins and interbedform areas 13.5 Erg and draa evolution and sedimentary architecture 13.6 Erg construction, stasis and destruction: climate and sea-level controls 13.7 Ancient desert facies Further reading 14 Lakes 14.1 Introduction 14.2 Lake stratification 14.3 Clastic input by rivers and the effect of turbidity currents 14.4 Wind-forced physical processes 14.5 Temperate lake chemical processes and cycles 14.6 Saline lake chemical processes and cycles 14.7 Biological processes and cycles 14.8 Modern temperate lakes and their sedimentary facies 14.9 Lakes in the East African rifts 14.10 Lake Baikal 14.11 The succession of facies as lakes evolve 14.12 Ancient lake facies Further reading 15 Ice 15.1 Introduction 15.2 Physical processes of ice flow 15.3 Glacier flow, basal lubrication and surges 15.4 Sediment transport, erosion and deposition by flowing ice 15.5 Glacigenic sediment: nomenclature and classification 15.6 Quaternary and modern glacial environments and facies 15.7 Ice-produced glacigenic erosion and depositional facies on land and in the periglacial realm 15.8 Glaciofluvial processes on land at and within the ice-front 15.9 Glacimarine environments 15.10 Glacilacustrine environments 15.11 Glacial facies in the pre-Quaternary geological record: case of Cenozoic Antarctica Further reading Part 6: Marine Sedimentary Environments Introduction 16. Estuaries 16.1 Introduction 16.2 Estuarine dynamics 16.3 Modern estuarine morphology and sedimentary environments 16.4 Estuaries and sequence stratigraphy Further reading 17. River and Fan Deltas 17.1 Introduction to river deltas 17.2 Basic physical processes and sedimentation at the river delta front 17.3 Mass movements and slope failure on the subaqueous delta 17.4 Organic deposition in river deltas 17.5 River delta case histories 17.6 River deltas and sea-level change 17.7 Ancient river delta deposits 17.8 Fan deltas Further reading 18. Linear Siliciclastic Shorelines 18.1 Introduction 18.2 Beach processes and sedimentation 18.3 Barrier-inlet-spit systems and their deposits 18.4 Tidal flats, salt marsh and chenier ridges 18.5 Ancient clastic shoreline facies Further reading 19 Siliciclastic Shelves 19.1 Introduction: shelf sinks and lowstand bypass 19.2 Shelf water dynamics 19.3 Holocene highstand shelf sediments: general 19.4 Tide-dominated, low river input, highstand shelves 19.5 Tide-dominated, high river input, highstand shelves 19.6 Weather-dominated highstand shelves Further reading 20 Calcium-carbonate-evaporite Shorelines, Shelves and Basins 20.1 Introduction: calcium carbonate 'nurseries' and their consequences 20.2 Arid carbonate tidal flats, lagoons and evaporite sabkhas 20.3 Humid carbonate tidal flats and marshes 20.4 Lagoons and bays 20.5 Tidal delta and margin-spillover carbonate tidal sands 20.6 Open-shelf carbonate ramps 20.7 Platform margin reefs and carbonate build-ups 20.8 Platform margin slopes and basins 20.9 Carbonate sediments, cycles and sea-level change 20.10 Displacement and destruction of carbonate environments: silicicl

Note: Cover; Title Page; Copyright Page; Table of Contents; List of illustrations; Notes on contributors; Acknowledgements; 1 Socio-ecological transformations and the social sciences; PART I Challenges, contradictions and consequences of global socio-ecological change; 2 Ecological modernization theory: taking stock, moving forward; 3 The emergence of new world-systems perspectives on global environmental change; 4 China's economic growth and environmental protection: approaching a 'win-win' situation? A discussion of ecological modernization theory; 5 Eco-imperialism and environmental justice. , 6 Neoliberalism by design: changing modalities of market-based environmental governance7 Dilemmas for standardizers of sustainable consumption; PART II Climate change, energy and adaptation; 8 Climate, scenario-building and governance: comprehending the temporalities of social-ecological change; 9 From Rio to Copenhagen: multilateral agreements, disagreements and situated actions; 10 Marriage on the rocks: sociology's counsel for our struggling energy-society relationships; 11 Sustainability as social practice: new perspectives on the theory and policies of reducing energy consumption. , 12 Environmental migration: nature, society and population movementPART III Urban environmental change, governance and adaptation; 13 Climate change and urban governance: a new politics?; 14 Recovering the city level in the global environmental struggle: going beyond carbon trading; 15 Hybrid arrangements within the environmental state; 16 The new mobilities paradigm and sustainable transport: finding synergies and creating new methods; PART IV Risk, uncertainty and social learning; 17 Towards a socio-ecological foundation for environmental risk research. , 18 Uncertainty and claims of uncertainty as impediments to risk management19 Transboundary risk governance: co-constructing environmental issues and political solutions; 20 The role of professionals in managing technological hazards: the Montara blowout; 21 Social learning to cope with global environmental change and unsustainability; PART V (Re)assembling social-ecological systems; 22 The social-ecological co-constitution of nature through ecological restoration: experimentally coping with inevitable ignorance and surprise. , 23 Biological invasions as cause and consequence of 'our' changing world: social and environmental paradoxes24 Biological resources, knowledge and property; 25 Disassembling and reassembling socionatural networks: integrated natural resource management in the Great Bear Rainforest; 26 Land use tensions for the development of renewable sources of energy; Index.

Note: Berlin, Humboldt-Univ., Diss., 2011

Note: Vorwort; Inhaltsverzeichnis; 1 Einführung; 1.1 Grundlegende Begriffe; 1.2 Schutzziele; 1.3 Schwachstellen, Bedrohungen, Angriffe; 1.3.1 Bedrohungen; 1.3.2 Angriffs- undAngreifer-Typen; 1.3.3 Rechtliche Rahmenbedingungen; 1.4 ComputerForensik; 1.5 Sicherheitsrichtlinie; 1.6 Sicherheitsinfrastruktur; 2 Spezielle Bedrohungen; 2.1 Einführung; 2.2 Buffer-Overflow; 2.2.1 Einführung; 2.2.2 Angriffe; 2.2.3 Gegenmaßnahmen; 2.3 Computerviren; 2.3.1 Eigenschaften; 2.3.2 Viren-Typen; 2.3.3 Gegenmaßnahmen; 2.4 Würmer; 2.5 Trojanisches Pferd; 2.5.1 Eigenschaften; 2.5.2 Gegenmaßnahmen; 2.6 Bot-Netze undSpam. , 2.6.1 Bot-Netze2.6.2 Spam; 2.7 MobilerCode; 2.7.1 Eigenschaften; 2.7.2 Sicherheitsbedrohungen; 2.7.3 Gegenmaßnahmen; 2.7.4 MobileApps; 3 Internet-(Un-)Sicherheit; 3.1 Einführung; 3.2 Internet-Protokollfamilie; 3.2.1 ISO/OSI-Referenzmodell; 3.2.2 DasTCP/IP-Referenzmodell; 3.2.3 Das Internet-Protokoll IP; 3.2.4 DasTransmissionControlProtokoll TCP; 3.2.5 DasUserDatagramProtocolUDP; 3.2.6 DHCP und NAT; 3.3 Sicherheitsprobleme; 3.3.1 Sicherheitsprobleme von IP; 3.3.2 Sicherheitsprobleme von ICMP; 3.3.3 Sicherheitsprobleme vonARP; 3.3.4 Sicherheitsprobleme vonUDPundTCP. , 3.4 Sicherheitsprobleme vonNetzdiensten3.4.1 DomainNameService (DNS); 3.4.2 NetworkFileSystem(NFS); 3.4.3 WeitereDienste; 3.5 Web-Anwendungen; 3.5.1 World Wide Web (WWW); 3.5.2 Sicherheitsprobleme; 3.5.3 OWASPTop-TenSicherheitsprobleme; 3.6 Analysetools undSystemhärtung; 4 Security Engineering; 4.1 Entwicklungsprozess; 4.1.1 AllgemeineKonstruktionsprinzipien; 4.1.2 Phasen; 4.1.3 BSI-Sicherheitsprozess; 4.2 Strukturanalyse; 4.3 Schutzbedarfsermittlung; 4.3.1 Schadensszenarien; 4.3.2 Schutzbedarf; 4.4 Bedrohungsanalyse; 4.4.1 Bedrohungsmatrix; 4.4.2 Bedrohungsbaum; 4.5 Risikoanalyse. , 4.5.1 Attributierung4.5.2 Penetrationstests; 4.6 Sicherheitsarchitektur und Betrieb; 4.6.1 Sicherheitsstrategie undSicherheitsmodell; 4.6.2 Systemarchitektur undValidierung; 4.6.3 Aufrechterhaltung im laufenden Betrieb; 4.7 Sicherheitsgrundfunktionen; 4.8 Realisierung der Grundfunktionen; 4.9 Security Development Lifecycle (SDL); 4.9.1 Die Entwicklungsphasen; 4.9.2 Bedrohungs- und Risikoanalyse; 5 Bewertungskriterien; 5.1 TCSEC-Kriterien; 5.1.1 Sicherheitsstufen; 5.1.2 Kritik am Orange Book; 5.2 IT-Kriterien; 5.2.1 Mechanismen; 5.2.2 Funktionsklassen; 5.2.3 Qualität; 5.3 ITSEC-Kriterien. , 5.3.1 Evaluationsstufen5.3.2 Qualität und Bewertung; 5.4 Common Criteria; 5.4.1 Überblick über dieCC; 5.4.2 CC-Funktionsklassen; 5.4.3 Schutzprofile; 5.4.4 Vertrauenswürdigkeitsklassen; 5.5 Zertifizierung; 6 Sicherheitsmodelle; 6.1 Modell-Klassifikation; 6.1.1 Objekte undSubjekte; 6.1.2 Zugriffsrechte; 6.1.3 Zugriffsbeschränkungen; 6.1.4 Sicherheitsstrategien; 6.2 Zugriffskontrollmodelle; 6.2.1 Zugriffsmatrix-Modell; 6.2.2 RollenbasierteModelle; 6.2.3 Chinese-Wall Modell; 6.2.4 Bell-LaPadula Modell; 6.3 Informationsflussmodelle; 6.3.1 Verbands-Modell; 6.4 Fazit undAusblick. , 7 Kryptografische Verfahren.

Note: Machine generated contents note: Introduction Jan Aart Scholte; 1. Global governance, accountability and civil society Jan Aart Scholte; 2. Civil society and accountability of the United Nations Kerstin Martens; 3. The World Bank and democratic accountability: the role of civil society Alnoor Ebrahim and Steven Herz; 4. Civil society and IMF accountability Jan Aart Scholte; 5. Civil society and the WTO: contesting accountability Marc Williams; 6. Civil society and accountability in the Commonwealth Timothy M. Shaw and Pamela K. Mbabazi; 7. The organisation of the Islamic conference, accountability and civil society Saied Reza Ameli; 8. Civil society and patterns of accountability in the OECD Morten Ougaard; 9. Civil society and G8 accountability Peter I. Hajnal; 10. Structuring accountability: the Asia-Europe meeting Julie Gilson; 11. Civil society and accountability in global governance of climate change Peter Newell; 12. Civil society and accountability promotion in the global fund Carolyn Long and Nata Duvvury; 13. Accountability in private global governance: ICANN and civil society Mawaki Chango; 14. Civil society and the World Fair Trade Organisation: developing responsive accountability Heidi Ullrich; Conclusion Jan Aart Scholte..

Note: German

Note: Outline Abstract Keywords 1. Introduction 2. Methods 2.1. Sample collection 2.2. 234Th analyses 2.3. Particulate organic carbon analyses 3. Results 3.1. Hydrography 3.2. Nutrients 3.3. 234Th activities and POC concentrations 3.4. Trapped material 4. Discussion 4.1. Origins of 234Th/238U disequilibrium 4.2. Determining 234Th fluxes 4.3. Calibration of sediment trap with 234Th 4.4. Vertical flux of particulate organic carbon and the POC/234Thp ratio 5. Conclusion Acknowledgements References

Note: Dissertation

Note: IntroductionTheorising Norms -- Theorising Crime -- Agent-based Modelling -- The Environment and Social Norms -- Punishment and Social Norms -- Imitation and Social Norms -- Socially Situated Social Norms -- Internalisation and Social Norms -- Modelling Norms -- Delinquent Networks -- Social Construction of Knowledge -- Morality -- We-Intentionality -- Conclusion -- Index..

Note: Inhalt 1 Einleitung 2 Der erste Eindruck - Das Anmeldegespräch 2.1 Ein Beispiel 2.2 Die Raumsituation 2.3 Die Kommunikationssituation mit Kunden 2.3.1 Gast und Gastgeber 2.3.2 Wir kommunizieren ständig 2.3.3 Wie wirke ich auf andere? 2.3.4 Beziehungs- und Sachaspekt der Kommunikation 2.3.5 Rolleneinnahme und Gesamthaltung der Bibliothek 2.4 Die Gesprächssituation 2.4.1 Augenhöhe und Respekt 2.4.2 Einstellen auf verschiedene Gesprächspartner 2.4.3 Der Gesprächsverlauf 2.4.4 Verständlichkeit und Anschaulichkeit 2.4.5 Schwierige Situationen im Anmeldegespräch 2.5 Vertiefung 3 Professionell beraten - Das Auskunftsgespräch 3.1 Ein Beispiel 3.2 Verantwortung im Gespräch übernehmen - Rollenklarheit 3.3 Reden wir über das Gleiche? 3.4 Durch die Phasen des Gesprächs steuern 3.4.1 Kontakt aufnehmen 3.4.2 Die Ausgangsfrage stellen 3.4.3 Nachfragen 3.4.4 Absichern 3.4.5 Lösungen entwickeln und anbieten 3.4.6 Vereinbarung treffen 3.4.7 Verabschieden 3.5 Die richtigen Fragen stellen 3.6 Störungen in der Auskunftssituation und die Etablierung von Standards 3.7 Tipps im Auskunftsgespräch 3.8 Vertiefung 4 Schulungen und Führungen entwickeln 4.1 Ein Beispiel 4.2 Lerntheoretische Hintergründe 4.2.1 Das Gedächtnis: Wie merken wir uns etwas? 4.2.2 Lerntypen: Wer lernt wie? 4.2.3 Lernpyramide: Mit welchen Lernmethoden lernen wir am effektivsten? 4.2.4 Die Hirnforschung: Wie lernt unser Gehirn am besten? 4.3 Modelle der Didaktik 4.3.1 Instruktionsorientierte Didaktik 4.3.2 Kompetenzorientierte Didaktik 4.4 Die Rolle der Lehrenden 4.5 Auftragsklärung 4.6 Die Konzeptentwicklung in sechs Schritten 4.6.1 Mit der Zielgruppe beschäftigen 4.6.2 Lernziele entwickeln 4.6.3 Themen sammeln und sortieren 4.6.4 Methodik festlegen 4.6.5 Lernkreislauf entwickeln 4.6.6 Dramaturgie und Zeitplan festlegen 4.7 Methodenpool 4.8 Schwierige Situationen in Schulungen 4.9 Wir lernen weiter: Eine Methode für das Schulungsteam 4.10 Vertiefung 5 Schwierige Situationen mit Kunden bewältigen 5.1 Ein Beispiel 5.2 Der Hintergrund 5.2.1 Ebenen der Kommunikation 5.2.2 Vier Reaktionsmöglichkeiten 5.2.3 Der Teufelskreis in der Kommunikation 5.3 Was lässt manche Menschen schwierig werden? 5.3.1 Ein Beispiel 5.3.2 Menschliche Bedürfnisse und Aggressionen 5.3.3 Wie wir den Konflikt betrachten - verschiedene Konfliktebenen 5.4 Das Dilemma der guten Mitarbeiterin 5.5 Die Entschärfung der Situation 5.6 Formulierungstipps - kleines Glossar der hilfreichen Worte 5.7 Kommunikative Basics für schwierige Situationen 5.7.1 So tun als ob 5.7.2 Distanz wahren 5.7.3 Die Flucht nach vornantreten 5.7.4 Verlierer und Schein-Sieger 5.7.5 Eigene Irrtümer vermeiden 5.8 Fallbeispiele 5.8.1 Typologie nach Fritz Riemann 5.8.2 Fünf Fälle und Handlungsmöglichkeiten 5.9 Deeskalationsstrategien - wenn es ganz schwierig wird 5.10 Vertiefung 6 Beschwerdemanagement in Bibliotheken 6.1 Ein Beispiel 6.2 Was ist Beschwerdemanagement? 6.3 Die Komponenten eines Beschwerdemanagement-Systems 6.3.1 Beschwerdestimulierung 6.3.2 Beschwerdekanäle 6.3.3 Beschwerdeannahme 6.3.4 Beschwerdebearbeitung 6.3.5 Beschwerdereaktion 6.3.6 Beschwerdeauswertung 6.3.7 Beschwerdereporting (öffentlich) 6.4 Die Kommunikationssituation der Beschwerde 6.4.1 Worüber beschweren sich Kunden der Bibliothek? 6.4.2 Beschwerdeschreiben verstehen und beantworten 6.4.3 Unzufriedenheit und Schweregrad der Beschwerde 6.4.4 Die Entschärfung der Situation 6.4.5 Ein Gesprächsleitfaden für Beschwerdegespräche 6.4.6 Deeskalieren 6.4.7 Tipps für die Gesprächssituation 6.4.8 Mitarbeiter einbeziehen und schulen 6.5 Vertiefung 7 Kundenorientierung in der Bibliothek 7.1 Ein Beispiel 7.2 Was heißt Kundenorientierung in der Bibliothek? 7.3 Vom Nutzer zum Kunden 7.4 Von der Produkt- zur Kundenorientierung 7.5 Ein Gesamtkonzept zur Einführung von Kundenorientierung 7.6 Eins greift ins andere - Kundenzentrierung und Mitarbeiterorientierung 7.7 Gemeinsame Verhaltensstandards einführen 7.7.1 Was sind Leistungsstandards 7.7.2 Kontaktsituationen mit Kunden und mögliche Verhaltensstandards 7.8 Damit alle an einem Strang ziehen 7.9 Vertiefung 8 Sicher und gewandt auftreten 8.1 Ein Beispiel 8.2 Die eigene Einstellung 8.2.1 Persönliche Denkmuster 8.2.2 Innere Dialoge 8.3 Woran wir arbeiten können - das rhetorische Handwerkszeug 8.4 Sicheres Auftreten braucht Übung 8.5 Erklären und überzeugen 8.6 Anschaulich und lebendig sprechen 8.7 Präsenz zeigen 8.8 Stimmlich überzeugen 8.9 Lampenfieber - die Spannung nutzen 8.10 Vertiefung Literatur und Internet-Links Sachregister Über die Autorin

Note: N.F. entfällt ab 57.2000. - Volltext auch als Teil einer Datenbank verfügbar , Ersch. ab 2000 in engl. Sprache mit dt. Hauptsacht.

Note: Contents Foreword Preface Acknowledgments Part I: The Need for Diversity Management Chapter 1 - The Business Case for Diversity Chapter 2 - Introduction to Diversity Measurement Part II: The Diversity Return-on-Investment (DROI) Process Chapter 3 - Introduction to the Diversity ROI Process Chapter 4 - Planning and Collecting Data Chapter 5 - Evaluating Diversity's Contribution Chapter 6 - Track and Assess Progress Part III: Building a Diversity Scorecard Chapter 7 - Basic Diversity Scorecard Components Chapter 8 - Diversity Leadership Commitment Perspective Chapter 9 - Workforce Profile Perspective Chapter 10 - Workplace Culture/Climate Perspective Chapter 11 - Learning and Growth Perspective Chapter 12 - Diverse Customer/Community Partnership Perspective Chapter 13 - Financial Impact Perspective Chapter 14 - Building Your Diversity Scorecard Part IV: Implementation Issues Chapter 15 - Achieving Strategic Alignment from Top to Bottom Chapter 16 - Implementing the Diversity Scorecard Process Appendix A - Hubbard Diversity Measurement and Productivity (DM&P) Institute: Creating Applied Sciences for Measuring Diversity Performance and Results Index About the Author

Note: ""Cover""; ""Contents""; ""Acknowledgments""; ""Chapter 1 Introduction""; ""1.1 Types of Disease""; ""1.2 Characterization of Diseases""; ""1.3 Control of Infectious Diseases""; ""1.4 What Are Mathematical Models?""; ""1.5 What Models Can Do""; ""1.6 What Models Cannot Do""; ""1.7 What Is a Good Model?""; ""1.8 Layout of This Book""; ""1.9 What Else Should You Know?""; ""Chapter 2 Introduction to Simple Epidemic Models""; ""2.1 Formulating the Deterministic SIR Model""; ""2.1.1 The SIR Model Without Demography""; ""2.1.1.1 The Threshold Phenomenon""; ""2.1.1.2 Epidemic Burnout"". , ""2.1.1.3 Worked Example: Influenza in a Boarding School""""2.1.2 The SIR Model With Demography""; ""2.1.2.1 The Equilibrium State""; ""2.1.2.2 Stability Properties""; ""2.1.2.3 Oscillatory Dynamics""; ""2.1.2.4 Mean Age at Infection""; ""2.2 Infection-Induced Mortality and SI Models""; ""2.2.1 Mortality Throughout Infection""; ""2.2.1.1 Density-Dependent Transmission""; ""2.2.1.2 Frequency Dependent Transmission""; ""2.2.2 Mortality Late in Infection""; ""2.2.3 Fatal Infections""; ""2.3 Without Immunity: The SIS Model""; ""2.4 Waning Immunity: The SIRS Model"". , ""2.5 Adding a Latent Period: The SEIR Model""""2.6 Infections with a Carrier State""; ""2.7 Discrete-Time Models""; ""2.8 Parameterization""; ""2.8.1 Estimating R[sub(0)] from Reported Cases""; ""2.8.2 Estimating R[sub(0)] from Seroprevalence Data""; ""2.8.3 Estimating Parameters in General""; ""2.9 Summary""; ""Chapter 3 Host Heterogeneities""; ""3.1 Risk-Structure: Sexually Transmitted Infections""; ""3.1.1 Modeling Risk Structure""; ""3.1.1.1 High-Risk and Low-Risk Groups""; ""3.1.1.2 Initial Dynamics""; ""3.1.1.3 Equilibrium Prevalence""; ""3.1.1.4 Targeted Control"". , ""3.1.1.5 Generalizing the Model""""3.1.1.6 Parameterization""; ""3.1.2 Two Applications of Risk Structure""; ""3.1.2.1 Early Dynamics of HIV""; ""3.1.2.2 Chlamydia Infections in Koalas""; ""3.1.3 Other Types of Risk Structure""; ""3.2 Age-Structure: Childhood Infections""; ""3.2.1 Basic Methodology""; ""3.2.1.1 Initial Dynamics""; ""3.2.1.2 Equilibrium Prevalence""; ""3.2.1.3 Control by Vaccination""; ""3.2.1.3 Parameterization""; ""3.2.2 Applications of Age Structure""; ""3.2.2.1 Dynamics of Measles""; ""3.2.2.2 Spread and Control of BSE""; ""3.3 Dependence on Time Since Infection"". , ""3.3.1 SEIR and Multi-Compartment Models""""3.3.2 Models with Memory""; ""3.3.3 Application: SARS""; ""3.4 Future Directions""; ""3.5 Summary""; ""Chapter 4 Multi-Pathogen/Multi-Host Models""; ""4.1 Multiple Pathogens""; ""4.1.1 Complete Cross-Immunity""; ""4.1.1.1 Evolutionary Implications""; ""4.1.2 No Cross-Immunity""; ""4.1.2.1 Application: The Interaction of Measles and Whooping Cough""; ""4.1.2.2 Application: Multiple Malaria Strains""; ""4.1.3 Enhanced Susceptibility""; ""4.1.4 Partial Cross-Immunity""; ""4.1.4.1 Evolutionary Implications"". , ""4.1.4.2 Oscillations Driven by Cross-Immunity"".

Note: Cover; Contents; List of Tables; List of Figures; Acknowledgements; List of Abbreviations/Glossary; Preface; Introduction; Chapter 1 Producing Performance; Chapter 2 Selling Performance; Chapter 3 Managing Performance Over Time; Chapter 4 Sustainability and the Performance Economy; Notes; References; Index.

Note: CONTENTS Preface Photo Credits Computer Codes 1 Introduction 1-1 Why Microwaves for Remote Sensing? 1-2 A Brief Overview of Microwave Sensors 1-3 A Short History of Microwave Remote Sensing 1-3.1 Radar 1-3.2 Radiometers 1-4 The Electromagnetic Spectrum 1-5 Basic Operation and Applications of Radar 1-5.1 Operation of Remote-Sensing Radars 1-5.2 Applications of Remote-Sensing Radars 1-6 Basic Operation and Applications of Radiometers 1-6.1 Radiometer Operation 1-6.2 Applications of Microwave Radiometry 1-7 Image Examples 2 Electromagnetic Wave Propagation 2-1 EM Plane Waves 2-1.1 Constitutive Parameters 2-1.2 Maxwell's Equations 2-1.3 Complex Permittivity 2-1.4 Wave Equations 2-2 Plane-Wave Propagation in Lossless Media 2-2.1 Uniform Plane Waves 2-2.2 General Relation between E and H 2-3 Wave Polarization in a Lossless Medium 2-3.1 Linear Polarization 2-3.2 Circular Polarization 2-3.3 Elliptical Polarization 2-4 Plane Wave Propagation in Lossy Media 2-4.1 Low Loss Dielectric 2-4.2 Good Conductor 2-5 Electromagnetic Power Density 2-5.1 Plane Wave in a Lossless Medium 2-5.2 Plane Wave in a Lossy Medium 2-5.3 Decibel Scale tor Power Ratios 2-6 Wave Reflection and Transmission at Normal Incidence 2-6.1 Boundary between Lossless Media 2-6.2 Boundary between Lossy Media 2-7 Wave Reflection and Transmission at Oblique Incidence 2-7.1 Horizontal Polarization—Lossless Media 2-7.2 Vertical Polarization 2-8 Reflectivity and Transmissivity 2-9 Oblique Incidence onto a Lossy Medium 2- 10 Oblique Incidence onto a Two-Layer Composite 2-10.1 Input Parameters 2-10.2 Propagation Matrix Method 2-10.3 Multiple Reflection Method 3 Remote-Sensing Antennas 3-1 The Hertzian Dipole 3-2 Antenna Radiation Characteristics 3-2.1 Antenna Pattern 3-2.2 Beam Dimensions 3-2.3 Antenna Directivity 3-2.4 Antenna Gain 3-2.5 Radiation Efficiency 3-2.6 Effective Area of a Receiving Antenna 3-3 Friis Transmission Formula 3-4 Radiation by Large-Aperture Antennas 3-5 Rectangular Aperture with Uniform Field Distribution 3-5.1 Antenna Pattern in x-y Plane 3-5.2 Beamwidth 3-5.3 Directivity and Effective Area 3-6 Circular Aperture with Uniform Field Illumination 3-7 Nonuniform-Amplitude Illumination 3-8 Beam Efficiency 3-9 Antenna Arrays 3-10 N-Element Array with Uniform Phase Distribution 3-10.1 Uniform Amplitude Distribution 3-10.2 Grating Lobes 3-10.3 Binomial Distribution 3-11 Electronic Scanning of Arrays 3-12 Antenna Types 3-12.1 Horn Antennas 3-12.2 Slot Antennas 3-12.3 Microstrip Antennas 3-13 Active Antennas 3-13.1 Advantages of Active Antennas 3-13.2 Digital Beamforming with Active Antennas 4 Microwave Dielectric Properties of Natural Earth Materials 4-1 Pure-Water Single-Debye Dielectric Model (f 〈 50 GHz) 4-2 Saline-Water Double-Debye Dielectric Model (f〈 1000 GHz) 4-3 Dielectric Constant of Pure Ice 4-4 Dielectric Mixing Models for Heterogeneous Materials 4-4.1 Randomly Oriented Ellipsoidal Inclusions 4-4.2 Polder-van Santen/de Loor Formulas 4-4.3 Tinga-Voss-Blossey (TVB) Formulas 4-4.4 Other Dielectric Mixing Formulas 4-5 Sea Ice 4-5.1 Dielectric Constant of Brine 4-5.2 Brine Volume Fraction 4-5.3 Dielectric Properties 4-6 Dielectric Constant of Snow 4-6.1 Dry Snow 4-6.2 Wet Snow 4-7 Dielectric Constant of Dry Rocks 4-7.1 Powdered Rocks 4-7.2 Solid Rocks 4-8 Dielectric Constant of Soils 4-8.1 Dry Soil 4-8.2 Wet Soil 4-8.3 εsoil in 0.3-1.5 GHz Band 4-9 Dielectric Constant of Vegetation 4-9.1 Dielectric Constant of Canopy Constituents 4-9.2 Dielectric Model 5 Radar Scattering 5-1 Wave Polarization in a Spherical Coordinate System 5-2 Scattering Coordinate Systems 5-2.1 Forward Scattering Alignment (FSA) Convention 5-2.2 Backscatter Alignment (BSA) Convention 5-3 Scattering Matrix 5-3.1 FSA Convention 5-3.2 BSA Convention 5-3.3 Stokes Parameters and Mueller Matrix 5-4 Radar Equation 5-5 Scattering from Distributed Targets 5-5.1 Narrow-Beam Scatterometer 5-5.2 Imaging Radar 5-5.3 Specific Intensities for Distributed Target 5-6 RCS Statistics 5-7 Rayleigh Fading Model 5-7.1 Underlying Assumptions 5-7.2 Linear Detection 5-7.3 Square-Law Detection 5-7.4 Interpretation 5-8 Multiple Independent Samples 5-8.1 N-Look Amplitude Image 5-8.2 N-Look Intensity Image 5-8.3 N-Look Square-Root Intensity Image 5-8.4 Spatial Resolution vs. Radiometric Resolution 5-8.5 Applicability of the Rayleigh Fading Model 5-9 Image Texture and Despeckle Filtering . 5-9.1 Image Texture 5-9.2 Despeckling Filters 5-10 Coherent and Noncoherent Scattering 5-10.1 Surface Roughness 5-10.2 Bistatic Scattering 5-10.3 Specular Reflectivity 5-10.4 Bistatic-Scattering Coefficient 5-10.5 Backscattering Response of a Smooth Surface 5-11 Polarization Synthesis 5-11.1 RCS Polarization Response 5-11.2 Distributed Targets 5-11.3 Mueller Matrix Approach 5-12 Polarimetric Scattering Statistics 5-13 Polarimetric Analysis Tools 5-13.1 Scattering Covariance Matrix 5-13.2 Eigenvector Decomposition 5-13.3 Useful Polarimetric Parameters 5-13.4 Image Examples 5-13.5 Freeman-Durden Decomposition 6 Microwave Radiometry and Radiative Transfer 6-1 Radiometric Quantities 6-2 Thermal Radiation 6-2.1 Quantum Theory of Radiation 6-2.2 Planck's Blackbody Radiation Law 6-2.3 The Rayleigh-Jeans Law 6-3 Power-Temperature Correspondence 6-4 Radiation by Natural Materials 6-4.1 Brightness Temperature 6-4.2 Brightness Temperature Distribution 6-4.3 Antenna Temperature 6-5 Antenna Efficiency Considerations 6-5.1 Beam Efficiency 6-5.2 Radiation Efficiency 6-5.3 Radiometer Measurement Ambiguity 6-6 Theory of Radiative Transfer 6-6.1 Equation of Radiative Transfer 6-6.2 Brightness-Temperature Equation 6-6.3 Brightness Temperature of a Stratified Medium 6-6.4 Brightness Temperature of a Scatter-Free Medium 6-6.5 Upwelling and Downwelling Atmospheric Brightness Temperatures 6-7 Terrain Brightness Temperature 6-7.1 Brightness Transmission Across a Specular Boundary 6-7.2 Emission by a Specular Surface 6-7.3 Emissivity of a Rough Surface 6-7.4 Extreme Surface Conditions 6-7.5 Emissivity of a Two-Layer Composite 6-8 Downward-Looking Satellite Radiometer 6-9 Polarimetric Radiometry 6-10 Stokes Parameters and Periodic Structures 7 Microwave Radiometric Systems 7-1 Equivalent Noise Temperature 7-2 Characterization of Noise 7-2.1 Noise Figure 7-2.2 Equivalent Input Noise Temperature 7-2.3 Noise Temperature of a Cascaded System 7-2.4 Noise Temperature of a Lossy Two-Port Device 7-3 Receiver and System Noise Temperatures 7-3.1 Receiver Alone 7-3.2 Total System Including Antenna 7-4 Radiometer Operation 7-4.1 Measurement Accuracy 7-4.2 Total-Power Radiometer 7-4.3 Radiometric Resolution 7-5 Effects of Receiver Gain Variations 7-6 Dicke Radiometer 7-7 Balancing Techniques 7-7.1 Reference-Channel Control Method 7-7.2 Antenna-Channel Noise-Injection Method 7-7.3 Pulsed Noise-Injection Method 7-7.4 Gain-Modulation Method 7-8 Automatic-Gain-Control (AGC) Techniques 7-9 Noise-Adding Radiometer 7-10 Summary of Radiometer Properties 7-11 Radiometer Calibration Techniques 7-11.1 Receiver Calibration 7-11.2 Calibration Sources 7-11.3 Effects of Impedance Mismatches 7-11.4 Antenna Calibration 7-11.5 Cryoload Technique 7-11.6 Bucket Technique 7-12 Imaging Considerations 7-12.1 Scanning Configurations 7-12.2 Radiometer Uncertainty Principle 7-13 Interferometric Aperture Synthesis 7-13.1 Image Reconstruction 7-13.2 MIR Radiometric Sensitivity 7-14 Polarimetric Radiometer 7-14.1 Coherent Detection 7-14.2 Incoherent Detection 7-15 Calibration of Polarimetric Radiometers 7-15.1 Forward Model for a Fully Polarimetric Radiometer 7-15.2 Forward Model for the Polarimetric Calibration Source 7-15.3 Calibration by Inversion of the Forward Models 7-16 Digital Radiometers 8 Microwave Interaction with Atmospheric Constituents 8-1 Standard Atmosphere 8-1.1 Atmospheric Composition 8-1.2 Temperature Profile 8-1.3 Density Profile 8-1.4 Pressure Profi

Note: Contents 1 High elevation treelines 1.1 The task 1.2 Previous works 2 Definitions and conventions 2.1 The life form ‘tree’ 2.2 Lines and transitions 2.3 Limitation, stress and disturbance 2.4 Altitude-related and other environmental drivers 2.5 Treeline nomenclature 3 Treeline patterns 3.1 Treeline taxa 3.2 The summit syndrome and other treeline depressions 3.3 Mass elevation effect 3.4 Treeline elevation 3.5 Time matters 3.6 Forest structure near treeline 4 Treeline climate 4.1 Specific aspects of treeline climatology 4.2 Criteria to define temperature regimes at treeline 4.3 Treeline temperatures in different bioclimatic regions 4.3.1 Subarctic and boreal zone (45–68° N) 4.3.2 Cool temperate zone (45–47° N, 44° S) 4.3.3 Warm temperate zone (28–42° N, 36° S) 4.3.4 Subtropical zone (19° S, 19° N) 4.3.5 Equatorial tropics (6° N to 3° S) 4.3.6 Mediterranean ‘treelines’ (38–42° N) 4.3.7 The Nothofagus and Metrosideros case 4.3.8 Treeline temperatures across bioclimatic zones 4.4 Seedbed and branch temperatures 4.5 Whole forest temperatures 5 Global mountain statistics based on treeline elevation 5.1 Mountain geostatistics 5.2 Elevational belts 5.3 Global treeline ecotones 6 Structure and stature of treeline trees 6.1 Foliage properties 6.2 Wood properties 6.3 Bark properties 6.4 Root traits 6.5 Tree stature 6.6 Dry matter allocation in treeline trees 7 Growth and development 7.1 Tree growth near the treeline 7.1.1 In situ growth of seedlings 7.1.2 In situ growth of saplings and adult trees 7.2 Xylogenesis at the treeline 7.2.1 In situ cambial activity 7.2.2 Apical growth dynamics 7.3 Root growth 7.4 Phenology at the treeline 8 Evolutionary adjustments to life at the treeline 8.1 Phylogenetic selection 8.2 Genotypic responses of growth and development 8.3 Genotypic responses of physiological traits 9 Reproduction, early life stages and tree demography 9.1 Amount and quality of seeds at high elevation 9.2 Germination, seedling and sapling stage 9.3 Tree demography at the treeline 10 Freezing and other forms of stress 10.1 Stress at the treeline in a fitness context 10.2 Mechanisms and principles of freezing resistance 10.3 Freezing resistance in treeline trees 10.4 Other forms of stress at the treeline 10.4.1 Freeze-thaw cycles and hydraulic failure 10.4.2 Winter desiccation 11 Water, nutrient and carbon relations 11.1 Tree water relations during the growing season 11.2 Nutrient relations 11.3 Carbon relations 12 Treeline formation - currently, in the past and in the future 12.1 Causes of current treelines 12.2 Treelines in the recent past 12.3 Treelines in the distant past (Holocene) 12.4 Treelines in the future References Subject Index Taxonomic Index

Note: Foreword; Acknowledgements; List of participating members of the Expert Group; CONTENTS; List of tables; List of figures; Executive summary; Part I: Methodology and Data on Levelised Costs for Generating Electricity; Chapter 1 Introduction and context; Chapter 2 Methodology, conventions and key assumptions; Chapter 3 Technology overview; Chapter 4 Country-by-country data on electricity generating costs for different technologies; Part 2: Sensitivity analyses and boundary issues; Chapter 5 Median case; Chapter 6 Sensitivity analyses. , Chapter 7 System integration aspects of variable renewable power generationChapter 8 Financing issues; Chapter 9 Levelised costs and the working of actual power markets; Chapter 10 Carbon capture and storage; Chapter 11 Synthesis report on other studies of the levelised cost of electricity; ANNEXES; Annex 1 Issues concerning data from non-OECD countries and assumptions forthe electricity generating cost calculations; Annex 2 List of abbreviations;.

Note: Cover; Copyright; Praise; Introduction; Contents; Section 1: THINK IT; The First Thing to Do When You Find Yourself in a Hole: Stop Digging; Stay Positive; Never Lose Faith; Seven Career Lessons I Learned from Selling Ginsu Knives; A Turning Point; Stop. Breathe. Think. Then Act.; Overcoming Inertia; Overcoming Fear; Keep Swimming; Section 2: DO IT; What Is a Resume?; What Are Managers Looking For?; Dirty Little Resume Secrets; The T-Bomb; Current Experience; What You Do Is More Important than What You're Called; The Top Ten Mistakes Professionals Make When Looking for Work. , Resumes: A SummaryCover Your Letter; Following Up; Getting Interviews; Be Proactive; Be Visible; Social Networking; Four Critical Steps to Getting a Job Offer; Send Out Ships; Gold Calling; Section 3: HAVE IT; Creating the Path; Recession-Proof Your Career; Creating a PR Campaign; Taking the Initiative; Increase Your Ability to Find Work; Advancing Your Career through Personal Branding; Advancing Your Career through Progressive Information Disclosure; Honing Your Workplace Negotiation Skills; The Sky's the Limit; What Are You Waiting For?; About Making Money; Creating the Life You Want. , Recommended ReadingAbout the Author.

Note: Introduction -- Geodetic Data Collection Techniques -- Geodetic datum and Geodetic Control Network -- Geoid and Height System -- Reference Ellipsoid and Geodetic Coordinate System -- Gauss and UTM Conformal Projection and Plane Rectangular Coordinate System -- Establishment of Geodetic Coordinate System

Note: Cover; Contents; Preface and Overview; Acknowledgments; Introduction to the 2014 Edition; 1. The Distinctiveness of Comparative Social Science; 2. Heterogeneity and Causal Complexity; 3. Case-Oriented Comparative Methods; 4. The Variable-Oriented Approach; 5. Combined Versus Synthetic Comparative Strategies; 6. A Boolean Approach to Qualitative Comparison: Basic Concepts; 7. Extensions of Boolean Methods of Qualitative Comparison; 8. Applications of Boolean Methods of Qualitative Comparison; 9. The Dialogue of Ideas and Evidence in Social Research; Bibliography; Index.

Note: Deckblatt; Titelseite; Impressum; Inhaltsverzeichnis; Vorwort; 1 Die Bedeutung von Moral und Ethik für den wirtschaftlichen Entwicklungsprozess; 2 Zur Entwicklung einer Horden- und Stammesmoral; 2.1 Vorgeschichte: Ein interdisziplinäres Projekt; 2.2 Rahmenbedingungen vorgeschichtlicher Existenz; 2.2.1 Biologische‚ anthropologische und soziale Entwicklungen; 2.2.2 Grundlinien einer Ökonomie der Steinzeit; 2.3 Denkweise‚ wirtschaftliches Verhalten und Moralität; 2.3.1 Von mythisch-magischer und dogmatischer Denkweise; 2.3.2 Moral in der Horde; 2.3.3 Moral und wirtschaftliches Verhalten. , 3 Griechische Antike: Die Lehre vom wohlgeordneten Haus3.1 Zeitliche Einordnung der griechischen Antike; 3.2 Wirtschaftliche, soziale und politische Verhältnisse; 3.3 Entstehung antiker Philosophie und Ethik; 3.3.1 Vom Mythos zum Logos; 3.3.2 Sokrates, Platon und Aristoteles: Ihre Beiträge im Überblick; 3.4 Drei grundlegende Erkenntniswege; 3.5 Tugendethik - Leitlinien für eine Individualethik; 3.6 Der wohlgeordnete Kosmos: Ordnungsethik für eine geschlossene Gesellschaft; 3.6.1 Zum Verhältnis von Oikos und Polis. , 3.6.2 Unnatürliche Erwerbskunst (Chrematistik) und die Institutionen der Marktwirtschaft3.7 Das Erbe der griechischen Antike; 4 Jüdische und frühchristliche Traditionen: Gerechtigkeit, Liebe und Barmherzigkeit; 4.1 Ursprung und Verbreitung des jüdischen und christlichen Glaubens; 4.2 Politische‚ wirtschaftliche und soziale Entwicklung in Palästina; 4.3 Religiös-biblische Traditionen und ihr Beitrag zur Ethik; 4.3.1 Die Bibel als Quelle religiöser und moralischer Vorstellungen; 4.3.2 Zum Zusammenhang von Religion‚ Recht und Moral; 4.3.3 Ethische Grundaspekte im Alten und Neuen Testament. , 4.4 Maßstäbe für wirtschaftliches Handeln aus biblischer Sicht4.4.1 Arbeitsethos‚ Erwerbsstreben und Genuss; 4.4.2 Eigentum‚ Sozialbindung‚ Zins und Preis; 4.4.3 Macht‚ Herrschaft und staatliche Redistribution; 4.4.4 Gerechtigkeit und Gleichheit; 4.4.5 Ausdifferenzierung der Wirtschaft: Handel und Geldwesen; 4.5 Der Beitrag der jüdisch-christlichen Ethik zur Entfaltung wirtschaftsethischer Kategorien; 5 Mittelalter: die Moralphilosophie als »Magd der Theologie«; 5.1 Zeitliche Einordnung; 5.2 Das »finstere« Mittelalter: Wirtschaftliche‚ soziale und politische Verhältnisse. , 5.3 Das mittelalterliche Weltbild und die Stellung der Kirche5.4 Patristik und Scholastik: Wichtige Denker und ihr Beitrag; 5.5 Schöpfungsordnung‚ Wirtschaften und Wirtschaftsethik; 5.5.1 Die Einbettung der Wirtschaft in die Schöpfungsordnung; 5.5.2 Tugendethik und Wirtschaften; 5.5.3 Wirtschaftsethische Lehren der Scholastik; 5.5.4 Von frommen Klosterbrüdern‚ edlen Rittern und sündigen Kaufleuten; 5.6 Das Mittelalter: Finsteres Zeitalter und Nährboden für eine neuzeitliche Wirtschaftsethik; 6 Neuzeit: Herausbildung einer marktwirtschaftlich-kapitalistischen Ethik; 6.1 Zeitliche Einordnung. , 6.2 Wirtschaftliche‚ soziale und politische Entwicklungslinien.

Note: IntroductionConditional expectations and related concepts in econometrics -- Basic asymptotic theory -- Single-equation linear model and ordinary least squares estimation -- Instrumental variables estimation of single-equation linear models -- Additional single-equation topics -- Estimating systems of equations by ordinary least squares and generalized least squares -- System estimation by instrumental variables -- Simultaneous equations models..

Note: Problemanalyse und ÜberblickNeue Institutionen: Zukunftsräte -- Neue Institutionen: Ombudspersonen -- Ergänzungen und Alternativen: Ein Weltgerichtshof; Mehr Bürgerbeteiligung; Hoffnung auf die Dynamik der Verhandlungsrealitäten -- Ombudspersonen in Unternehmen?..

Note: Preface; Contributors; Content; Introduction; Cosmology - The Largest Possible Model?; The Standard Model of Cosmology as a Tool for Interpretation and Discovery; Patterns in Physical and Biological Systems; Symmetry and the Explanation of Organismal Form; Pluralistic Modeling of Complex Systems; The Methodological Challenges of Complex Systems; Contested Modeling: The Case of Economics; A Unifying Approach to High- and Low-Level Cognition; High-vs Low-Level Cognition and the Neuro- Emulative Theory of Mental Representation. , Evaluating a Computational Model of Eye-Movement Control in ReadingConsidering Criteria for Model Modification and Theory Change in Psychology; Identification of Kinetic Models by Incremental Refinement; Kinetics, Models, and Mechanism; Modeling Complexity: The Case of Climate Science; Chaos, Plurality, and Model Metrics in Climate Science; Subject Index; Author Index.

Note: Front cover; Title page; Copyright page; Contents; Dedication; Friends of the Earth: rethinking travel; Foreword; Preface; Introduction; PART 1: THINKING BEYOND FLYING; Chapter 1: To fly or not to fly?; Chapter 2: Deciding never to fly again; Chapter 3: Young people and climate change; Chapter 4: Waking up to the downsides of flying; Chapter 5: Slow and low - the way to go: a systems view of travel emissions; PART 2: BUSINESS BEYOND FLYING; Chapter 6: A green travel experiment; Chapter 7: Trains versus planes: building a low-carbon travel agency. , Chapter 8: Going cold turkey: a law practice without any flightsChapter 9: The no-flying conference: Signs of Change; Chapter 10: Slowlier than thou: why flight-free travel is about better, not less; PART 3: SAVOURING THE JOURNEY; Chapter 11: The human engine: bicycling to Beijing; Chapter 12: Walking distance; Chapter 13: bike2oz: the world going through you instead of around you; Chapter 14: A small matter of distance: trying not to fly to climate talks; Chapter 15: Travel on a hot planet: exploring the global tourist industry overland; How to fly less; Index; Other Green Books titles. , About Green Books.

Note: Cover; Title Page; Copyright Page; Dedication Page; Table of Contents; Acknowledgments; Part One: Prehistory; 1. Introduction; 2. Sex and Salesmanship; 3. Seduction and the Emotions; 4. Social Primates; Part Two: Today; 5. Testing for Talent; 6. What Do Women Want?; 7. Coalitions of the Willing; 8. The Scarcity of Charm; 9. The Tender War; Notes; References; Index.

Note: Cover; Title; Copyright; CONTENTS; Acknowledgments; PART I. THE COMPLEXITY FRAME FOR POLICY; Chapter 1. Twin Peaks; Chapter 2. Government With, Not Versus, the Market; Chapter 3. I Pencil Revisited: Beyond Market Fundamentalism; Chapter 4. The Complexity Policy Frame; PART II. EXPLORING THE FOUNDATIONS; Chapter 5. How Economics Lost the Complexity Vision; Chapter 6. How Macroeconomics Lost the Complexity Vision; Chapter 7. Complexity: A New Kind of Science?; Chapter 8: A New Kind of Complexity Economics?; Chapter 9. Nudging toward a Complexity Policy Frame. , PART III. LAISSEZ-FAIRE ACTIVISM IN PRACTICEChapter 10. The Economics of Influence; Chapter 11. Implementing Influence Policy; Chapter 12. Laissez-Faire Activism; Chapter 13. Getting the Ecostructure of Government Right; PART IV. THE LOST AGENDA; Chapter 14. Getting the Ecostructure of Social Science Education Right; Chapter 15. The Lost Agenda; Notes; Bibliography; Index.

Note: Contents; Preface; 1 Introduction; 2 Fundamentals of rock failure physics; 2.1 Mechanical properties and constitutive relations; 2.1.1 Elastic deformation; 2.1.2 Ductile deformation; 2.1.3 Fracture; 2.1.4 Friction; 2.2 Basics of rock fracture mechanics; 2.2.1 Energy release rate and resistance to rupture growth; 2.2.2 Stress concentration and cohesive zone model; 2.2.3 Breakdown zone model for shear failure; 2.2.4 j-integral and energy criterion for shear failure; 2.2.5 Relation between resistance to rupture growth and constitutive relation parameters. , 3 Laboratory-derived constitutive relations for shear failure3.1 Shear failure of intact rock; 3.1.1 Method and apparatus used; 3.1.2 Constitutive relations derived from data on the shear failure of intact rock; 3.1.3 Geometric irregularity of shear-fractured surfaces and characteristic length; 3.2 Frictional slip failure on precut rock interface; 3.2.1 Method and apparatus used; 3.2.2 Geometric irregularity of precut fault surfaces and characteristic length; 3.2.3 Constitutive relations derived from data on frictional stick-slip failure. , 3.2.4 Laboratory-derived relationships between physical quantities observed during dynamic slip rupture propagation3.3 Unifying constitutive formulation and a constitutive scaling law; 3.3.1 Unification of constitutive relations for shear fracture and for frictional slip failure; 3.3.2 A constitutive scaling law; 3.3.3 Critical energy required for shear fracture and for frictional stick-slip failure; 3.3.4 Stabilityinstability of the breakdown process; 3.3.5 Breakdown zone size; 3.4 Dependence of constitutive law parameters on environmental factors; 3.4.1 Introduction. , 3.4.2 Dependence of shear failure strength on environmental factors3.4.3 Dependence of breakdown stress drop on environmental factors; 3.4.4 Dependence of breakdown displacement on environmental factors; 4 Constitutive laws for earthquake ruptures; 4.1 Basic foundations for constitutive formulations; 4.2 Rate-dependent constitutive formulations; 4.3 Slip-dependent constitutive formulations; 4.4 Depth dependence of constitutive law parameters; 5 Earthquake generation processes; 5.1 Shear failure nucleation processes observed in the laboratory; 5.1.1 Introduction; 5.1.2 Experimental method. , 5.1.3 Nucleation phases observed on faults with different surface roughnessesRough fault; Smooth fault; Extremely smooth fault; 5.1.4 Scaling of the nucleation zone size; 5.2 Earthquake rupture nucleation; 5.2.1 Seismogenic background; 5.2.2 Physical modeling and theoretical derivation of the nucleation zone size; 5.2.3 Comparison of theoretical relations with seismological data; 5.2.4 Foreshock activity associated with the nucleation process; 5.3 Dynamic propagation and generation of strong motion seismic waves; 5.3.1 Slip velocity and slip acceleration in the breakdown zone. , 5.3.2 The cutoff frequency fs max of the power spectral density of slip acceleration at the source.

Note: Inhalt; Über dieses Buch; Teil I Einführungen: Theorien der Erzählungen; Erzählen. Die ethisch-politische Funktion narrativer Diskurse; 1 Narrative Diskurse: Eigenschaften und Funktionen; 1.1 Die narrative Kunst der Begründung; 1.2 Ein semantisches Modell der Erzählung: Algirdas J. Greimas' Aktantentheorie; 1.3 Narrative Begründungen: Eine semantische Typologie; 1.4 Die Schuld und die Vergebung: Zum Verantwortungsmanagement narrativer Diskurse; 1.5 In medias res: Warum Erzählungen oft mit dem Ende beginnen; 1.6 Die doppelte Referenz: Das Allgemeine und das Einzigartige. , 2 Die Erzähler und ihr Publikum: Zur Öffentlichkeit narrativer Diskurse2.1 Öffentliche Urteile: Die Erzähler und ihr Publikum; 2.2 Die zwei Stimmen des Erzählers; 2.3 Die Präsenz des Erzählers in der Erzählung; 2.4 Die Öffentlichkeiten des Erzählers; 2.5 Autobiografisches Erzählen: Der innere Dialog und das Denken; 2.6 Ausblick: Die Öffentlichkeitsregime narrativer Diskurse; Literatur; »Menschen lesbarer machen«1: Narration, Diskurs,Referenz; 1 Narrationen als sozialwissenschaftliches Konzept; 1.1 Erzählungen zwischen Text und Handlung; 1.2 Typen der Erzählung. , 1.3 Zur lebensweltlichen Einbettung von Narrativen2 Zum Verhältnis von Narration und Diskurs; 2.1 Brauchen Diskurse Erzählungen?; 2.2 Narrationen als Sprech-Handlungen (über Satzniveau); 3 Erzählungen: Strukturen, Ereignisse und dieKomposition der Fabel; 3.1 Narration und Fabelkomposition; 3.2 Ebenen der Erzählung; 3.3 Kollektiv-Symbole und ihre Erzählungen; 3.4 Narrative und ihre Bedeutung für die kulturelle Reproduktion und Innovation; 4 Referenz und Erzählung: Jenseits der Innenwelt von Texten; 4.1 Öffentliche Erzählungen als Mimesis von Handlungen?. , 5 ConclusioLiteratur; Öffentliche Erzählungen und der globale Wandel des Klimas; 1 Einleitung; 2 Der Mensch als Klimageschichtenerzähler; 2.1 Was heißt Narrativisierung des Klimas?; 2.2 Narrationen als Geburtshelfer möglicher Welten; 2.3 Klimageschichten sind lebende Geschichten; 3 Globaler Klimawandel: Geburt eines Konzepts; 4 Sechs Varianten der Narrativisierung des globalenKlimawandels; 4.1 Das »globale Treibhaus« als anthropogene Katastrophe; 4.2 Anthropogene Eiszeiten: die Katastrophe des; 4.3 Die Geschichte vom »nuklearen Winter«; 4.4 »Paradiesische Warmzeiten«. , 4.5 Die ewige Wiederkehr der »Sonnenflecken«: Normalität statt Katastrophe. , 4.2 Die Konfiguration von Charakteren in öffentlichen Erzählungen4.3 Re-figuration und die Rolle des Lesers; Teil II Erzählungen in den Medien; Kollektivsymbolik und die deutsche Krise seit dem Jahr 2000; Heimat, Natur und die gute alte Zeit. Erzählungenüber Nachhaltige Entwicklung im Spannungsfeldöffentlicher und wissenschaftlicher Diskurse1; 1 Einleitung; 2 Wissenschaftliche Diskurse über Nachhaltige Entwicklung; 3 Nachhaltige Ernährung und Ernährungskommunikation; 4 Erzählungen über Ernährung in den Medien; 4.1 Polarisierende Rhetorik; 4.2 Affirmative Rhetorik; 4.3 Reflektierende Rhetorik.

Note: The democratic promiseThe deliberative turn in democratic theory -- The elusive concept of empathy -- Empathy in deliberative theory -- Empathy's importance : the empirical evidence -- Deliberative democracy and its critics -- Empathy and democracy..

Note: Particle Drifts and the First Adiabatic InvariantParticle Trapping, Drift Shells and the Second Adiabatic Invariant -- Periodic Drift Motion and the Third Adiabatic Invariant -- Trapped Particle Distributions and Flux Mapping -- Violation of the Adiabatic Invariants and Trapped Particle Diffusion -- Introduction to Plasma Physics..

Note: section A. Language, ideology and powersection B. Discourse and sociocultural change -- section C. Dialectics of discourse: theoretical developments -- section D. Methodology in CDA research -- section E. Political discourse -- F. Globalisation and 'transition' -- section G. Language and education..

Note: Vorwort zur zweiten Auflage; Vorwort; Inhalt; Abkürzungen; Einführung; Teil I; Eine kurze Geschichte der Energiewende; Fukushima und Ausstieg (2011); Fundamente der Energiewende (1980 - 1998); EnWG und EEG (1998 - 2003); Emissionshandel und Energiepreise (2003 - 2008); Netzregulierung und EEG (2004 - 2008); Krise in Europa (2009 - 2012); Teil II; Die Zukunft der Energiewende; Standortbestimmung (2013); 2050: Energiewende; Fossile Primärenergien; Die Regenerativen; Energiesystem der Zukunft; Politik für die Energiewende; 1 Braunkohle und Erdgas; 2 Auslaufbetrieb der Kernenergie ; 3 Energieeffizienz ; 4 Emissionshandel ; 5 EEG Reform ; 6 Regulierung der Stromnetze ; 7 Strommarktgestaltung ; 8 Koordinierung der Energiewende ; Zusammenfassung.

Note: Cover; Half title; Title; Copyright; Contents; Contributors; Preface; 1 Introduction; 2 Intraplate earthquakes in Australia; 2.1 Introduction; 2.2 Two centuries of earthquake observations in Australia; 2.2.1 Mechanism, geographic distribution, and strain rate; 2.2.2 Seismogenic depth; 2.2.3 Attenuation and scaling relations; 2.3 A long-term landscape record of large (morphogenic) earthquakes; 2.3.1 Variation in fault scarp length and vertical displacement; 2.3.2 The influence of crustal type and character on seismic activity rates; 2.4 Patterns in earthquake occurrence. , 2.5 Maximum magnitude earthquake2.5.1 Scarp length as a proxy for paleo-earthquake magnitude; 2.6 Implications for SCR analogue studies: factors important in earthquake localisation; 2.6.1 Mechanical and thermal influences; 2.6.2 Structural architectural influences; 2.7 Conclusions; Acknowledgements; 3 Intraplate seismicity in Brazil; 3.1 Introduction; 3.2 Earthquake catalogue; 3.3 Seismicity map; 3.4 Seismotectonic correlations; 3.4.1 Lower seismicity in Precambrian cratonic provinces; 3.4.2 Intraplate seismicity and cratonic roots; 3.4.3 Passive margin seismicity. , 3.4.4 Influence of neotectonic faults3.4.5 Flexural stresses; 3.5 Discussion and conclusions; Acknowledgments; 4 Earthquakes and geological structures of the St. Lawrence Rift System; 4.1 Introduction; 4.2 Historical earthquakes and their impact; 4.3 Seismic zones of the SLRS; 4.3.1 Charlevoix; 4.3.2 Lower St. Lawrence; 4.3.3 Western Quebec; 4.3.4 Background seismicity; 4.4 The St. Lawrence Rift System; 4.5 The rift hypothesis and the SLRS: discussion and conclusions; Acknowledgments; 5 Intraplate earthquakes in North China; 5.1 Introduction; 5.2 Tectonic background; 5.2.1 Geological history. , 5.2.2 Lithospheric structure5.2.3 Major seismogenic faults; 5.3 Active tectonics and crustal kinematics; 5.4 Strain rates and seismicity; 5.5 Seismicity; 5.5.1 Paleoseismicity; 5.5.2 Large historic events; 1303 Hongdong earthquake (M 8.0); 1556 Huaxian earthquake (M 8.3); 1668 Tancheng earthquake (M 8.5); 1679 Sanhe earthquake (M 8.0); 1695 Linfen earthquake (M 7.5-8.0); 5.5.3 Large instrumentally recorded earthquake; The 1966 Xingtai earthquake (Ms 7.2); The 1975 Haicheng earthquake (Ms 7.3); The 1976 Tangshan earthquake (Ms 7.8); 5.6 Spatiotemporal patterns of large earthquakes. , 5.6.1 Long-distance roaming of large earthquakes5.6.2 Fault coupling and interaction; 5.6.3 A conceptual model for mid-continental earthquakes; 5.7 Implications for earthquake hazards; Acknowledgements; 6 Seismogenesis of earthquakes occurring in the ancient rift basin of Kachchh, Western India; 6.1 Introduction; 6.2 Tectonic framework, structure, and tectonic evolution of Kachchh Rift basin; 6.2.1 Structure and tectonics; 6.2.2 Tectono-volcanic events; 6.2.3 Tectonic evolution and existing earthquake generation models of the Kachchh Rift zone. , 6.2.4 Identification of magmatic intrusive bodies.